3PVRB

The phenylacetyl-coa monooxygenase paaac subcomplex with benzoyl-coa
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
236
structure length
236
Chain Sequence
SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylacetic acid degradation protein paaA
publication title Structural and Functional Studies of the Escherichia coli Phenylacetyl-CoA Monooxygenase Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 99
structure length 236
sequence length 236
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pvrB00
4TW3A 3SE1A 2F7NA 4REUA 1EUMA 5JKMG 5JKLG 2WTLA 5GN8A 2C6RA 2YW7A 3AK9A 4ISPA 3A9QA 4LQHA 3NOZX 1TK6A 4CY9A 1NNQA 1UMNA 3R2MA 5LG8A 4CMYA 1ZUJA 2FZFA 3HIUA 4KVSA 2QF9A 2CIHA 4ZL5A 2FKZA 3BT5A 4CYAA 3NP2X 5D8RA 4CYBA 1JIGA 1RCEA 3TA8A 2C41A 3UNOA 2Z6MA 2JD70 5GN8B 4RC5A 4ML5A 5GU0X 3R2HA 4MY7A 3E1LA 2FG4A 2BKCA 4MUDA 1VEIA 2V2RA 4RC7A 1S3QA 3SHXA 2IB0A 2OC5A 2JD80 2FL0A 3QHBA 3QD8A 3KA9A 4ITWA 4QUWA 3R2SA 3UOIA 4PGKA 1Z6OA 2Z5QA 4TOGA 2IU2A 4MJYA 5J8SA 3BVKA 4RC5B 4EVEA 2YJKA 4IWJA 4TODA 5I4JA 3AF9X 3BVIA 1VJXA 3GHQA 4DYUA 3E2CA 5CMRA 2GYDA 2YW6A 4M35A 2V2OA 2GYQA 4RC7B 1O9RA 5FFDA 5LBHA 2W0OA 3F38A 4TOEA 4DYXA 2CEIA 3A68A 2V2IA 4M32A 4M34A 4EVBA 5E2DA 3H7GA 4A25A 3QZ3A 3BVFA 3BVLA 4CVSA 2V2JA 1Z6OM 3ES3A 5GOUA 4ZKXA 2ZA7A 3EZUA 3PVTA 1XZ3A 2HR5A 4RC8A 3RE7A 3AF8X 4LPJA 2G4HA 4ZTTA 3WVVA 4LQJA 3ISFA 2IY4A 2ZG8X 3RGDA 1LKMA 4YKHA 5ERKA 3GVYA 3MPSA 1JKUA 1UVHA 5D8XA 5GU2X 1LKPA 3Q4NA 4KVQA 4LYUA 4ZLWA 4M33A 3WVWA 2V2NA 3GE4A 3PVTB 2ZG7X 4TOFA 2CF7A 1SQ3A 3OGHA 3FVBA 1NF6A 3U90A 3KA4A 4Y08A 3F37A 5FFBA 1RCDA 5E1UA 1JGCA 2V2SA 4CVPA 1HRSA 3PW8C 3EZ0A 2XKQA 3AF7X 1NFVA 4RC6A 4TOAA 2ZURX 2XGWA 5IX6A 5LG2A 1TKPA 1MFRA 3ISEA 1RCGA 2UX1A 1BCFA 4PG1A 4PG0A 2QQYA 4Z3BA 1LKOA 4AM2A 5K53A 3E1NA 1VELA 3F34A 4PGIA 4MN9A 4U3GA 1JI5A 3PW1A 5J8WA 4XGSA 4DZ0A 3KA8A 3HL1A 1N1QA 1Z4AA 1F30A 2Z90A 2Y3QA 3AJQA 4RC6B 2FFXJ 5FFAA 1J30A 4EVCA 2C2JA 2BK6A 2ZG9X 5GU3X 3KX9A 2V2MA 2ZA6A 1S2ZA 3NP0X 2ITBA 4CVTA 4LYXA 1VLGA 5C6FA 3PW1B 1H96A 3F36A 4DYZA 3PWFA 2CLBA 2X170 1JYBA 1IESA 5JACA 3PW8A 1L8IA 3PVYA 4XKSA 4MKUA 3RD0A 3F32A 3RBCA 3EGMA 2BJYA 3Q4OA 3FSEA 4ZKHA 1VEQA 4ERUA 3F39A 4AM5A 2CN6A 1TJOA 1YV1A 4TO9A 3VNXA 3KA3A 5D8SA 3E1MA 1S30A 2VZBA 4CMYV 1YUXA 3OJ5A 3PZAA 3WNWA 4LQVA 4LPMA 1AEWA 1F33A 3KWOA 2GS4A 3O7RA 3E1OA 4ZMCA 4ZJKA 1DPSA 1R03A 2JD60 1RYTA 5HJHA 4ITTA 3IQ1A 2PYBA 1IERA 1JTSA 4E6KA 2CLUA 3Q4QA 3E6RA 1RCCA 4P18A 1ZS3A 3KXUA 1DATA 4EVDA 4AM4A 3F33A 3PVRA 4LQNA 1JKVA 3QB9A 5AXSA 4LPNA 1L8HA 3E1JA 4CVRA 1FHAA 1SOFA 1GWGA 5HJFA 2Z5RA 2ZA8A 3R2KA 3BKNA 5J93A 1BG7A 1MOJA 4DE6A 4DI0A 5CMQA 1TKOA 5LS9A 4XKTA 1YUZA 2V2LA 3PWQC 3FI6A 3PVRB 3AK8A 4DYYA 4TOHA 3RAVA 1QGHA 3IS8A 2OH3A 4II4A 2V2PA 5FEJA 3Q4RA 3SH6A 3AJOA 2C2FA 3IS7A 3T9JA 5HQOA 1QYBA 4Z5SA 4ISMA 5D8QA 5FFEA 3QHCA 5JKMA 5JKLA 3QVDA 2FJCA 3SIDA 3WVUA 2C2UA 5FFCA 2HTNA 5K52A 5GU1X 2CHPA 1BFRA 3KA6A 4II4B 1RCIA 4TOBA 5D8OA 1OTKA 4ZKWA 3AJPA 3R2LA 5D8PA 2VXXA 4TOCA 2BW1A 4XKUA 3F35A 2XJMA 2D5KA 5D8YA 3PWQA 2VXIA 1B71A 1JREA 1LB3A 2FG8A 2RBDA 3ERZA 3E6SA 5ERJA 2XJNA 1XZ1A 2XJOA 3BVEA 2Z5PA 1DVBA 3O7SA 4DASA 4IXKA 2V15A 2WLAA 4ZL6A 4KVRA 5J9VA 3PVYB 4OYNA 3UOFA 1O9IA 3E1QA 2WLUA 1KRQA 3R2OA 2CN7A 5CZUA 2FHAA 2CHIA 4IWKA 4R42A 3R2RA 1NF4A 1JI4A 3E1PA 2YJJA 4ETRA
chains in the Genus database with same CATH superfamily
3W54A 4TW3A 3SE1A 2F7NA 4REUA 1EUMA 5JKMG 5JKLG 3C1ZA 2WTLA 5GN8A 2C6RA 2YW7A 3AK9A 4ISPA 3A9QA 4LQHA 3NOZX 1TK6A 4CY9A 1NNQA 1UMNA 3R2MA 5LG8A 4CMYA 1ZUJA 2FZFA 2N02A 3HIUA 4KVSA 2QF9A 2CIHA 2G38B 4ZL5A 2FKZA 3BT5A 2WWXB 4CYAA 3NP2X 5D8RA 4CYBA 1JIGA 1RCEA 3TA8A 2C41A 3UNOA 2Z6MA 2JD70 3V3KB 5GN8B 4RC5A 4ML5A 5GU0X 3R2HA 4MY7A 3E1LA 2FG4A 2BKCA 4MUDA 1VEIA 2V2RA 4RC7A 1S3QA 3SHXA 2IB0A 2OC5A 2JD80 5HU6D 2FL0A 3QHBA 2Y44A 3QD8A 3KA9A 4ITWA 4QUWA 3R2SA 3UOIA 4PGKA 1Z6OA 2Z5QA 4TOGA 2IU2A 4MJYA 5J8SA 2V8TA 3BVKA 4RC5B 4EVEA 2YJKA 2CWLA 4IWJA 4TODA 5I4JA 3AF9X 3BVIA 1VJXA 3GHQA 4DYUA 3E2CA 5CMRA 2GYDA 2YW6A 4M35A 2V2OA 2GYQA 4RC7B 1O9RA 5FFDA 5LBHA 3UFBA 2W0OA 3F38A 4TOEA 2V8UA 4DYXA 2CEIA 3A68A 2V2IA 4M32A 4M34A 4EVBA 5E2DA 3H7GA 3C1YA 4A25A 3QZ3A 3BVFA 3BVLA 3JZ9A 4CVSA 2V2JA 3KDQA 1Z6OM 3FRRA 3ES3A 5GOUA 4ZKXA 5JDOA 2ZA7A 3EZUA 3N6OA 3PVTA 1XZ3A 2HR5A 4RC8A 3RE7A 3AF8X 4LPJA 2G4HA 4ZTTA 3WVVA 4LQJA 3ISFA 2IY4A 2ZG8X 3RGDA 1LKMA 4YKHA 5ERKA 3GVYA 3MPSA 1JKUA 1UVHA 5D8XA 5GU2X 1LKPA 3KHKA 3Q4NA 4KVQA 4LYUA 4ZLWA 4M33A 3WVWA 2V2NA 3GE4A 3PVTB 2ZG7X 4TOFA 2CF7A 4MXPA 1SQ3A 3OGHA 3FVBA 1NF6A 3U90A 4YXJA 3KA4A 4Y08A 3F37A 5FFBA 1RCDA 5E1UA 1JGCA 2V2SA 4CVPA 1HRSA 3PW8C 3EZ0A 2XKQA 3AF7X 1NFVA 4RC6A 4TOAA 2ZURX 4YXMA 2XGWA 5IX6A 5LG2A 1TKPA 1MFRA 3ISEA 1RCGA 2UX1A 1BCFA 4PG1A 4PG0A 2QQYA 4Z3BA 1LKOA 4AM2A 5K53A 3E1NA 1VELA 3F34A 4PGIA 3M6JA 4MN9A 4U3GA 1JI5A 3PW1A 5J8WA 2AR0A 4XGSA 4DZ0A 3KA8A 3GGZA 3HL1A 1N1QA 1Z4AA 1F30A 2OKCA 4W4LB 2Z90A 2Y3QA 3AJQA 4RC6B 2FFXJ 5FFAA 1J30A 4EVCA 2C2JA 2BK6A 2ZG9X 5GU3X 3KX9A 2V2MA 2ZA6A 1S2ZA 3NP0X 2ITBA 4CVTA 4LYXA 1VLGA 3C23A 5C6FA 3PW1B 1H96A 3F36A 4DYZA 3PWFA 2CLBA 2X170 4W4KB 1JYBA 1IESA 5JACA 3PW8A 1L8IA 3PVYA 4XKSA 4MKUA 3RD0A 3F32A 3GGYA 3RBCA 3EGMA 2BJYA 3Q4OA 3FSEA 4ZKHA 1VEQA 4ERUA 3F39A 4AM5A 2CN6A 1TJOA 1YV1A 4TO9A 3VNXA 3KA3A 5D8SA 3E1MA 1S30A 2VZBA 4CMYV 1YUXA 3OJ5A 3PZAA 3L0MA 3WNWA 4LQVA 4LPMA 1AEWA 1F33A 3KWOA 2GS4A 4E40A 3O7RA 3E1OA 4ZMCA 3D19A 4ZJKA 1DPSA 1R03A 2JD60 1RYTA 5HJHA 4ITTA 3IQ1A 2PYBA 3DBYA 1IERA 1JTSA 4E6KA 2CLUA 3Q4QA 3C21A 3E6RA 1RCCA 4P18A 1ZS3A 3KXUA 1DATA 4EVDA 4AM4A 3F33A 3PVRA 5JDOB 4LQNA 1JKVA 3QB9A 5AXSA 4LPNA 1L8HA 3E1JA 4CVRA 1FHAA 1SOFA 1GWGA 5HJFA 2Z5RA 2ZA8A 3R2KA 3BKNA 5J93A 1BG7A 1MOJA 4DE6A 4DI0A 5CMQA 1TKOA 5LS9A 4XKTA 1YUZA 2V2LA 3PWQC 3FI6A 3PVRB 3AK8A 4DYYA 4TOHA 3RAVA 1QGHA 3IS8A 2OH3A 4II4A 2V2PA 5FEJA 3Q4RA 3SH6A 3AJOA 2C2FA 3IS7A 3T9JA 5HQOA 1QYBA 4Z5SA 4ISMA 5D8QA 5FFEA 3QHCA 5JKMA 5JKLA 3QVDA 2FJCA 3SIDA 3WVUA 2C2UA 5FFCA 2HTNA 5K52A 5GU1X 2CHPA 1BFRA 3KA6A 2MGYA 4II4B 1RCIA 4TOBA 5D8OA 1OTKA 4ZKWA 3AJPA 3VV9A 3R2LA 5D8PA 2VXXA 4TOCA 3FRSA 2BW1A 4XKUA 3F35A 2XJMA 2D5KA 5D8YA 3PWQA 2VXIA 1B71A 1JREA 1LB3A 2FG8A 2RBDA 3ERZA 3E6SA 5ERJA 4X0JA 2XJNA 4YVZA 1XZ1A 2XJOA 3BVEA 2Z5PA 3JZAB 1DVBA 3O7SA 4DASA 4IXKA 2V15A 2WLAA 4ZL6A 4KVRA 5J9VA 3PVYB 4OYNA 3VVAA 4WJG4 3UOFA 1O9IA 3E1QA 2WLUA 1KRQA 3R2OA 2CN7A 5CZUA 2FHAA 4KXRB 2CHIA 4IWKA 4R42A 3R2RA 1NF4A 1JI4A 3E1PA 2YJJA 3LKDA 4ETRA
chains in the Genus database with same CATH topology
3W54A 4TW3A 3SE1A 2F7NA 4REUA 1EUMA 5JKMG 5JKLG 3C1ZA 2WTLA 5GN8A 2C6RA 2YW7A 3AK9A 4ISPA 3A9QA 4LQHA 3NOZX 1TK6A 4CY9A 1NNQA 1UMNA 3R2MA 5LG8A 4CMYA 1ZUJA 2FZFA 2N02A 3HIUA 4KVSA 2QF9A 2CIHA 2G38B 4ZL5A 2FKZA 3BT5A 2WWXB 4CYAA 3NP2X 5D8RA 4CYBA 1JIGA 1RCEA 3TA8A 2C41A 3UNOA 2Z6MA 2JD70 3V3KB 5GN8B 4RC5A 4ML5A 5GU0X 3R2HA 4MY7A 3E1LA 2FG4A 2BKCA 4MUDA 1VEIA 2V2RA 4RC7A 1S3QA 3SHXA 2IB0A 2OC5A 2JD80 5HU6D 2FL0A 3QHBA 2Y44A 3QD8A 3KA9A 4ITWA 4QUWA 3R2SA 3UOIA 4PGKA 1Z6OA 2Z5QA 4TOGA 2IU2A 4MJYA 5J8SA 2V8TA 3BVKA 4RC5B 4EVEA 2YJKA 2CWLA 4IWJA 4TODA 5I4JA 3AF9X 3BVIA 1VJXA 3GHQA 4DYUA 3E2CA 5CMRA 2GYDA 2YW6A 4M35A 2V2OA 2GYQA 4RC7B 1O9RA 5FFDA 5LBHA 3UFBA 2W0OA 3F38A 4TOEA 2V8UA 4DYXA 2CEIA 3A68A 2V2IA 4M32A 4M34A 4EVBA 5E2DA 3H7GA 3C1YA 4A25A 3QZ3A 3BVFA 3BVLA 3JZ9A 4CVSA 2V2JA 3KDQA 1Z6OM 3FRRA 3ES3A 5GOUA 4ZKXA 5JDOA 2ZA7A 3EZUA 3N6OA 3PVTA 1XZ3A 2HR5A 4RC8A 3RE7A 3AF8X 4LPJA 2G4HA 4ZTTA 3WVVA 4LQJA 3ISFA 2IY4A 2ZG8X 3RGDA 1LKMA 4YKHA 5ERKA 3GVYA 3MPSA 1JKUA 1UVHA 5D8XA 5GU2X 1LKPA 3KHKA 3Q4NA 4KVQA 4LYUA 4ZLWA 4M33A 3WVWA 2V2NA 3GE4A 3PVTB 2ZG7X 4TOFA 2CF7A 4MXPA 1SQ3A 3OGHA 3FVBA 1NF6A 3U90A 4YXJA 3KA4A 4Y08A 3F37A 5FFBA 1RCDA 5E1UA 1JGCA 2V2SA 4CVPA 1HRSA 3PW8C 3EZ0A 2XKQA 3AF7X 1NFVA 4RC6A 4TOAA 2ZURX 4YXMA 2XGWA 5IX6A 5LG2A 1TKPA 1MFRA 3ISEA 1RCGA 2UX1A 1BCFA 4PG1A 4PG0A 2QQYA 4Z3BA 1LKOA 4AM2A 5K53A 3E1NA 1VELA 3F34A 4PGIA 3M6JA 4MN9A 4U3GA 1JI5A 3PW1A 5J8WA 2AR0A 4XGSA 4DZ0A 3KA8A 3GGZA 3HL1A 1N1QA 1Z4AA 1F30A 2OKCA 4W4LB 2Z90A 2Y3QA 3AJQA 4RC6B 2FFXJ 5FFAA 1J30A 4EVCA 2C2JA 2BK6A 2ZG9X 5GU3X 3KX9A 2V2MA 2ZA6A 1S2ZA 3NP0X 2ITBA 4CVTA 4LYXA 1VLGA 3C23A 5C6FA 3PW1B 1H96A 3F36A 4DYZA 3PWFA 2CLBA 2X170 4W4KB 1JYBA 1IESA 5JACA 3PW8A 1L8IA 3PVYA 4XKSA 4MKUA 3RD0A 3F32A 3GGYA 3RBCA 3EGMA 2BJYA 3Q4OA 3FSEA 4ZKHA 1VEQA 4ERUA 3F39A 4AM5A 2CN6A 1TJOA 1YV1A 4TO9A 3VNXA 3KA3A 5D8SA 3E1MA 1S30A 2VZBA 4CMYV 1YUXA 3OJ5A 3PZAA 3L0MA 3WNWA 4LQVA 4LPMA 1AEWA 1F33A 3KWOA 2GS4A 4E40A 3O7RA 3E1OA 4ZMCA 3D19A 4ZJKA 1DPSA 1R03A 2JD60 1RYTA 5HJHA 4ITTA 3IQ1A 2PYBA 3DBYA 1IERA 1JTSA 4E6KA 2CLUA 3Q4QA 3C21A 3E6RA 1RCCA 4P18A 1ZS3A 3KXUA 1DATA 4EVDA 4AM4A 3F33A 3PVRA 5JDOB 4LQNA 1JKVA 3QB9A 5AXSA 4LPNA 1L8HA 3E1JA 4CVRA 1FHAA 1SOFA 1GWGA 5HJFA 2Z5RA 2ZA8A 3R2KA 3BKNA 5J93A 1BG7A 1MOJA 4DE6A 4DI0A 5CMQA 1TKOA 5LS9A 4XKTA 1YUZA 2V2LA 3PWQC 3FI6A 3PVRB 3AK8A 4DYYA 4TOHA 3RAVA 1QGHA 3IS8A 2OH3A 4II4A 2V2PA 5FEJA 3Q4RA 3SH6A 3AJOA 2C2FA 3IS7A 3T9JA 5HQOA 1QYBA 4Z5SA 4ISMA 5D8QA 5FFEA 3QHCA 5JKMA 5JKLA 3QVDA 2FJCA 3SIDA 3WVUA 2C2UA 5FFCA 2HTNA 5K52A 5GU1X 2CHPA 1BFRA 3KA6A 2MGYA 4II4B 1RCIA 4TOBA 5D8OA 1OTKA 4ZKWA 3AJPA 3VV9A 3R2LA 5D8PA 2VXXA 4TOCA 3FRSA 2BW1A 4XKUA 3F35A 2XJMA 2D5KA 5D8YA 3PWQA 2VXIA 1B71A 1JREA 1LB3A 2FG8A 2RBDA 3ERZA 3E6SA 5ERJA 4X0JA 2XJNA 4YVZA 1XZ1A 2XJOA 3BVEA 2Z5PA 3JZAB 1DVBA 3O7SA 4DASA 4IXKA 2V15A 2WLAA 4ZL6A 4KVRA 5J9VA 3PVYB 4OYNA 3VVAA 4WJG4 3UOFA 1O9IA 3E1QA 2WLUA 1KRQA 3R2OA 2CN7A 5CZUA 2FHAA 4KXRB 2CHIA 4IWKA 4R42A 3R2RA 1NF4A 1JI4A 3E1PA 2YJJA 3LKDA 4ETRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TW3 A;  3SE1 A;  2F7N A;  4REU A;  1EUM A;  5JKM G;  5JKL G;  2WTL A;  5GN8 A;  2C6R A;  2YW7 A;  3AK9 A;  4ISP A;  3A9Q A;  4LQH A;  3NOZ X;  1TK6 A;  4CY9 A;  1NNQ A;  1UMN A;  3R2M A;  5LG8 A;  4CMY A;  1ZUJ A;  2FZF A;  3HIU A;  4KVS A;  2QF9 A;  2CIH A;  4ZL5 A;  2FKZ A;  3BT5 A;  4CYA A;  3NP2 X;  5D8R A;  4CYB A;  1JIG A;  1RCE A;  3TA8 A;  2C41 A;  3UNO A;  2Z6M A;  2JD7 0;  5GN8 B;  4RC5 A;  4ML5 A;  5GU0 X;  3R2H A;  4MY7 A;  3E1L A;  2FG4 A;  2BKC A;  4MUD A;  1VEI A;  2V2R A;  4RC7 A;  1S3Q A;  3SHX A;  2IB0 A;  2OC5 A;  2JD8 0;  2FL0 A;  3QHB A;  3QD8 A;  3KA9 A;  4ITW A;  4QUW A;  3R2S A;  3UOI A;  4PGK A;  1Z6O A;  2Z5Q A;  4TOG A;  2IU2 A;  4MJY A;  5J8S A;  3BVK A;  4RC5 B;  4EVE A;  2YJK A;  4IWJ A;  4TOD A;  5I4J A;  3AF9 X;  3BVI A;  1VJX A;  3GHQ A;  4DYU A;  3E2C A;  5CMR A;  2GYD A;  2YW6 A;  4M35 A;  2V2O A;  2GYQ A;  4RC7 B;  1O9R A;  5FFD A;  5LBH A;  2W0O A;  3F38 A;  4TOE A;  4DYX A;  2CEI A;  3A68 A;  2V2I A;  4M32 A;  4M34 A;  4EVB A;  5E2D A;  3H7G A;  4A25 A;  3QZ3 A;  3BVF A;  3BVL A;  4CVS A;  2V2J A;  1Z6O M;  3ES3 A;  5GOU A;  4ZKX A;  2ZA7 A;  3EZU A;  3PVT A;  1XZ3 A;  2HR5 A;  4RC8 A;  3RE7 A;  3AF8 X;  4LPJ A;  2G4H A;  4ZTT A;  3WVV A;  4LQJ A;  3ISF A;  2IY4 A;  2ZG8 X;  3RGD A;  1LKM A;  4YKH A;  5ERK A;  3GVY A;  3MPS A;  1JKU A;  1UVH A;  5D8X A;  5GU2 X;  1LKP A;  3Q4N A;  4KVQ A;  4LYU A;  4ZLW A;  4M33 A;  3WVW A;  2V2N A;  3GE4 A;  3PVT B;  2ZG7 X;  4TOF A;  2CF7 A;  1SQ3 A;  3OGH A;  3FVB A;  1NF6 A;  3U90 A;  3KA4 A;  4Y08 A;  3F37 A;  5FFB A;  1RCD A;  5E1U A;  1JGC A;  2V2S A;  4CVP A;  1HRS A;  3PW8 C;  3EZ0 A;  2XKQ A;  3AF7 X;  1NFV A;  4RC6 A;  4TOA A;  2ZUR X;  2XGW A;  5IX6 A;  5LG2 A;  1TKP A;  1MFR A;  3ISE A;  1RCG A;  2UX1 A;  1BCF A;  4PG1 A;  4PG0 A;  2QQY A;  4Z3B A;  1LKO A;  4AM2 A;  5K53 A;  3E1N A;  1VEL A;  3F34 A;  4PGI A;  4MN9 A;  4U3G A;  1JI5 A;  3PW1 A;  5J8W A;  4XGS A;  4DZ0 A;  3KA8 A;  3HL1 A;  1N1Q A;  1Z4A A;  1F30 A;  2Z90 A;  2Y3Q A;  3AJQ A;  4RC6 B;  2FFX J;  5FFA A;  1J30 A;  4EVC A;  2C2J A;  2BK6 A;  2ZG9 X;  5GU3 X;  3KX9 A;  2V2M A;  2ZA6 A;  1S2Z A;  3NP0 X;  2ITB A;  4CVT A;  4LYX A;  1VLG A;  5C6F A;  3PW1 B;  1H96 A;  3F36 A;  4DYZ A;  3PWF A;  2CLB A;  2X17 0;  1JYB A;  1IES A;  5JAC A;  3PW8 A;  1L8I A;  3PVY A;  4XKS A;  4MKU A;  3RD0 A;  3F32 A;  3RBC A;  3EGM A;  2BJY A;  3Q4O A;  3FSE A;  4ZKH A;  1VEQ A;  4ERU A;  3F39 A;  4AM5 A;  2CN6 A;  1TJO A;  1YV1 A;  4TO9 A;  3VNX A;  3KA3 A;  5D8S A;  3E1M A;  1S30 A;  2VZB A;  4CMY V;  1YUX A;  3OJ5 A;  3PZA A;  3WNW A;  4LQV A;  4LPM A;  1AEW A;  1F33 A;  3KWO A;  2GS4 A;  3O7R A;  3E1O A;  4ZMC A;  4ZJK A;  1DPS A;  1R03 A;  2JD6 0;  1RYT A;  5HJH A;  4ITT A;  3IQ1 A;  2PYB A;  1IER A;  1JTS A;  4E6K A;  2CLU A;  3Q4Q A;  3E6R A;  1RCC A;  4P18 A;  1ZS3 A;  3KXU A;  1DAT A;  4EVD A;  4AM4 A;  3F33 A;  3PVR A;  4LQN A;  1JKV A;  3QB9 A;  5AXS A;  4LPN A;  1L8H A;  3E1J A;  4CVR A;  1FHA A;  1SOF A;  1GWG A;  5HJF A;  2Z5R A;  2ZA8 A;  3R2K A;  3BKN A;  5J93 A;  1BG7 A;  1MOJ A;  4DE6 A;  4DI0 A;  5CMQ A;  1TKO A;  5LS9 A;  4XKT A;  1YUZ A;  2V2L A;  3PWQ C;  3FI6 A;  3PVR B;  3AK8 A;  4DYY A;  4TOH A;  3RAV A;  1QGH A;  3IS8 A;  2OH3 A;  4II4 A;  2V2P A;  5FEJ A;  3Q4R A;  3SH6 A;  3AJO A;  2C2F A;  3IS7 A;  3T9J A;  5HQO A;  1QYB A;  4Z5S A;  4ISM A;  5D8Q A;  5FFE A;  3QHC A;  5JKM A;  5JKL A;  3QVD A;  2FJC A;  3SID A;  3WVU A;  2C2U A;  5FFC A;  2HTN A;  5K52 A;  5GU1 X;  2CHP A;  1BFR A;  3KA6 A;  4II4 B;  1RCI A;  4TOB A;  5D8O A;  1OTK A;  4ZKW A;  3AJP A;  3R2L A;  5D8P A;  2VXX A;  4TOC A;  2BW1 A;  4XKU A;  3F35 A;  2XJM A;  2D5K A;  5D8Y A;  3PWQ A;  2VXI A;  1B71 A;  1JRE A;  1LB3 A;  2FG8 A;  2RBD A;  3ERZ A;  3E6S A;  5ERJ A;  2XJN A;  1XZ1 A;  2XJO A;  3BVE A;  2Z5P A;  1DVB A;  3O7S A;  4DAS A;  4IXK A;  2V15 A;  2WLA A;  4ZL6 A;  4KVR A;  5J9V A;  3PVY B;  4OYN A;  3UOF A;  1O9I A;  3E1Q A;  2WLU A;  1KRQ A;  3R2O A;  2CN7 A;  5CZU A;  2FHA A;  2CHI A;  4IWK A;  4R42 A;  3R2R A;  1NF4 A;  1JI4 A;  3E1P A;  2YJJ A;  4ETR A; 
#chains in the Genus database with same CATH topology
 3W54 A;  4TW3 A;  3SE1 A;  2F7N A;  4REU A;  1EUM A;  5JKM G;  5JKL G;  3C1Z A;  2WTL A;  5GN8 A;  2C6R A;  2YW7 A;  3AK9 A;  4ISP A;  3A9Q A;  4LQH A;  3NOZ X;  1TK6 A;  4CY9 A;  1NNQ A;  1UMN A;  3R2M A;  5LG8 A;  4CMY A;  1ZUJ A;  2FZF A;  2N02 A;  3HIU A;  4KVS A;  2QF9 A;  2CIH A;  2G38 B;  4ZL5 A;  2FKZ A;  3BT5 A;  2WWX B;  4CYA A;  3NP2 X;  5D8R A;  4CYB A;  1JIG A;  1RCE A;  3TA8 A;  2C41 A;  3UNO A;  2Z6M A;  2JD7 0;  3V3K B;  5GN8 B;  4RC5 A;  4ML5 A;  5GU0 X;  3R2H A;  4MY7 A;  3E1L A;  2FG4 A;  2BKC A;  4MUD A;  1VEI A;  2V2R A;  4RC7 A;  1S3Q A;  3SHX A;  2IB0 A;  2OC5 A;  2JD8 0;  5HU6 D;  2FL0 A;  3QHB A;  2Y44 A;  3QD8 A;  3KA9 A;  4ITW A;  4QUW A;  3R2S A;  3UOI A;  4PGK A;  1Z6O A;  2Z5Q A;  4TOG A;  2IU2 A;  4MJY A;  5J8S A;  2V8T A;  3BVK A;  4RC5 B;  4EVE A;  2YJK A;  2CWL A;  4IWJ A;  4TOD A;  5I4J A;  3AF9 X;  3BVI A;  1VJX A;  3GHQ A;  4DYU A;  3E2C A;  5CMR A;  2GYD A;  2YW6 A;  4M35 A;  2V2O A;  2GYQ A;  4RC7 B;  1O9R A;  5FFD A;  5LBH A;  3UFB A;  2W0O A;  3F38 A;  4TOE A;  2V8U A;  4DYX A;  2CEI A;  3A68 A;  2V2I A;  4M32 A;  4M34 A;  4EVB A;  5E2D A;  3H7G A;  3C1Y A;  4A25 A;  3QZ3 A;  3BVF A;  3BVL A;  3JZ9 A;  4CVS A;  2V2J A;  3KDQ A;  1Z6O M;  3FRR A;  3ES3 A;  5GOU A;  4ZKX A;  5JDO A;  2ZA7 A;  3EZU A;  3N6O A;  3PVT A;  1XZ3 A;  2HR5 A;  4RC8 A;  3RE7 A;  3AF8 X;  4LPJ A;  2G4H A;  4ZTT A;  3WVV A;  4LQJ A;  3ISF A;  2IY4 A;  2ZG8 X;  3RGD A;  1LKM A;  4YKH A;  5ERK A;  3GVY A;  3MPS A;  1JKU A;  1UVH A;  5D8X A;  5GU2 X;  1LKP A;  3KHK A;  3Q4N A;  4KVQ A;  4LYU A;  4ZLW A;  4M33 A;  3WVW A;  2V2N A;  3GE4 A;  3PVT B;  2ZG7 X;  4TOF A;  2CF7 A;  4MXP A;  1SQ3 A;  3OGH A;  3FVB A;  1NF6 A;  3U90 A;  4YXJ A;  3KA4 A;  4Y08 A;  3F37 A;  5FFB A;  1RCD A;  5E1U A;  1JGC A;  2V2S A;  4CVP A;  1HRS A;  3PW8 C;  3EZ0 A;  2XKQ A;  3AF7 X;  1NFV A;  4RC6 A;  4TOA A;  2ZUR X;  4YXM A;  2XGW A;  5IX6 A;  5LG2 A;  1TKP A;  1MFR A;  3ISE A;  1RCG A;  2UX1 A;  1BCF A;  4PG1 A;  4PG0 A;  2QQY A;  4Z3B A;  1LKO A;  4AM2 A;  5K53 A;  3E1N A;  1VEL A;  3F34 A;  4PGI A;  3M6J A;  4MN9 A;  4U3G A;  1JI5 A;  3PW1 A;  5J8W A;  2AR0 A;  4XGS A;  4DZ0 A;  3KA8 A;  3GGZ A;  3HL1 A;  1N1Q A;  1Z4A A;  1F30 A;  2OKC A;  4W4L B;  2Z90 A;  2Y3Q A;  3AJQ A;  4RC6 B;  2FFX J;  5FFA A;  1J30 A;  4EVC A;  2C2J A;  2BK6 A;  2ZG9 X;  5GU3 X;  3KX9 A;  2V2M A;  2ZA6 A;  1S2Z A;  3NP0 X;  2ITB A;  4CVT A;  4LYX A;  1VLG A;  3C23 A;  5C6F A;  3PW1 B;  1H96 A;  3F36 A;  4DYZ A;  3PWF A;  2CLB A;  2X17 0;  4W4K B;  1JYB A;  1IES A;  5JAC A;  3PW8 A;  1L8I A;  3PVY A;  4XKS A;  4MKU A;  3RD0 A;  3F32 A;  3GGY A;  3RBC A;  3EGM A;  2BJY A;  3Q4O A;  3FSE A;  4ZKH A;  1VEQ A;  4ERU A;  3F39 A;  4AM5 A;  2CN6 A;  1TJO A;  1YV1 A;  4TO9 A;  3VNX A;  3KA3 A;  5D8S A;  3E1M A;  1S30 A;  2VZB A;  4CMY V;  1YUX A;  3OJ5 A;  3PZA A;  3L0M A;  3WNW A;  4LQV A;  4LPM A;  1AEW A;  1F33 A;  3KWO A;  2GS4 A;  4E40 A;  3O7R A;  3E1O A;  4ZMC A;  3D19 A;  4ZJK A;  1DPS A;  1R03 A;  2JD6 0;  1RYT A;  5HJH A;  4ITT A;  3IQ1 A;  2PYB A;  3DBY A;  1IER A;  1JTS A;  4E6K A;  2CLU A;  3Q4Q A;  3C21 A;  3E6R A;  1RCC A;  4P18 A;  1ZS3 A;  3KXU A;  1DAT A;  4EVD A;  4AM4 A;  3F33 A;  3PVR A;  5JDO B;  4LQN A;  1JKV A;  3QB9 A;  5AXS A;  4LPN A;  1L8H A;  3E1J A;  4CVR A;  1FHA A;  1SOF A;  1GWG A;  5HJF A;  2Z5R A;  2ZA8 A;  3R2K A;  3BKN A;  5J93 A;  1BG7 A;  1MOJ A;  4DE6 A;  4DI0 A;  5CMQ A;  1TKO A;  5LS9 A;  4XKT A;  1YUZ A;  2V2L A;  3PWQ C;  3FI6 A;  3PVR B;  3AK8 A;  4DYY A;  4TOH A;  3RAV A;  1QGH A;  3IS8 A;  2OH3 A;  4II4 A;  2V2P A;  5FEJ A;  3Q4R A;  3SH6 A;  3AJO A;  2C2F A;  3IS7 A;  3T9J A;  5HQO A;  1QYB A;  4Z5S A;  4ISM A;  5D8Q A;  5FFE A;  3QHC A;  5JKM A;  5JKL A;  3QVD A;  2FJC A;  3SID A;  3WVU A;  2C2U A;  5FFC A;  2HTN A;  5K52 A;  5GU1 X;  2CHP A;  1BFR A;  3KA6 A;  2MGY A;  4II4 B;  1RCI A;  4TOB A;  5D8O A;  1OTK A;  4ZKW A;  3AJP A;  3VV9 A;  3R2L A;  5D8P A;  2VXX A;  4TOC A;  3FRS A;  2BW1 A;  4XKU A;  3F35 A;  2XJM A;  2D5K A;  5D8Y A;  3PWQ A;  2VXI A;  1B71 A;  1JRE A;  1LB3 A;  2FG8 A;  2RBD A;  3ERZ A;  3E6S A;  5ERJ A;  4X0J A;  2XJN A;  4YVZ A;  1XZ1 A;  2XJO A;  3BVE A;  2Z5P A;  3JZA B;  1DVB A;  3O7S A;  4DAS A;  4IXK A;  2V15 A;  2WLA A;  4ZL6 A;  4KVR A;  5J9V A;  3PVY B;  4OYN A;  3VVA A;  4WJG 4;  3UOF A;  1O9I A;  3E1Q A;  2WLU A;  1KRQ A;  3R2O A;  2CN7 A;  5CZU A;  2FHA A;  4KXR B;  2CHI A;  4IWK A;  4R42 A;  3R2R A;  1NF4 A;  1JI4 A;  3E1P A;  2YJJ A;  3LKD A;  4ETR A; 
#chains in the Genus database with same CATH homology
 3W54 A;  4TW3 A;  3SE1 A;  2F7N A;  4REU A;  1EUM A;  5JKM G;  5JKL G;  3C1Z A;  2WTL A;  5GN8 A;  2C6R A;  2YW7 A;  3AK9 A;  4ISP A;  3A9Q A;  4LQH A;  3NOZ X;  1TK6 A;  4CY9 A;  1NNQ A;  1UMN A;  3R2M A;  5LG8 A;  4CMY A;  1ZUJ A;  2FZF A;  2N02 A;  3HIU A;  4KVS A;  2QF9 A;  2CIH A;  2G38 B;  4ZL5 A;  2FKZ A;  3BT5 A;  2WWX B;  4CYA A;  3NP2 X;  5D8R A;  4CYB A;  1JIG A;  1RCE A;  3TA8 A;  2C41 A;  3UNO A;  2Z6M A;  2JD7 0;  3V3K B;  5GN8 B;  4RC5 A;  4ML5 A;  5GU0 X;  3R2H A;  4MY7 A;  3E1L A;  2FG4 A;  2BKC A;  4MUD A;  1VEI A;  2V2R A;  4RC7 A;  1S3Q A;  3SHX A;  2IB0 A;  2OC5 A;  2JD8 0;  5HU6 D;  2FL0 A;  3QHB A;  2Y44 A;  3QD8 A;  3KA9 A;  4ITW A;  4QUW A;  3R2S A;  3UOI A;  4PGK A;  1Z6O A;  2Z5Q A;  4TOG A;  2IU2 A;  4MJY A;  5J8S A;  2V8T A;  3BVK A;  4RC5 B;  4EVE A;  2YJK A;  2CWL A;  4IWJ A;  4TOD A;  5I4J A;  3AF9 X;  3BVI A;  1VJX A;  3GHQ A;  4DYU A;  3E2C A;  5CMR A;  2GYD A;  2YW6 A;  4M35 A;  2V2O A;  2GYQ A;  4RC7 B;  1O9R A;  5FFD A;  5LBH A;  3UFB A;  2W0O A;  3F38 A;  4TOE A;  2V8U A;  4DYX A;  2CEI A;  3A68 A;  2V2I A;  4M32 A;  4M34 A;  4EVB A;  5E2D A;  3H7G A;  3C1Y A;  4A25 A;  3QZ3 A;  3BVF A;  3BVL A;  3JZ9 A;  4CVS A;  2V2J A;  3KDQ A;  1Z6O M;  3FRR A;  3ES3 A;  5GOU A;  4ZKX A;  5JDO A;  2ZA7 A;  3EZU A;  3N6O A;  3PVT A;  1XZ3 A;  2HR5 A;  4RC8 A;  3RE7 A;  3AF8 X;  4LPJ A;  2G4H A;  4ZTT A;  3WVV A;  4LQJ A;  3ISF A;  2IY4 A;  2ZG8 X;  3RGD A;  1LKM A;  4YKH A;  5ERK A;  3GVY A;  3MPS A;  1JKU A;  1UVH A;  5D8X A;  5GU2 X;  1LKP A;  3KHK A;  3Q4N A;  4KVQ A;  4LYU A;  4ZLW A;  4M33 A;  3WVW A;  2V2N A;  3GE4 A;  3PVT B;  2ZG7 X;  4TOF A;  2CF7 A;  4MXP A;  1SQ3 A;  3OGH A;  3FVB A;  1NF6 A;  3U90 A;  4YXJ A;  3KA4 A;  4Y08 A;  3F37 A;  5FFB A;  1RCD A;  5E1U A;  1JGC A;  2V2S A;  4CVP A;  1HRS A;  3PW8 C;  3EZ0 A;  2XKQ A;  3AF7 X;  1NFV A;  4RC6 A;  4TOA A;  2ZUR X;  4YXM A;  2XGW A;  5IX6 A;  5LG2 A;  1TKP A;  1MFR A;  3ISE A;  1RCG A;  2UX1 A;  1BCF A;  4PG1 A;  4PG0 A;  2QQY A;  4Z3B A;  1LKO A;  4AM2 A;  5K53 A;  3E1N A;  1VEL A;  3F34 A;  4PGI A;  3M6J A;  4MN9 A;  4U3G A;  1JI5 A;  3PW1 A;  5J8W A;  2AR0 A;  4XGS A;  4DZ0 A;  3KA8 A;  3GGZ A;  3HL1 A;  1N1Q A;  1Z4A A;  1F30 A;  2OKC A;  4W4L B;  2Z90 A;  2Y3Q A;  3AJQ A;  4RC6 B;  2FFX J;  5FFA A;  1J30 A;  4EVC A;  2C2J A;  2BK6 A;  2ZG9 X;  5GU3 X;  3KX9 A;  2V2M A;  2ZA6 A;  1S2Z A;  3NP0 X;  2ITB A;  4CVT A;  4LYX A;  1VLG A;  3C23 A;  5C6F A;  3PW1 B;  1H96 A;  3F36 A;  4DYZ A;  3PWF A;  2CLB A;  2X17 0;  4W4K B;  1JYB A;  1IES A;  5JAC A;  3PW8 A;  1L8I A;  3PVY A;  4XKS A;  4MKU A;  3RD0 A;  3F32 A;  3GGY A;  3RBC A;  3EGM A;  2BJY A;  3Q4O A;  3FSE A;  4ZKH A;  1VEQ A;  4ERU A;  3F39 A;  4AM5 A;  2CN6 A;  1TJO A;  1YV1 A;  4TO9 A;  3VNX A;  3KA3 A;  5D8S A;  3E1M A;  1S30 A;  2VZB A;  4CMY V;  1YUX A;  3OJ5 A;  3PZA A;  3L0M A;  3WNW A;  4LQV A;  4LPM A;  1AEW A;  1F33 A;  3KWO A;  2GS4 A;  4E40 A;  3O7R A;  3E1O A;  4ZMC A;  3D19 A;  4ZJK A;  1DPS A;  1R03 A;  2JD6 0;  1RYT A;  5HJH A;  4ITT A;  3IQ1 A;  2PYB A;  3DBY A;  1IER A;  1JTS A;  4E6K A;  2CLU A;  3Q4Q A;  3C21 A;  3E6R A;  1RCC A;  4P18 A;  1ZS3 A;  3KXU A;  1DAT A;  4EVD A;  4AM4 A;  3F33 A;  3PVR A;  5JDO B;  4LQN A;  1JKV A;  3QB9 A;  5AXS A;  4LPN A;  1L8H A;  3E1J A;  4CVR A;  1FHA A;  1SOF A;  1GWG A;  5HJF A;  2Z5R A;  2ZA8 A;  3R2K A;  3BKN A;  5J93 A;  1BG7 A;  1MOJ A;  4DE6 A;  4DI0 A;  5CMQ A;  1TKO A;  5LS9 A;  4XKT A;  1YUZ A;  2V2L A;  3PWQ C;  3FI6 A;  3PVR B;  3AK8 A;  4DYY A;  4TOH A;  3RAV A;  1QGH A;  3IS8 A;  2OH3 A;  4II4 A;  2V2P A;  5FEJ A;  3Q4R A;  3SH6 A;  3AJO A;  2C2F A;  3IS7 A;  3T9J A;  5HQO A;  1QYB A;  4Z5S A;  4ISM A;  5D8Q A;  5FFE A;  3QHC A;  5JKM A;  5JKL A;  3QVD A;  2FJC A;  3SID A;  3WVU A;  2C2U A;  5FFC A;  2HTN A;  5K52 A;  5GU1 X;  2CHP A;  1BFR A;  3KA6 A;  2MGY A;  4II4 B;  1RCI A;  4TOB A;  5D8O A;  1OTK A;  4ZKW A;  3AJP A;  3VV9 A;  3R2L A;  5D8P A;  2VXX A;  4TOC A;  3FRS A;  2BW1 A;  4XKU A;  3F35 A;  2XJM A;  2D5K A;  5D8Y A;  3PWQ A;  2VXI A;  1B71 A;  1JRE A;  1LB3 A;  2FG8 A;  2RBD A;  3ERZ A;  3E6S A;  5ERJ A;  4X0J A;  2XJN A;  4YVZ A;  1XZ1 A;  2XJO A;  3BVE A;  2Z5P A;  3JZA B;  1DVB A;  3O7S A;  4DAS A;  4IXK A;  2V15 A;  2WLA A;  4ZL6 A;  4KVR A;  5J9V A;  3PVY B;  4OYN A;  3VVA A;  4WJG 4;  3UOF A;  1O9I A;  3E1Q A;  2WLU A;  1KRQ A;  3R2O A;  2CN7 A;  5CZU A;  2FHA A;  4KXR B;  2CHI A;  4IWK A;  4R42 A;  3R2R A;  1NF4 A;  1JI4 A;  3E1P A;  2YJJ A;  3LKD A;  4ETR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...