3PVRB

The phenylacetyl-coa monooxygenase paaac subcomplex with benzoyl-coa
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
236
structure length
236
Chain Sequence
SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Phenylacetic acid degradation protein paaA
publication title Structural and Functional Studies of the Escherichia coli Phenylacetyl-CoA Monooxygenase Complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 236
sequence length 236
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pvrB00
3F35A 3F39A 1RCEA 1LKOA 3E6SA 3KWOA 4YKHA 2QQYA 2CLUA 4RC8A 3R2OA 4TOGA 4XKUA 4ZTTA 2CF7A 4IWKA 4R42A 4CY9A 1NNQA 3WVWA 1JKUA 3F34A 5FFDA 5J8SA 1JYBA 4RC5A 2VZBA 2GYDA 3QHBA 3Q4NA 5ERJA 1VLGA 1L8IA 5JKLA 3F33A 2Z5QA 3NP0X 3A68A 3PVTA 4ERUA 1LKPA 5FFEA 3PWQA 1NFVA 1QGHA 5E2DA 4LQJA 1NF6A 2C2JA 4XKSA 1TK6A 4PG1A 2V2OA 5HJHA 4ZL5A 3AK8A 5J9VA 4KVSA 1LB3A 3R2LA 4A25A 5GU0X 1J30A 5J93A 5HJFA 4ZKWA 2Z5RA 4IWJA 3PW8C 4ZMCA 3GE4A 4PG0A 2QF9A 4RC5B 1JIGA 2V2IA 3Q4OA 3KA3A 4ZLWA 2ZG9X 3ERZA 3PVTB 2FZFA 3BVEA 1Z6OM 3IS8A 3A9QA 3EZ0A 3FI6A 1MOJA 1VJXA 3PW1A 1BFRA 3QHCA 3F32A 4LPNA 3SIDA 3AJQA 5GOUA 4ZL6A 1KRQA 4AM5A 2F7NA 2V2JA 5GU3X 2V2SA 1B71A 3KX9A 2GYQA 5D8XA 3RD0A 4TO9A 5J8WA 2V2PA 4REUA 4LYUA 1VELA 3SH6A 4RC6B 4M34A 4M32A 3PWFA 4ETRA 3QVDA 4RC7B 2RBDA 5FFBA 2VXIA 1RCIA 1NF4A 2V2RA 3GHQA 5JKMG 1RCGA 5CMRA 4MJYA 4ITWA 4KVQA 1SOFA 4DZ0A 4CVPA 2IU2A 3AJPA 3EZUA 4TOHA 3BVLA 5K53A 2Z5PA 1ZS3A 4PGIA 4DYZA 4TOFA 3PVRA 4U3GA 2PYBA 4TW3A 3E1OA 5D8QA 4EVDA 5D8OA 2ZA7A 2V15A 2CN7A 5CZUA 3F38A 3IQ1A 1UMNA 1DVBA 3FSEA 4ZKXA 3TA8A 1YV1A 4OYNA 2D5KA 5GN8A 4EVBA 1JTSA 3ISFA 2ZA8A 4KVRA 2FHAA 1Z6OA 3KA6A 3IS7A 4CVTA 3KA8A 4LQHA 4ZJKA 1OTKA 3UOIA 4DE6A 4M35A 3KXUA 3PVRB 3RBCA 1RCCA 4CYBA 3SHXA 1JREA 5FFAA 3R2HA 3AF8X 2V2NA 3QB9A 4MKUA 2XJMA 2BW1A 2C6RA 4LPMA 4TOBA 1AEWA 2HTNA 3AF7X 5GN8B 2CLBA 1HRSA 2HR5A 2X170 3E1JA 3WVUA 1UVHA 2JD70 4ISPA 5D8PA 5LS9A 3Q4QA 5GU1X 5JKMA 1TKPA 3R2RA 3Q4RA 4TOCA 4E6KA 1TKOA 4MY7A 1YUZA 1FHAA 3AF9X 3E6RA 1RCDA 2FG8A 5D8SA 3R2SA 3BVFA 1O9IA 1N1QA 2FFXJ 3PVYA 5JACA 2WLUA 4LPJA 5K52A 3R2KA 3E1QA 3BT5A 5D8RA 2XJOA 3AJOA 4DYXA 2YJKA 1JGCA 3PW1B 1DATA 3PWQC 2YJJA 4CMYA 2UX1A 4II4A 2CN6A 1S30A 3GVYA 4CMYV 1GWGA 3EGMA 3E1LA 3PZAA 2G4HA 1BCFA 1O9RA 2V2LA 2ZA6A 4EVEA 3UOFA 5LG8A 3PW8A 2IY4A 5ERKA 3BVKA 1BG7A 3OGHA 3E1NA 2IB0A 5LBHA 3F37A 2VXXA 3E1PA 2OC5A 2Z6MA 3H7GA 2WLAA 3PVYB 3E2CA 5LG2A 2YW7A 3ES3A 1S2ZA 2GS4A 2JD60 3KA4A 2BKCA 1S3QA 3AK9A 4Y08A 5CMQA 2C2FA 3WNWA 2WTLA 3VNXA 4II4B 1IESA 1SQ3A 5FFCA 2ZURX 4Z5SA 1MFRA 1LKMA 3QZ3A 3UNOA 4TOAA 2OH3A 2FG4A 3BKNA 2FL0A 2Z90A 4MUDA 3RAVA 2CIHA 2ZG8X 3F36A 3HL1A 2V2MA 3U90A 4CVSA 1EUMA 4ML5A 3NOZX 2W0OA 2Y3QA 5FEJA 3QD8A 3WVVA 4TODA 2BK6A 4EVCA 4DYUA 5AXSA 4CYAA 4LQNA 5HQOA 1IERA 1TJOA 1DPSA 4M33A 1XZ3A 1L8HA 3FVBA 3KA9A 5E1UA 1XZ1A 5IX6A 3E1MA 2CHIA 1VEIA 1JI4A 3OJ5A 4PGKA 3RE7A 1H96A 2FJCA 2XGWA 4TOEA 4RC6A 5JKLG 3O7SA 4CVRA 1JI5A 2ITBA 1RYTA 2XKQA 1R03A 4LQVA 2FKZA 4QUWA 4ZKHA 4RC7A 1Z4AA 1F30A 4ISMA 3NP2X 2CEIA 5D8YA 2BJYA 4XKTA 3R2MA 4IXKA 4AM4A 4XGSA 1QYBA 1F33A 1JKVA 3RGDA 2CHPA 1YUXA 2JD80 4LYXA 3BVIA 2YW6A 4Z3BA 3T9JA 4AM2A 2XJNA 4DASA 4ITTA 4P18A 5GU2X 2C41A 3SE1A 3ISEA 3HIUA 1VEQA 1ZUJA 4MN9A 3MPSA 4DYYA 5I4JA 4DI0A 2C2UA 5C6FA 3O7RA 2ZG7X
chains in the Genus database with same CATH superfamily
3F35A 3N6OA 3F39A 1RCEA 4YVZA 1LKOA 3E6SA 3KWOA 4YKHA 2QQYA 2CLUA 5HU6D 4RC8A 3R2OA 4TOGA 3GGZA 4XKUA 4ZTTA 2CF7A 4IWKA 4R42A 4CY9A 1NNQA 3WVWA 1JKUA 3F34A 5FFDA 3UFBA 5J8SA 1JYBA 4RC5A 2VZBA 2GYDA 3QHBA 3Q4NA 5ERJA 1VLGA 1L8IA 5JKLA 3F33A 2Z5QA 3NP0X 3VV9A 3A68A 3PVTA 4ERUA 1LKPA 5FFEA 3PWQA 1NFVA 1QGHA 5E2DA 4LQJA 1NF6A 2C2JA 4XKSA 1TK6A 4PG1A 2V2OA 5HJHA 4ZL5A 3AK8A 5J9VA 4KVSA 1LB3A 3R2LA 4A25A 5GU0X 1J30A 5J93A 5HJFA 4ZKWA 2Z5RA 4IWJA 3PW8C 4ZMCA 3GE4A 4PG0A 2QF9A 4RC5B 1JIGA 2V2IA 3Q4OA 3KA3A 4ZLWA 2ZG9X 3ERZA 3PVTB 2FZFA 3BVEA 1Z6OM 3IS8A 3A9QA 3EZ0A 3FI6A 1MOJA 1VJXA 3PW1A 1BFRA 3QHCA 3F32A 4LPNA 3SIDA 3AJQA 5GOUA 4X0JA 5JDOA 4ZL6A 1KRQA 4AM5A 2F7NA 2V2JA 5GU3X 2N02A 1B71A 2V2SA 4YXJA 3KX9A 2GYQA 5D8XA 3RD0A 4TO9A 5J8WA 2V2PA 4REUA 4LYUA 1VELA 3SH6A 4RC6B 4M34A 4M32A 3PWFA 4ETRA 3QVDA 4RC7B 2RBDA 5FFBA 2VXIA 1RCIA 1NF4A 2V2RA 3GHQA 5JKMG 1RCGA 5CMRA 2V8UA 4MJYA 5JDOB 4ITWA 4KVQA 1SOFA 4DZ0A 4CVPA 2IU2A 3AJPA 3EZUA 4TOHA 3BVLA 5K53A 2Z5PA 1ZS3A 4PGIA 4DYZA 3V3KB 4TOFA 3PVRA 4U3GA 4WJG4 2PYBA 4TW3A 3E1OA 5D8QA 4EVDA 5D8OA 2ZA7A 2V15A 2CN7A 5CZUA 3F38A 3D19A 3IQ1A 3JZAB 1UMNA 1DVBA 3FSEA 4ZKXA 3TA8A 1YV1A 4OYNA 2D5KA 5GN8A 4EVBA 1JTSA 3ISFA 2ZA8A 4KVRA 2FHAA 1Z6OA 3KA6A 3IS7A 4CVTA 3KA8A 4LQHA 4ZJKA 1OTKA 4W4KB 3UOIA 4DE6A 4M35A 3KXUA 3PVRB 3RBCA 1RCCA 4CYBA 3SHXA 1JREA 5FFAA 3R2HA 3AF8X 2V2NA 3QB9A 4MKUA 3VVAA 3W54A 2XJMA 2BW1A 2C6RA 4LPMA 4TOBA 1AEWA 3KHKA 2HTNA 3AF7X 5GN8B 2CLBA 1HRSA 2HR5A 2X170 3E1JA 3WVUA 1UVHA 2JD70 4ISPA 3M6JA 5D8PA 5LS9A 3Q4QA 5GU1X 5JKMA 1TKPA 4E40A 3R2RA 3Q4RA 4MXPA 4TOCA 4E6KA 1TKOA 4MY7A 1YUZA 1FHAA 3AF9X 4W4LB 3E6RA 1RCDA 2FG8A 5D8SA 3R2SA 3BVFA 1O9IA 1N1QA 2FFXJ 3PVYA 5JACA 2WLUA 4LPJA 5K52A 3R2KA 3E1QA 4KXRB 2Y44A 3BT5A 2MGYA 5D8RA 2XJOA 3AJOA 3C1ZA 4DYXA 2YJKA 1JGCA 3PW1B 1DATA 3PWQC 2YJJA 4CMYA 2UX1A 4II4A 2CN6A 1S30A 3GVYA 4CMYV 1GWGA 3EGMA 3E1LA 2AR0A 3PZAA 2G4HA 1BCFA 1O9RA 2V2LA 2ZA6A 4EVEA 3UOFA 5LG8A 3PW8A 2IY4A 5ERKA 3BVKA 1BG7A 3OGHA 3E1NA 2IB0A 5LBHA 3F37A 2VXXA 3E1PA 2OC5A 2Z6MA 3GGYA 2WLAA 3H7GA 3PVYB 3E2CA 5LG2A 3C1YA 3C21A 2YW7A 3ES3A 1S2ZA 2GS4A 2JD60 3KA4A 2WWXB 2BKCA 1S3QA 3AK9A 4Y08A 5CMQA 2C2FA 3WNWA 2WTLA 3VNXA 4II4B 1IESA 1SQ3A 5FFCA 2ZURX 4Z5SA 1MFRA 1LKMA 3QZ3A 3UNOA 4TOAA 3LKDA 2OH3A 2FG4A 3BKNA 2FL0A 2Z90A 4MUDA 3RAVA 2CIHA 2ZG8X 4YXMA 3F36A 3HL1A 2V2MA 3U90A 4CVSA 1EUMA 4ML5A 3NOZX 2W0OA 2Y3QA 5FEJA 3QD8A 3WVVA 4TODA 2BK6A 4EVCA 4DYUA 5AXSA 4CYAA 4LQNA 5HQOA 1IERA 2CWLA 1TJOA 1DPSA 4M33A 1XZ3A 1L8HA 2G38B 3FVBA 3KA9A 5E1UA 1XZ1A 5IX6A 3E1MA 2CHIA 1VEIA 1JI4A 3OJ5A 4PGKA 3RE7A 1H96A 2FJCA 2XGWA 3L0MA 2OKCA 4TOEA 4RC6A 5JKLG 3O7SA 4CVRA 1JI5A 2ITBA 1RYTA 2XKQA 1R03A 4LQVA 2FKZA 4QUWA 4ZKHA 4RC7A 1Z4AA 1F30A 3DBYA 4ISMA 3NP2X 2CEIA 5D8YA 2BJYA 4XKTA 3R2MA 4IXKA 4AM4A 4XGSA 1QYBA 3KDQA 1F33A 1JKVA 3RGDA 2CHPA 1YUXA 2JD80 3FRSA 4LYXA 3BVIA 2YW6A 3C23A 4Z3BA 3T9JA 4AM2A 2XJNA 4DASA 4ITTA 4P18A 5GU2X 2C41A 3SE1A 3ISEA 3FRRA 3HIUA 1VEQA 1ZUJA 4MN9A 3MPSA 3JZ9A 4DYYA 5I4JA 4DI0A 2C2UA 5C6FA 3O7RA 2V8TA 2ZG7X
chains in the Genus database with same CATH topology
3F35A 3N6OA 3F39A 1RCEA 4YVZA 1LKOA 3E6SA 3KWOA 4YKHA 2QQYA 2CLUA 5HU6D 4RC8A 3R2OA 4TOGA 3GGZA 4XKUA 4ZTTA 2CF7A 4IWKA 4R42A 4CY9A 1NNQA 3WVWA 1JKUA 3F34A 5FFDA 3UFBA 5J8SA 1JYBA 4RC5A 2VZBA 2GYDA 3QHBA 3Q4NA 5ERJA 1VLGA 1L8IA 5JKLA 3F33A 2Z5QA 3NP0X 3VV9A 3A68A 3PVTA 4ERUA 1LKPA 5FFEA 3PWQA 1NFVA 1QGHA 5E2DA 4LQJA 1NF6A 2C2JA 4XKSA 1TK6A 4PG1A 2V2OA 5HJHA 4ZL5A 3AK8A 5J9VA 4KVSA 1LB3A 3R2LA 4A25A 5GU0X 1J30A 5J93A 5HJFA 4ZKWA 2Z5RA 4IWJA 3PW8C 4ZMCA 3GE4A 4PG0A 2QF9A 4RC5B 1JIGA 2V2IA 3Q4OA 3KA3A 4ZLWA 2ZG9X 3ERZA 3PVTB 2FZFA 3BVEA 1Z6OM 3IS8A 3A9QA 3EZ0A 3FI6A 1MOJA 1VJXA 3PW1A 1BFRA 3QHCA 3F32A 4LPNA 3SIDA 3AJQA 5GOUA 4X0JA 5JDOA 4ZL6A 1KRQA 4AM5A 2F7NA 2V2JA 5GU3X 2N02A 1B71A 2V2SA 4YXJA 3KX9A 2GYQA 5D8XA 3RD0A 4TO9A 5J8WA 2V2PA 4REUA 4LYUA 1VELA 3SH6A 4RC6B 4M34A 4M32A 3PWFA 4ETRA 3QVDA 4RC7B 2RBDA 5FFBA 2VXIA 1RCIA 1NF4A 2V2RA 3GHQA 5JKMG 1RCGA 5CMRA 2V8UA 4MJYA 5JDOB 4ITWA 4KVQA 1SOFA 4DZ0A 4CVPA 2IU2A 3AJPA 3EZUA 4TOHA 3BVLA 5K53A 2Z5PA 1ZS3A 4PGIA 4DYZA 3V3KB 4TOFA 3PVRA 4U3GA 4WJG4 2PYBA 4TW3A 3E1OA 5D8QA 4EVDA 5D8OA 2ZA7A 2V15A 2CN7A 5CZUA 3F38A 3D19A 3IQ1A 3JZAB 1UMNA 1DVBA 3FSEA 4ZKXA 3TA8A 1YV1A 4OYNA 2D5KA 5GN8A 4EVBA 1JTSA 3ISFA 2ZA8A 4KVRA 2FHAA 1Z6OA 3KA6A 3IS7A 4CVTA 3KA8A 4LQHA 4ZJKA 1OTKA 4W4KB 3UOIA 4DE6A 4M35A 3KXUA 3PVRB 3RBCA 1RCCA 4CYBA 3SHXA 1JREA 5FFAA 3R2HA 3AF8X 2V2NA 3QB9A 4MKUA 3VVAA 3W54A 2XJMA 2BW1A 2C6RA 4LPMA 4TOBA 1AEWA 3KHKA 2HTNA 3AF7X 5GN8B 2CLBA 1HRSA 2HR5A 2X170 3E1JA 3WVUA 1UVHA 2JD70 4ISPA 3M6JA 5D8PA 5LS9A 3Q4QA 5GU1X 5JKMA 1TKPA 4E40A 3R2RA 3Q4RA 4MXPA 4TOCA 4E6KA 1TKOA 4MY7A 1YUZA 1FHAA 3AF9X 4W4LB 3E6RA 1RCDA 2FG8A 5D8SA 3R2SA 3BVFA 1O9IA 1N1QA 2FFXJ 3PVYA 5JACA 2WLUA 4LPJA 5K52A 3R2KA 3E1QA 4KXRB 2Y44A 3BT5A 2MGYA 5D8RA 2XJOA 3AJOA 3C1ZA 4DYXA 2YJKA 1JGCA 3PW1B 1DATA 3PWQC 2YJJA 4CMYA 2UX1A 4II4A 2CN6A 1S30A 3GVYA 4CMYV 1GWGA 3EGMA 3E1LA 2AR0A 3PZAA 2G4HA 1BCFA 1O9RA 2V2LA 2ZA6A 4EVEA 3UOFA 5LG8A 3PW8A 2IY4A 5ERKA 3BVKA 1BG7A 3OGHA 3E1NA 2IB0A 5LBHA 3F37A 2VXXA 3E1PA 2OC5A 2Z6MA 3GGYA 2WLAA 3H7GA 3PVYB 3E2CA 5LG2A 3C1YA 3C21A 2YW7A 3ES3A 1S2ZA 2GS4A 2JD60 3KA4A 2WWXB 2BKCA 1S3QA 3AK9A 4Y08A 5CMQA 2C2FA 3WNWA 2WTLA 3VNXA 4II4B 1IESA 1SQ3A 5FFCA 2ZURX 4Z5SA 1MFRA 1LKMA 3QZ3A 3UNOA 4TOAA 3LKDA 2OH3A 2FG4A 3BKNA 2FL0A 2Z90A 4MUDA 3RAVA 2CIHA 2ZG8X 4YXMA 3F36A 3HL1A 2V2MA 3U90A 4CVSA 1EUMA 4ML5A 3NOZX 2W0OA 2Y3QA 5FEJA 3QD8A 3WVVA 4TODA 2BK6A 4EVCA 4DYUA 5AXSA 4CYAA 4LQNA 5HQOA 1IERA 2CWLA 1TJOA 1DPSA 4M33A 1XZ3A 1L8HA 2G38B 3FVBA 3KA9A 5E1UA 1XZ1A 5IX6A 3E1MA 2CHIA 1VEIA 1JI4A 3OJ5A 4PGKA 3RE7A 1H96A 2FJCA 2XGWA 3L0MA 2OKCA 4TOEA 4RC6A 5JKLG 3O7SA 4CVRA 1JI5A 2ITBA 1RYTA 2XKQA 1R03A 4LQVA 2FKZA 4QUWA 4ZKHA 4RC7A 1Z4AA 1F30A 3DBYA 4ISMA 3NP2X 2CEIA 5D8YA 2BJYA 4XKTA 3R2MA 4IXKA 4AM4A 4XGSA 1QYBA 3KDQA 1F33A 1JKVA 3RGDA 2CHPA 1YUXA 2JD80 3FRSA 4LYXA 3BVIA 2YW6A 3C23A 4Z3BA 3T9JA 4AM2A 2XJNA 4DASA 4ITTA 4P18A 5GU2X 2C41A 3SE1A 3ISEA 3FRRA 3HIUA 1VEQA 1ZUJA 4MN9A 3MPSA 3JZ9A 4DYYA 5I4JA 4DI0A 2C2UA 5C6FA 3O7RA 2V8TA 2ZG7X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F35 A;  3F39 A;  1RCE A;  1LKO A;  3E6S A;  3KWO A;  4YKH A;  2QQY A;  2CLU A;  4RC8 A;  3R2O A;  4TOG A;  4XKU A;  4ZTT A;  2CF7 A;  4IWK A;  4R42 A;  4CY9 A;  1NNQ A;  3WVW A;  1JKU A;  3F34 A;  5FFD A;  5J8S A;  1JYB A;  4RC5 A;  2VZB A;  2GYD A;  3QHB A;  3Q4N A;  5ERJ A;  1VLG A;  1L8I A;  5JKL A;  3F33 A;  2Z5Q A;  3NP0 X;  3A68 A;  3PVT A;  4ERU A;  1LKP A;  5FFE A;  3PWQ A;  1NFV A;  1QGH A;  5E2D A;  4LQJ A;  1NF6 A;  2C2J A;  4XKS A;  1TK6 A;  4PG1 A;  2V2O A;  5HJH A;  4ZL5 A;  3AK8 A;  5J9V A;  4KVS A;  1LB3 A;  3R2L A;  4A25 A;  5GU0 X;  1J30 A;  5J93 A;  5HJF A;  4ZKW A;  2Z5R A;  4IWJ A;  3PW8 C;  4ZMC A;  3GE4 A;  4PG0 A;  2QF9 A;  4RC5 B;  1JIG A;  2V2I A;  3Q4O A;  3KA3 A;  4ZLW A;  2ZG9 X;  3ERZ A;  3PVT B;  2FZF A;  3BVE A;  1Z6O M;  3IS8 A;  3A9Q A;  3EZ0 A;  3FI6 A;  1MOJ A;  1VJX A;  3PW1 A;  1BFR A;  3QHC A;  3F32 A;  4LPN A;  3SID A;  3AJQ A;  5GOU A;  4ZL6 A;  1KRQ A;  4AM5 A;  2F7N A;  2V2J A;  5GU3 X;  2V2S A;  1B71 A;  3KX9 A;  2GYQ A;  5D8X A;  3RD0 A;  4TO9 A;  5J8W A;  2V2P A;  4REU A;  4LYU A;  1VEL A;  3SH6 A;  4RC6 B;  4M34 A;  4M32 A;  3PWF A;  4ETR A;  3QVD A;  4RC7 B;  2RBD A;  5FFB A;  2VXI A;  1RCI A;  1NF4 A;  2V2R A;  3GHQ A;  5JKM G;  1RCG A;  5CMR A;  4MJY A;  4ITW A;  4KVQ A;  1SOF A;  4DZ0 A;  4CVP A;  2IU2 A;  3AJP A;  3EZU A;  4TOH A;  3BVL A;  5K53 A;  2Z5P A;  1ZS3 A;  4PGI A;  4DYZ A;  4TOF A;  3PVR A;  4U3G A;  2PYB A;  4TW3 A;  3E1O A;  5D8Q A;  4EVD A;  5D8O A;  2ZA7 A;  2V15 A;  2CN7 A;  5CZU A;  3F38 A;  3IQ1 A;  1UMN A;  1DVB A;  3FSE A;  4ZKX A;  3TA8 A;  1YV1 A;  4OYN A;  2D5K A;  5GN8 A;  4EVB A;  1JTS A;  3ISF A;  2ZA8 A;  4KVR A;  2FHA A;  1Z6O A;  3KA6 A;  3IS7 A;  4CVT A;  3KA8 A;  4LQH A;  4ZJK A;  1OTK A;  3UOI A;  4DE6 A;  4M35 A;  3KXU A;  3PVR B;  3RBC A;  1RCC A;  4CYB A;  3SHX A;  1JRE A;  5FFA A;  3R2H A;  3AF8 X;  2V2N A;  3QB9 A;  4MKU A;  2XJM A;  2BW1 A;  2C6R A;  4LPM A;  4TOB A;  1AEW A;  2HTN A;  3AF7 X;  5GN8 B;  2CLB A;  1HRS A;  2HR5 A;  2X17 0;  3E1J A;  3WVU A;  1UVH A;  2JD7 0;  4ISP A;  5D8P A;  5LS9 A;  3Q4Q A;  5GU1 X;  5JKM A;  1TKP A;  3R2R A;  3Q4R A;  4TOC A;  4E6K A;  1TKO A;  4MY7 A;  1YUZ A;  1FHA A;  3AF9 X;  3E6R A;  1RCD A;  2FG8 A;  5D8S A;  3R2S A;  3BVF A;  1O9I A;  1N1Q A;  2FFX J;  3PVY A;  5JAC A;  2WLU A;  4LPJ A;  5K52 A;  3R2K A;  3E1Q A;  3BT5 A;  5D8R A;  2XJO A;  3AJO A;  4DYX A;  2YJK A;  1JGC A;  3PW1 B;  1DAT A;  3PWQ C;  2YJJ A;  4CMY A;  2UX1 A;  4II4 A;  2CN6 A;  1S30 A;  3GVY A;  4CMY V;  1GWG A;  3EGM A;  3E1L A;  3PZA A;  2G4H A;  1BCF A;  1O9R A;  2V2L A;  2ZA6 A;  4EVE A;  3UOF A;  5LG8 A;  3PW8 A;  2IY4 A;  5ERK A;  3BVK A;  1BG7 A;  3OGH A;  3E1N A;  2IB0 A;  5LBH A;  3F37 A;  2VXX A;  3E1P A;  2OC5 A;  2Z6M A;  3H7G A;  2WLA A;  3PVY B;  3E2C A;  5LG2 A;  2YW7 A;  3ES3 A;  1S2Z A;  2GS4 A;  2JD6 0;  3KA4 A;  2BKC A;  1S3Q A;  3AK9 A;  4Y08 A;  5CMQ A;  2C2F A;  3WNW A;  2WTL A;  3VNX A;  4II4 B;  1IES A;  1SQ3 A;  5FFC A;  2ZUR X;  4Z5S A;  1MFR A;  1LKM A;  3QZ3 A;  3UNO A;  4TOA A;  2OH3 A;  2FG4 A;  3BKN A;  2FL0 A;  2Z90 A;  4MUD A;  3RAV A;  2CIH A;  2ZG8 X;  3F36 A;  3HL1 A;  2V2M A;  3U90 A;  4CVS A;  1EUM A;  4ML5 A;  3NOZ X;  2W0O A;  2Y3Q A;  5FEJ A;  3QD8 A;  3WVV A;  4TOD A;  2BK6 A;  4EVC A;  4DYU A;  5AXS A;  4CYA A;  4LQN A;  5HQO A;  1IER A;  1TJO A;  1DPS A;  4M33 A;  1XZ3 A;  1L8H A;  3FVB A;  3KA9 A;  5E1U A;  1XZ1 A;  5IX6 A;  3E1M A;  2CHI A;  1VEI A;  1JI4 A;  3OJ5 A;  4PGK A;  3RE7 A;  1H96 A;  2FJC A;  2XGW A;  4TOE A;  4RC6 A;  5JKL G;  3O7S A;  4CVR A;  1JI5 A;  2ITB A;  1RYT A;  2XKQ A;  1R03 A;  4LQV A;  2FKZ A;  4QUW A;  4ZKH A;  4RC7 A;  1Z4A A;  1F30 A;  4ISM A;  3NP2 X;  2CEI A;  5D8Y A;  2BJY A;  4XKT A;  3R2M A;  4IXK A;  4AM4 A;  4XGS A;  1QYB A;  1F33 A;  1JKV A;  3RGD A;  2CHP A;  1YUX A;  2JD8 0;  4LYX A;  3BVI A;  2YW6 A;  4Z3B A;  3T9J A;  4AM2 A;  2XJN A;  4DAS A;  4ITT A;  4P18 A;  5GU2 X;  2C41 A;  3SE1 A;  3ISE A;  3HIU A;  1VEQ A;  1ZUJ A;  4MN9 A;  3MPS A;  4DYY A;  5I4J A;  4DI0 A;  2C2U A;  5C6F A;  3O7R A;  2ZG7 X; 
#chains in the Genus database with same CATH topology
 3F35 A;  3N6O A;  3F39 A;  1RCE A;  4YVZ A;  1LKO A;  3E6S A;  3KWO A;  4YKH A;  2QQY A;  2CLU A;  5HU6 D;  4RC8 A;  3R2O A;  4TOG A;  3GGZ A;  4XKU A;  4ZTT A;  2CF7 A;  4IWK A;  4R42 A;  4CY9 A;  1NNQ A;  3WVW A;  1JKU A;  3F34 A;  5FFD A;  3UFB A;  5J8S A;  1JYB A;  4RC5 A;  2VZB A;  2GYD A;  3QHB A;  3Q4N A;  5ERJ A;  1VLG A;  1L8I A;  5JKL A;  3F33 A;  2Z5Q A;  3NP0 X;  3VV9 A;  3A68 A;  3PVT A;  4ERU A;  1LKP A;  5FFE A;  3PWQ A;  1NFV A;  1QGH A;  5E2D A;  4LQJ A;  1NF6 A;  2C2J A;  4XKS A;  1TK6 A;  4PG1 A;  2V2O A;  5HJH A;  4ZL5 A;  3AK8 A;  5J9V A;  4KVS A;  1LB3 A;  3R2L A;  4A25 A;  5GU0 X;  1J30 A;  5J93 A;  5HJF A;  4ZKW A;  2Z5R A;  4IWJ A;  3PW8 C;  4ZMC A;  3GE4 A;  4PG0 A;  2QF9 A;  4RC5 B;  1JIG A;  2V2I A;  3Q4O A;  3KA3 A;  4ZLW A;  2ZG9 X;  3ERZ A;  3PVT B;  2FZF A;  3BVE A;  1Z6O M;  3IS8 A;  3A9Q A;  3EZ0 A;  3FI6 A;  1MOJ A;  1VJX A;  3PW1 A;  1BFR A;  3QHC A;  3F32 A;  4LPN A;  3SID A;  3AJQ A;  5GOU A;  4X0J A;  5JDO A;  4ZL6 A;  1KRQ A;  4AM5 A;  2F7N A;  2V2J A;  5GU3 X;  2N02 A;  1B71 A;  2V2S A;  4YXJ A;  3KX9 A;  2GYQ A;  5D8X A;  3RD0 A;  4TO9 A;  5J8W A;  2V2P A;  4REU A;  4LYU A;  1VEL A;  3SH6 A;  4RC6 B;  4M34 A;  4M32 A;  3PWF A;  4ETR A;  3QVD A;  4RC7 B;  2RBD A;  5FFB A;  2VXI A;  1RCI A;  1NF4 A;  2V2R A;  3GHQ A;  5JKM G;  1RCG A;  5CMR A;  2V8U A;  4MJY A;  5JDO B;  4ITW A;  4KVQ A;  1SOF A;  4DZ0 A;  4CVP A;  2IU2 A;  3AJP A;  3EZU A;  4TOH A;  3BVL A;  5K53 A;  2Z5P A;  1ZS3 A;  4PGI A;  4DYZ A;  3V3K B;  4TOF A;  3PVR A;  4U3G A;  4WJG 4;  2PYB A;  4TW3 A;  3E1O A;  5D8Q A;  4EVD A;  5D8O A;  2ZA7 A;  2V15 A;  2CN7 A;  5CZU A;  3F38 A;  3D19 A;  3IQ1 A;  3JZA B;  1UMN A;  1DVB A;  3FSE A;  4ZKX A;  3TA8 A;  1YV1 A;  4OYN A;  2D5K A;  5GN8 A;  4EVB A;  1JTS A;  3ISF A;  2ZA8 A;  4KVR A;  2FHA A;  1Z6O A;  3KA6 A;  3IS7 A;  4CVT A;  3KA8 A;  4LQH A;  4ZJK A;  1OTK A;  4W4K B;  3UOI A;  4DE6 A;  4M35 A;  3KXU A;  3PVR B;  3RBC A;  1RCC A;  4CYB A;  3SHX A;  1JRE A;  5FFA A;  3R2H A;  3AF8 X;  2V2N A;  3QB9 A;  4MKU A;  3VVA A;  3W54 A;  2XJM A;  2BW1 A;  2C6R A;  4LPM A;  4TOB A;  1AEW A;  3KHK A;  2HTN A;  3AF7 X;  5GN8 B;  2CLB A;  1HRS A;  2HR5 A;  2X17 0;  3E1J A;  3WVU A;  1UVH A;  2JD7 0;  4ISP A;  3M6J A;  5D8P A;  5LS9 A;  3Q4Q A;  5GU1 X;  5JKM A;  1TKP A;  4E40 A;  3R2R A;  3Q4R A;  4MXP A;  4TOC A;  4E6K A;  1TKO A;  4MY7 A;  1YUZ A;  1FHA A;  3AF9 X;  4W4L B;  3E6R A;  1RCD A;  2FG8 A;  5D8S A;  3R2S A;  3BVF A;  1O9I A;  1N1Q A;  2FFX J;  3PVY A;  5JAC A;  2WLU A;  4LPJ A;  5K52 A;  3R2K A;  3E1Q A;  4KXR B;  2Y44 A;  3BT5 A;  2MGY A;  5D8R A;  2XJO A;  3AJO A;  3C1Z A;  4DYX A;  2YJK A;  1JGC A;  3PW1 B;  1DAT A;  3PWQ C;  2YJJ A;  4CMY A;  2UX1 A;  4II4 A;  2CN6 A;  1S30 A;  3GVY A;  4CMY V;  1GWG A;  3EGM A;  3E1L A;  2AR0 A;  3PZA A;  2G4H A;  1BCF A;  1O9R A;  2V2L A;  2ZA6 A;  4EVE A;  3UOF A;  5LG8 A;  3PW8 A;  2IY4 A;  5ERK A;  3BVK A;  1BG7 A;  3OGH A;  3E1N A;  2IB0 A;  5LBH A;  3F37 A;  2VXX A;  3E1P A;  2OC5 A;  2Z6M A;  3GGY A;  2WLA A;  3H7G A;  3PVY B;  3E2C A;  5LG2 A;  3C1Y A;  3C21 A;  2YW7 A;  3ES3 A;  1S2Z A;  2GS4 A;  2JD6 0;  3KA4 A;  2WWX B;  2BKC A;  1S3Q A;  3AK9 A;  4Y08 A;  5CMQ A;  2C2F A;  3WNW A;  2WTL A;  3VNX A;  4II4 B;  1IES A;  1SQ3 A;  5FFC A;  2ZUR X;  4Z5S A;  1MFR A;  1LKM A;  3QZ3 A;  3UNO A;  4TOA A;  3LKD A;  2OH3 A;  2FG4 A;  3BKN A;  2FL0 A;  2Z90 A;  4MUD A;  3RAV A;  2CIH A;  2ZG8 X;  4YXM A;  3F36 A;  3HL1 A;  2V2M A;  3U90 A;  4CVS A;  1EUM A;  4ML5 A;  3NOZ X;  2W0O A;  2Y3Q A;  5FEJ A;  3QD8 A;  3WVV A;  4TOD A;  2BK6 A;  4EVC A;  4DYU A;  5AXS A;  4CYA A;  4LQN A;  5HQO A;  1IER A;  2CWL A;  1TJO A;  1DPS A;  4M33 A;  1XZ3 A;  1L8H A;  2G38 B;  3FVB A;  3KA9 A;  5E1U A;  1XZ1 A;  5IX6 A;  3E1M A;  2CHI A;  1VEI A;  1JI4 A;  3OJ5 A;  4PGK A;  3RE7 A;  1H96 A;  2FJC A;  2XGW A;  3L0M A;  2OKC A;  4TOE A;  4RC6 A;  5JKL G;  3O7S A;  4CVR A;  1JI5 A;  2ITB A;  1RYT A;  2XKQ A;  1R03 A;  4LQV A;  2FKZ A;  4QUW A;  4ZKH A;  4RC7 A;  1Z4A A;  1F30 A;  3DBY A;  4ISM A;  3NP2 X;  2CEI A;  5D8Y A;  2BJY A;  4XKT A;  3R2M A;  4IXK A;  4AM4 A;  4XGS A;  1QYB A;  3KDQ A;  1F33 A;  1JKV A;  3RGD A;  2CHP A;  1YUX A;  2JD8 0;  3FRS A;  4LYX A;  3BVI A;  2YW6 A;  3C23 A;  4Z3B A;  3T9J A;  4AM2 A;  2XJN A;  4DAS A;  4ITT A;  4P18 A;  5GU2 X;  2C41 A;  3SE1 A;  3ISE A;  3FRR A;  3HIU A;  1VEQ A;  1ZUJ A;  4MN9 A;  3MPS A;  3JZ9 A;  4DYY A;  5I4J A;  4DI0 A;  2C2U A;  5C6F A;  3O7R A;  2V8T A;  2ZG7 X; 
#chains in the Genus database with same CATH homology
 3F35 A;  3N6O A;  3F39 A;  1RCE A;  4YVZ A;  1LKO A;  3E6S A;  3KWO A;  4YKH A;  2QQY A;  2CLU A;  5HU6 D;  4RC8 A;  3R2O A;  4TOG A;  3GGZ A;  4XKU A;  4ZTT A;  2CF7 A;  4IWK A;  4R42 A;  4CY9 A;  1NNQ A;  3WVW A;  1JKU A;  3F34 A;  5FFD A;  3UFB A;  5J8S A;  1JYB A;  4RC5 A;  2VZB A;  2GYD A;  3QHB A;  3Q4N A;  5ERJ A;  1VLG A;  1L8I A;  5JKL A;  3F33 A;  2Z5Q A;  3NP0 X;  3VV9 A;  3A68 A;  3PVT A;  4ERU A;  1LKP A;  5FFE A;  3PWQ A;  1NFV A;  1QGH A;  5E2D A;  4LQJ A;  1NF6 A;  2C2J A;  4XKS A;  1TK6 A;  4PG1 A;  2V2O A;  5HJH A;  4ZL5 A;  3AK8 A;  5J9V A;  4KVS A;  1LB3 A;  3R2L A;  4A25 A;  5GU0 X;  1J30 A;  5J93 A;  5HJF A;  4ZKW A;  2Z5R A;  4IWJ A;  3PW8 C;  4ZMC A;  3GE4 A;  4PG0 A;  2QF9 A;  4RC5 B;  1JIG A;  2V2I A;  3Q4O A;  3KA3 A;  4ZLW A;  2ZG9 X;  3ERZ A;  3PVT B;  2FZF A;  3BVE A;  1Z6O M;  3IS8 A;  3A9Q A;  3EZ0 A;  3FI6 A;  1MOJ A;  1VJX A;  3PW1 A;  1BFR A;  3QHC A;  3F32 A;  4LPN A;  3SID A;  3AJQ A;  5GOU A;  4X0J A;  5JDO A;  4ZL6 A;  1KRQ A;  4AM5 A;  2F7N A;  2V2J A;  5GU3 X;  2N02 A;  1B71 A;  2V2S A;  4YXJ A;  3KX9 A;  2GYQ A;  5D8X A;  3RD0 A;  4TO9 A;  5J8W A;  2V2P A;  4REU A;  4LYU A;  1VEL A;  3SH6 A;  4RC6 B;  4M34 A;  4M32 A;  3PWF A;  4ETR A;  3QVD A;  4RC7 B;  2RBD A;  5FFB A;  2VXI A;  1RCI A;  1NF4 A;  2V2R A;  3GHQ A;  5JKM G;  1RCG A;  5CMR A;  2V8U A;  4MJY A;  5JDO B;  4ITW A;  4KVQ A;  1SOF A;  4DZ0 A;  4CVP A;  2IU2 A;  3AJP A;  3EZU A;  4TOH A;  3BVL A;  5K53 A;  2Z5P A;  1ZS3 A;  4PGI A;  4DYZ A;  3V3K B;  4TOF A;  3PVR A;  4U3G A;  4WJG 4;  2PYB A;  4TW3 A;  3E1O A;  5D8Q A;  4EVD A;  5D8O A;  2ZA7 A;  2V15 A;  2CN7 A;  5CZU A;  3F38 A;  3D19 A;  3IQ1 A;  3JZA B;  1UMN A;  1DVB A;  3FSE A;  4ZKX A;  3TA8 A;  1YV1 A;  4OYN A;  2D5K A;  5GN8 A;  4EVB A;  1JTS A;  3ISF A;  2ZA8 A;  4KVR A;  2FHA A;  1Z6O A;  3KA6 A;  3IS7 A;  4CVT A;  3KA8 A;  4LQH A;  4ZJK A;  1OTK A;  4W4K B;  3UOI A;  4DE6 A;  4M35 A;  3KXU A;  3PVR B;  3RBC A;  1RCC A;  4CYB A;  3SHX A;  1JRE A;  5FFA A;  3R2H A;  3AF8 X;  2V2N A;  3QB9 A;  4MKU A;  3VVA A;  3W54 A;  2XJM A;  2BW1 A;  2C6R A;  4LPM A;  4TOB A;  1AEW A;  3KHK A;  2HTN A;  3AF7 X;  5GN8 B;  2CLB A;  1HRS A;  2HR5 A;  2X17 0;  3E1J A;  3WVU A;  1UVH A;  2JD7 0;  4ISP A;  3M6J A;  5D8P A;  5LS9 A;  3Q4Q A;  5GU1 X;  5JKM A;  1TKP A;  4E40 A;  3R2R A;  3Q4R A;  4MXP A;  4TOC A;  4E6K A;  1TKO A;  4MY7 A;  1YUZ A;  1FHA A;  3AF9 X;  4W4L B;  3E6R A;  1RCD A;  2FG8 A;  5D8S A;  3R2S A;  3BVF A;  1O9I A;  1N1Q A;  2FFX J;  3PVY A;  5JAC A;  2WLU A;  4LPJ A;  5K52 A;  3R2K A;  3E1Q A;  4KXR B;  2Y44 A;  3BT5 A;  2MGY A;  5D8R A;  2XJO A;  3AJO A;  3C1Z A;  4DYX A;  2YJK A;  1JGC A;  3PW1 B;  1DAT A;  3PWQ C;  2YJJ A;  4CMY A;  2UX1 A;  4II4 A;  2CN6 A;  1S30 A;  3GVY A;  4CMY V;  1GWG A;  3EGM A;  3E1L A;  2AR0 A;  3PZA A;  2G4H A;  1BCF A;  1O9R A;  2V2L A;  2ZA6 A;  4EVE A;  3UOF A;  5LG8 A;  3PW8 A;  2IY4 A;  5ERK A;  3BVK A;  1BG7 A;  3OGH A;  3E1N A;  2IB0 A;  5LBH A;  3F37 A;  2VXX A;  3E1P A;  2OC5 A;  2Z6M A;  3GGY A;  2WLA A;  3H7G A;  3PVY B;  3E2C A;  5LG2 A;  3C1Y A;  3C21 A;  2YW7 A;  3ES3 A;  1S2Z A;  2GS4 A;  2JD6 0;  3KA4 A;  2WWX B;  2BKC A;  1S3Q A;  3AK9 A;  4Y08 A;  5CMQ A;  2C2F A;  3WNW A;  2WTL A;  3VNX A;  4II4 B;  1IES A;  1SQ3 A;  5FFC A;  2ZUR X;  4Z5S A;  1MFR A;  1LKM A;  3QZ3 A;  3UNO A;  4TOA A;  3LKD A;  2OH3 A;  2FG4 A;  3BKN A;  2FL0 A;  2Z90 A;  4MUD A;  3RAV A;  2CIH A;  2ZG8 X;  4YXM A;  3F36 A;  3HL1 A;  2V2M A;  3U90 A;  4CVS A;  1EUM A;  4ML5 A;  3NOZ X;  2W0O A;  2Y3Q A;  5FEJ A;  3QD8 A;  3WVV A;  4TOD A;  2BK6 A;  4EVC A;  4DYU A;  5AXS A;  4CYA A;  4LQN A;  5HQO A;  1IER A;  2CWL A;  1TJO A;  1DPS A;  4M33 A;  1XZ3 A;  1L8H A;  2G38 B;  3FVB A;  3KA9 A;  5E1U A;  1XZ1 A;  5IX6 A;  3E1M A;  2CHI A;  1VEI A;  1JI4 A;  3OJ5 A;  4PGK A;  3RE7 A;  1H96 A;  2FJC A;  2XGW A;  3L0M A;  2OKC A;  4TOE A;  4RC6 A;  5JKL G;  3O7S A;  4CVR A;  1JI5 A;  2ITB A;  1RYT A;  2XKQ A;  1R03 A;  4LQV A;  2FKZ A;  4QUW A;  4ZKH A;  4RC7 A;  1Z4A A;  1F30 A;  3DBY A;  4ISM A;  3NP2 X;  2CEI A;  5D8Y A;  2BJY A;  4XKT A;  3R2M A;  4IXK A;  4AM4 A;  4XGS A;  1QYB A;  3KDQ A;  1F33 A;  1JKV A;  3RGD A;  2CHP A;  1YUX A;  2JD8 0;  3FRS A;  4LYX A;  3BVI A;  2YW6 A;  3C23 A;  4Z3B A;  3T9J A;  4AM2 A;  2XJN A;  4DAS A;  4ITT A;  4P18 A;  5GU2 X;  2C41 A;  3SE1 A;  3ISE A;  3FRR A;  3HIU A;  1VEQ A;  1ZUJ A;  4MN9 A;  3MPS A;  3JZ9 A;  4DYY A;  5I4J A;  4DI0 A;  2C2U A;  5C6F A;  3O7R A;  2V8T A;  2ZG7 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...