5I4JA

Dps4 from nostoc punctiforme in complex with zn ions
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
177
structure length
177
Chain Sequence
TLLRNFGNVYDNPVLLDRSVTAPVTEGFNVVLASFQALYLQYQKHHFVVEGSEFYSLHEFFNESYNQVQDHIHEIGERLDGLGGVPVATFSKLAELTCFEQESEGVYSSRQMVENDLAAEQAIIGVIRRQAAQAESLGDRGTRYLYEKILLKTEERAYHLSHFLAKDSLTLGFVQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin, Dps family protein
publication title On the trail of iron into Dps4 from N. punctiforme
rcsb
source organism Nostoc punctiforme
molecule tags Metal binding protein
total genus 71
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5i4jA00
4M35A 1O9IA 5HJHA 4PG0A 3E1NA 1MFRA 3Q4QA 3GHQA 1LKMA 2CHPA 3KA9A 3SIDA 2BK6A 2IU2A 1YUZA 4XKSA 3UOFA 3FSEA 2ZG9X 2D5KA 3WVVA 3O7RA 3BVIA 3IS8A 5D8PA 1RCGA 4TW3A 3KA6A 3E1LA 3AF9X 4II4A 4CYAA 5FFEA 4ZKHA 1ZS3A 1IESA 4LQHA 4U3GA 3QZ3A 3RBCA 3RGDA 4ITWA 3PW8A 4TO9A 3EZUA 3O7SA 3BVFA 3R2KA 1R03A 4CVPA 4IWKA 3F33A 1XZ3A 3QHCA 1SQ3A 1VJXA 2WLUA 2YJJA 3KX9A 4AM5A 3F35A 1Z6OM 3AK8A 3WVWA 4RC6B 1YV1A 5GN8A 4ETRA 1QYBA 3PVRA 3PZAA 3R2OA 2V2OA 1S30A 3T9JA 4RC7A 1JREA 3AJPA 3A9QA 4DASA 5C6FA 3FI6A 1VEIA 2YW6A 3KA3A 3KXUA 2CHIA 4LQNA 4CVSA 4LPJA 3R2MA 3A68A 1JKUA 4Z3BA 1XZ1A 3E1QA 5FFAA 2IY4A 4CYBA 1UVHA 4LYXA 1ZUJA 3QB9A 4XKTA 4R42A 5FFDA 2CN7A 3QD8A 4PGKA 2FZFA 2XGWA 5GU3X 2CN6A 1GWGA 2GS4A 5JKMG 3AJQA 1RCEA 1RCCA 2Z6MA 3RAVA 5AXSA 2VXIA 2FG8A 2V15A 3ISEA 4ERUA 2BKCA 3E1JA 5CMQA 3Q4RA 4ML5A 3F32A 5HQOA 1HRSA 3RE7A 1OTKA 2C2FA 5CMRA 4MJYA 4Y08A 3R2SA 1DATA 3E2CA 3F34A 3PWQA 4DYYA 1JKVA 1JYBA 2ZURX 3SHXA 4MKUA 3UNOA 4DYZA 2V2RA 1LB3A 4ISMA 3F37A 4II4B 3R2LA 3HL1A 2GYDA 1EUMA 3GVYA 3GE4A 1F30A 1DVBA 1VLGA 2W0OA 2V2JA 1IERA 2OC5A 2OH3A 2XJOA 4DI0A 4ZL6A 1AEWA 4P18A 3WNWA 3PW1B 2UX1A 2Y3QA 2ZA6A 1VEQA 1Z6OA 2VXXA 1L8IA 3ERZA 4LQJA 4DE6A 5HJFA 5JACA 1YUXA 2PYBA 2YJKA 2ITBA 4CMYA 2JD70 4TOAA 4A25A 3OGHA 5K53A 2FHAA 4XGSA 3EZ0A 3IQ1A 5LG2A 2WTLA 1TKOA 4ZLWA 4Z5SA 5LBHA 4LYUA 5E2DA 4DZ0A 4LQVA 4KVRA 3PVRB 2FG4A 5D8YA 4CVRA 1B71A 5ERJA 3H7GA 4RC8A 5FFCA 3PVTB 1JGCA 2FJCA 5LS9A 2IB0A 2V2MA 5CZUA 2QF9A 3QVDA 5GOUA 4M34A 4RC5A 4DYUA 4LPNA 5JKLA 3ES3A 3AJOA 1JI5A 2CIHA 3NOZX 2FKZA 1BG7A 5J8SA 4TOFA 4M33A 3WVUA 2JD60 4ZJKA 3KA4A 1H96A 1KRQA 4LPMA 1JIGA 1NF6A 1RCIA 1NNQA 5D8XA 5IX6A 1O9RA 3PVYB 4CY9A 4ZKXA 2Z5RA 2WLAA 3KWOA 1QGHA 4M32A 1LKOA 2VZBA 2Z5QA 2FL0A 3VNXA 2F7NA 4OYNA 1JI4A 3PW8C 1S2ZA 2XJMA 3KA8A 3Q4NA 4PG1A 1L8HA 5GU1X 2CF7A 3QHBA 3RD0A 4ITTA 4KVSA 2GYQA 2Z5PA 3BT5A 4EVCA 4PGIA 2BW1A 5J8WA 4IWJA 4YKHA 1SOFA 2ZA7A 4TODA 1JTSA 1TKPA 3R2RA 2QQYA 1NF4A 2ZG7X 4ZKWA 3R2HA 5D8QA 2BJYA 4CMYV 3F39A 4KVQA 3NP0X 3TA8A 4MY7A 5ERKA 5D8SA 2CLBA 3E1MA 4ISPA 2V2IA 1F33A 4MUDA 3BKNA 2V2NA 3F36A 2Z90A 3F38A 3SE1A 2YW7A 3IS7A 5GU0X 1J30A 5E1UA 4AM2A 4TOCA 3NP2X 4QUWA 5GN8B 4EVEA 1TJOA 2ZG8X 3EGMA 3E1PA 1VELA 1DPSA 1N1QA 3FVBA 2X170 3E6SA 3PWFA 3Q4OA 4RC7B 2C2UA 5FEJA 4AM4A 4RC5B 4ZL5A 4XKUA 1MOJA 3PW1A 5J93A 3PWQC 4TOGA 3E1OA 3OJ5A 3ISFA 5JKMA 5I4JA 2JD80 2V2SA 2C2JA 1RYTA 1BCFA 5GU2X 4MN9A 1FHAA 4TOBA 4DYXA 2ZA8A 3MPSA 1S3QA 1Z4AA 4TOHA 4E6KA 5LG8A 3E6RA 2HR5A 4EVBA 2RBDA 1LKPA 3BVKA 4EVDA 1RCDA 3PVTA 4RC6A 2C41A 2C6RA 2G4HA 3AF7X 2HTNA 1BFRA 1UMNA 2CLUA 3U90A 1TK6A 2XJNA 3HIUA 4ZTTA 4IXKA 5J9VA 2V2PA 5D8RA 3SH6A 5D8OA 4CVTA 5FFBA 3BVEA 3AF8X 4REUA 3BVLA 4ZMCA 1NFVA 2FFXJ 2CEIA 4TOEA 2V2LA 3PVYA 2XKQA 5K52A 5JKLG 3UOIA 3AK9A
chains in the Genus database with same CATH superfamily
4M35A 1O9IA 5HJHA 3C23A 3E1NA 4PG0A 1MFRA 3Q4QA 3GHQA 1LKMA 2CHPA 3UFBA 3KA9A 3SIDA 4E40A 2BK6A 2IU2A 1YUZA 3LKDA 4XKSA 3UOFA 3FSEA 2ZG9X 3N6OA 2D5KA 3WVVA 3O7RA 3BVIA 3IS8A 3FRSA 5D8PA 1RCGA 4TW3A 3KA6A 3E1LA 3AF9X 4II4A 4CYAA 5FFEA 4ZKHA 1ZS3A 1IESA 3C1ZA 4LQHA 4U3GA 3QZ3A 3RBCA 3RGDA 4ITWA 3PW8A 3W54A 4TO9A 3EZUA 3O7SA 3BVFA 3R2KA 1R03A 4CVPA 4IWKA 3F33A 1XZ3A 3JZAB 3QHCA 1SQ3A 1VJXA 2WLUA 2YJJA 3KX9A 4AM5A 3F35A 3M6JA 1Z6OM 3AK8A 3FRRA 3WVWA 4RC6B 1YV1A 5GN8A 4ETRA 1QYBA 3PVRA 3PZAA 3R2OA 3VV9A 2V2OA 1S30A 3T9JA 4RC7A 1JREA 3AJPA 3A9QA 4DASA 5C6FA 3FI6A 1VEIA 4YXMA 2YW6A 3KA3A 3KXUA 2CHIA 4LQNA 4CVSA 4LPJA 3R2MA 3A68A 1JKUA 4Z3BA 1XZ1A 3E1QA 5FFAA 2IY4A 4CYBA 1UVHA 4LYXA 1ZUJA 3QB9A 4XKTA 4R42A 5FFDA 2CN7A 3QD8A 4PGKA 2FZFA 2CWLA 2XGWA 5GU3X 2CN6A 1GWGA 5HU6D 5JDOB 2GS4A 5JKMG 3AJQA 1RCEA 1RCCA 2WWXB 2Z6MA 3RAVA 5AXSA 2VXIA 2FG8A 2V15A 3ISEA 4ERUA 2BKCA 3E1JA 3GGYA 5CMQA 3Q4RA 3KDQA 4ML5A 3F32A 5HQOA 1HRSA 3RE7A 1OTKA 2C2FA 5CMRA 4MJYA 4Y08A 3R2SA 2MGYA 1DATA 3E2CA 3F34A 3PWQA 4DYYA 4W4LB 1JKVA 1JYBA 2ZURX 3SHXA 4MKUA 3UNOA 4DYZA 2V2RA 1LB3A 4ISMA 3F37A 4II4B 3R2LA 3HL1A 2GYDA 1EUMA 3GVYA 3GE4A 1F30A 1DVBA 1VLGA 2W0OA 2V2JA 1IERA 2OC5A 2OH3A 2XJOA 4DI0A 4ZL6A 1AEWA 4P18A 3WNWA 3PW1B 2UX1A 2Y3QA 3GGZA 2ZA6A 1VEQA 1Z6OA 2G38B 2VXXA 1L8IA 3ERZA 4LQJA 4DE6A 5HJFA 5JACA 1YUXA 2PYBA 2YJKA 2ITBA 4CMYA 2JD70 4TOAA 4A25A 3OGHA 5K53A 2FHAA 4XGSA 3EZ0A 3IQ1A 5LG2A 2WTLA 1TKOA 3L0MA 4Z5SA 5LBHA 4ZLWA 4LYUA 5E2DA 4MXPA 4DZ0A 4LQVA 4KVRA 3PVRB 2FG4A 5D8YA 4CVRA 1B71A 5ERJA 3H7GA 4RC8A 5FFCA 3PVTB 1JGCA 2FJCA 5LS9A 2IB0A 2V2MA 5CZUA 2QF9A 3QVDA 5GOUA 4M34A 4RC5A 4DYUA 4LPNA 5JKLA 3ES3A 3AJOA 1JI5A 2CIHA 3NOZX 2FKZA 1BG7A 5J8SA 4TOFA 4M33A 3WVUA 2JD60 4ZJKA 3KA4A 1H96A 1KRQA 4LPMA 1JIGA 1NF6A 1RCIA 1NNQA 5D8XA 5IX6A 1O9RA 3JZ9A 3PVYB 4CY9A 4ZKXA 2Z5RA 2WLAA 3KWOA 3VVAA 1QGHA 4M32A 1LKOA 2VZBA 2Z5QA 2FL0A 4W4KB 3VNXA 2F7NA 4OYNA 1JI4A 3PW8C 1S2ZA 2XJMA 3KA8A 3Q4NA 3D19A 4PG1A 1L8HA 5GU1X 2CF7A 3QHBA 3RD0A 4ITTA 4KVSA 2GYQA 2Z5PA 3BT5A 4EVCA 4PGIA 2BW1A 5J8WA 4IWJA 4YKHA 1SOFA 2ZA7A 4TODA 3V3KB 4WJG4 1JTSA 1TKPA 3R2RA 5JDOA 2QQYA 1NF4A 2ZG7X 4ZKWA 3R2HA 5D8QA 2BJYA 4CMYV 3DBYA 3F39A 4KVQA 2Y44A 3NP0X 3TA8A 4MY7A 5ERKA 5D8SA 2CLBA 3E1MA 4ISPA 2V2IA 1F33A 4MUDA 3BKNA 2V2NA 3F36A 2Z90A 3F38A 3SE1A 2YW7A 3IS7A 5GU0X 1J30A 5E1UA 4KXRB 4AM2A 4TOCA 3NP2X 4QUWA 5GN8B 4EVEA 1TJOA 2ZG8X 3EGMA 3E1PA 1VELA 1DPSA 1N1QA 2V8TA 3FVBA 2X170 3E6SA 3PWFA 3Q4OA 4RC7B 2C2UA 5FEJA 4AM4A 4RC5B 4ZL5A 3KHKA 4XKUA 1MOJA 3PW1A 5J93A 3PWQC 4TOGA 3E1OA 4YVZA 3OJ5A 3ISFA 5JKMA 5I4JA 2OKCA 2JD80 2V2SA 2C2JA 1RYTA 1BCFA 5GU2X 3C1YA 4MN9A 1FHAA 4TOBA 4DYXA 2ZA8A 3MPSA 3C21A 1S3QA 1Z4AA 4TOHA 4E6KA 5LG8A 3E6RA 2HR5A 4EVBA 4YXJA 2RBDA 2AR0A 1LKPA 3BVKA 4EVDA 1RCDA 3PVTA 4RC6A 2C41A 2C6RA 2G4HA 3AF7X 2HTNA 1BFRA 1UMNA 2CLUA 2N02A 3U90A 1TK6A 2XJNA 3HIUA 4X0JA 4IXKA 4ZTTA 5J9VA 2V2PA 5D8RA 3SH6A 2V8UA 5D8OA 4CVTA 5FFBA 3BVEA 3AF8X 4REUA 3BVLA 4ZMCA 1NFVA 2FFXJ 2CEIA 4TOEA 2V2LA 3PVYA 2XKQA 5K52A 5JKLG 3UOIA 3AK9A
chains in the Genus database with same CATH topology
4M35A 1O9IA 5HJHA 3C23A 3E1NA 4PG0A 1MFRA 3Q4QA 3GHQA 1LKMA 2CHPA 3UFBA 3KA9A 3SIDA 4E40A 2BK6A 2IU2A 1YUZA 3LKDA 4XKSA 3UOFA 3FSEA 2ZG9X 3N6OA 2D5KA 3WVVA 3O7RA 3BVIA 3IS8A 3FRSA 5D8PA 1RCGA 4TW3A 3KA6A 3E1LA 3AF9X 4II4A 4CYAA 5FFEA 4ZKHA 1ZS3A 1IESA 3C1ZA 4LQHA 4U3GA 3QZ3A 3RBCA 3RGDA 4ITWA 3PW8A 3W54A 4TO9A 3EZUA 3O7SA 3BVFA 3R2KA 1R03A 4CVPA 4IWKA 3F33A 1XZ3A 3JZAB 3QHCA 1SQ3A 1VJXA 2WLUA 2YJJA 3KX9A 4AM5A 3F35A 3M6JA 1Z6OM 3AK8A 3FRRA 3WVWA 4RC6B 1YV1A 5GN8A 4ETRA 1QYBA 3PVRA 3PZAA 3R2OA 3VV9A 2V2OA 1S30A 3T9JA 4RC7A 1JREA 3AJPA 3A9QA 4DASA 5C6FA 3FI6A 1VEIA 4YXMA 2YW6A 3KA3A 3KXUA 2CHIA 4LQNA 4CVSA 4LPJA 3R2MA 3A68A 1JKUA 4Z3BA 1XZ1A 3E1QA 5FFAA 2IY4A 4CYBA 1UVHA 4LYXA 1ZUJA 3QB9A 4XKTA 4R42A 5FFDA 2CN7A 3QD8A 4PGKA 2FZFA 2CWLA 2XGWA 5GU3X 2CN6A 1GWGA 5HU6D 5JDOB 2GS4A 5JKMG 3AJQA 1RCEA 1RCCA 2WWXB 2Z6MA 3RAVA 5AXSA 2VXIA 2FG8A 2V15A 3ISEA 4ERUA 2BKCA 3E1JA 3GGYA 5CMQA 3Q4RA 3KDQA 4ML5A 3F32A 5HQOA 1HRSA 3RE7A 1OTKA 2C2FA 5CMRA 4MJYA 4Y08A 3R2SA 2MGYA 1DATA 3E2CA 3F34A 3PWQA 4DYYA 4W4LB 1JKVA 1JYBA 2ZURX 3SHXA 4MKUA 3UNOA 4DYZA 2V2RA 1LB3A 4ISMA 3F37A 4II4B 3R2LA 3HL1A 2GYDA 1EUMA 3GVYA 3GE4A 1F30A 1DVBA 1VLGA 2W0OA 2V2JA 1IERA 2OC5A 2OH3A 2XJOA 4DI0A 4ZL6A 1AEWA 4P18A 3WNWA 3PW1B 2UX1A 2Y3QA 3GGZA 2ZA6A 1VEQA 1Z6OA 2G38B 2VXXA 1L8IA 3ERZA 4LQJA 4DE6A 5HJFA 5JACA 1YUXA 2PYBA 2YJKA 2ITBA 4CMYA 2JD70 4TOAA 4A25A 3OGHA 5K53A 2FHAA 4XGSA 3EZ0A 3IQ1A 5LG2A 2WTLA 1TKOA 3L0MA 4Z5SA 5LBHA 4ZLWA 4LYUA 5E2DA 4MXPA 4DZ0A 4LQVA 4KVRA 3PVRB 2FG4A 5D8YA 4CVRA 1B71A 5ERJA 3H7GA 4RC8A 5FFCA 3PVTB 1JGCA 2FJCA 5LS9A 2IB0A 2V2MA 5CZUA 2QF9A 3QVDA 5GOUA 4M34A 4RC5A 4DYUA 4LPNA 5JKLA 3ES3A 3AJOA 1JI5A 2CIHA 3NOZX 2FKZA 1BG7A 5J8SA 4TOFA 4M33A 3WVUA 2JD60 4ZJKA 3KA4A 1H96A 1KRQA 4LPMA 1JIGA 1NF6A 1RCIA 1NNQA 5D8XA 5IX6A 1O9RA 3JZ9A 3PVYB 4CY9A 4ZKXA 2Z5RA 2WLAA 3KWOA 3VVAA 1QGHA 4M32A 1LKOA 2VZBA 2Z5QA 2FL0A 4W4KB 3VNXA 2F7NA 4OYNA 1JI4A 3PW8C 1S2ZA 2XJMA 3KA8A 3Q4NA 3D19A 4PG1A 1L8HA 5GU1X 2CF7A 3QHBA 3RD0A 4ITTA 4KVSA 2GYQA 2Z5PA 3BT5A 4EVCA 4PGIA 2BW1A 5J8WA 4IWJA 4YKHA 1SOFA 2ZA7A 4TODA 3V3KB 4WJG4 1JTSA 1TKPA 3R2RA 5JDOA 2QQYA 1NF4A 2ZG7X 4ZKWA 3R2HA 5D8QA 2BJYA 4CMYV 3DBYA 3F39A 4KVQA 2Y44A 3NP0X 3TA8A 4MY7A 5ERKA 5D8SA 2CLBA 3E1MA 4ISPA 2V2IA 1F33A 4MUDA 3BKNA 2V2NA 3F36A 2Z90A 3F38A 3SE1A 2YW7A 3IS7A 5GU0X 1J30A 5E1UA 4KXRB 4AM2A 4TOCA 3NP2X 4QUWA 5GN8B 4EVEA 1TJOA 2ZG8X 3EGMA 3E1PA 1VELA 1DPSA 1N1QA 2V8TA 3FVBA 2X170 3E6SA 3PWFA 3Q4OA 4RC7B 2C2UA 5FEJA 4AM4A 4RC5B 4ZL5A 3KHKA 4XKUA 1MOJA 3PW1A 5J93A 3PWQC 4TOGA 3E1OA 4YVZA 3OJ5A 3ISFA 5JKMA 5I4JA 2OKCA 2JD80 2V2SA 2C2JA 1RYTA 1BCFA 5GU2X 3C1YA 4MN9A 1FHAA 4TOBA 4DYXA 2ZA8A 3MPSA 3C21A 1S3QA 1Z4AA 4TOHA 4E6KA 5LG8A 3E6RA 2HR5A 4EVBA 4YXJA 2RBDA 2AR0A 1LKPA 3BVKA 4EVDA 1RCDA 3PVTA 4RC6A 2C41A 2C6RA 2G4HA 3AF7X 2HTNA 1BFRA 1UMNA 2CLUA 2N02A 3U90A 1TK6A 2XJNA 3HIUA 4X0JA 4IXKA 4ZTTA 5J9VA 2V2PA 5D8RA 3SH6A 2V8UA 5D8OA 4CVTA 5FFBA 3BVEA 3AF8X 4REUA 3BVLA 4ZMCA 1NFVA 2FFXJ 2CEIA 4TOEA 2V2LA 3PVYA 2XKQA 5K52A 5JKLG 3UOIA 3AK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M35 A;  1O9I A;  5HJH A;  4PG0 A;  3E1N A;  1MFR A;  3Q4Q A;  3GHQ A;  1LKM A;  2CHP A;  3KA9 A;  3SID A;  2BK6 A;  2IU2 A;  1YUZ A;  4XKS A;  3UOF A;  3FSE A;  2ZG9 X;  2D5K A;  3WVV A;  3O7R A;  3BVI A;  3IS8 A;  5D8P A;  1RCG A;  4TW3 A;  3KA6 A;  3E1L A;  3AF9 X;  4II4 A;  4CYA A;  5FFE A;  4ZKH A;  1ZS3 A;  1IES A;  4LQH A;  4U3G A;  3QZ3 A;  3RBC A;  3RGD A;  4ITW A;  3PW8 A;  4TO9 A;  3EZU A;  3O7S A;  3BVF A;  3R2K A;  1R03 A;  4CVP A;  4IWK A;  3F33 A;  1XZ3 A;  3QHC A;  1SQ3 A;  1VJX A;  2WLU A;  2YJJ A;  3KX9 A;  4AM5 A;  3F35 A;  1Z6O M;  3AK8 A;  3WVW A;  4RC6 B;  1YV1 A;  5GN8 A;  4ETR A;  1QYB A;  3PVR A;  3PZA A;  3R2O A;  2V2O A;  1S30 A;  3T9J A;  4RC7 A;  1JRE A;  3AJP A;  3A9Q A;  4DAS A;  5C6F A;  3FI6 A;  1VEI A;  2YW6 A;  3KA3 A;  3KXU A;  2CHI A;  4LQN A;  4CVS A;  4LPJ A;  3R2M A;  3A68 A;  1JKU A;  4Z3B A;  1XZ1 A;  3E1Q A;  5FFA A;  2IY4 A;  4CYB A;  1UVH A;  4LYX A;  1ZUJ A;  3QB9 A;  4XKT A;  4R42 A;  5FFD A;  2CN7 A;  3QD8 A;  4PGK A;  2FZF A;  2XGW A;  5GU3 X;  2CN6 A;  1GWG A;  2GS4 A;  5JKM G;  3AJQ A;  1RCE A;  1RCC A;  2Z6M A;  3RAV A;  5AXS A;  2VXI A;  2FG8 A;  2V15 A;  3ISE A;  4ERU A;  2BKC A;  3E1J A;  5CMQ A;  3Q4R A;  4ML5 A;  3F32 A;  5HQO A;  1HRS A;  3RE7 A;  1OTK A;  2C2F A;  5CMR A;  4MJY A;  4Y08 A;  3R2S A;  1DAT A;  3E2C A;  3F34 A;  3PWQ A;  4DYY A;  1JKV A;  1JYB A;  2ZUR X;  3SHX A;  4MKU A;  3UNO A;  4DYZ A;  2V2R A;  1LB3 A;  4ISM A;  3F37 A;  4II4 B;  3R2L A;  3HL1 A;  2GYD A;  1EUM A;  3GVY A;  3GE4 A;  1F30 A;  1DVB A;  1VLG A;  2W0O A;  2V2J A;  1IER A;  2OC5 A;  2OH3 A;  2XJO A;  4DI0 A;  4ZL6 A;  1AEW A;  4P18 A;  3WNW A;  3PW1 B;  2UX1 A;  2Y3Q A;  2ZA6 A;  1VEQ A;  1Z6O A;  2VXX A;  1L8I A;  3ERZ A;  4LQJ A;  4DE6 A;  5HJF A;  5JAC A;  1YUX A;  2PYB A;  2YJK A;  2ITB A;  4CMY A;  2JD7 0;  4TOA A;  4A25 A;  3OGH A;  5K53 A;  2FHA A;  4XGS A;  3EZ0 A;  3IQ1 A;  5LG2 A;  2WTL A;  1TKO A;  4ZLW A;  4Z5S A;  5LBH A;  4LYU A;  5E2D A;  4DZ0 A;  4LQV A;  4KVR A;  3PVR B;  2FG4 A;  5D8Y A;  4CVR A;  1B71 A;  5ERJ A;  3H7G A;  4RC8 A;  5FFC A;  3PVT B;  1JGC A;  2FJC A;  5LS9 A;  2IB0 A;  2V2M A;  5CZU A;  2QF9 A;  3QVD A;  5GOU A;  4M34 A;  4RC5 A;  4DYU A;  4LPN A;  5JKL A;  3ES3 A;  3AJO A;  1JI5 A;  2CIH A;  3NOZ X;  2FKZ A;  1BG7 A;  5J8S A;  4TOF A;  4M33 A;  3WVU A;  2JD6 0;  4ZJK A;  3KA4 A;  1H96 A;  1KRQ A;  4LPM A;  1JIG A;  1NF6 A;  1RCI A;  1NNQ A;  5D8X A;  5IX6 A;  1O9R A;  3PVY B;  4CY9 A;  4ZKX A;  2Z5R A;  2WLA A;  3KWO A;  1QGH A;  4M32 A;  1LKO A;  2VZB A;  2Z5Q A;  2FL0 A;  3VNX A;  2F7N A;  4OYN A;  1JI4 A;  3PW8 C;  1S2Z A;  2XJM A;  3KA8 A;  3Q4N A;  4PG1 A;  1L8H A;  5GU1 X;  2CF7 A;  3QHB A;  3RD0 A;  4ITT A;  4KVS A;  2GYQ A;  2Z5P A;  3BT5 A;  4EVC A;  4PGI A;  2BW1 A;  5J8W A;  4IWJ A;  4YKH A;  1SOF A;  2ZA7 A;  4TOD A;  1JTS A;  1TKP A;  3R2R A;  2QQY A;  1NF4 A;  2ZG7 X;  4ZKW A;  3R2H A;  5D8Q A;  2BJY A;  4CMY V;  3F39 A;  4KVQ A;  3NP0 X;  3TA8 A;  4MY7 A;  5ERK A;  5D8S A;  2CLB A;  3E1M A;  4ISP A;  2V2I A;  1F33 A;  4MUD A;  3BKN A;  2V2N A;  3F36 A;  2Z90 A;  3F38 A;  3SE1 A;  2YW7 A;  3IS7 A;  5GU0 X;  1J30 A;  5E1U A;  4AM2 A;  4TOC A;  3NP2 X;  4QUW A;  5GN8 B;  4EVE A;  1TJO A;  2ZG8 X;  3EGM A;  3E1P A;  1VEL A;  1DPS A;  1N1Q A;  3FVB A;  2X17 0;  3E6S A;  3PWF A;  3Q4O A;  4RC7 B;  2C2U A;  5FEJ A;  4AM4 A;  4RC5 B;  4ZL5 A;  4XKU A;  1MOJ A;  3PW1 A;  5J93 A;  3PWQ C;  4TOG A;  3E1O A;  3OJ5 A;  3ISF A;  5JKM A;  5I4J A;  2JD8 0;  2V2S A;  2C2J A;  1RYT A;  1BCF A;  5GU2 X;  4MN9 A;  1FHA A;  4TOB A;  4DYX A;  2ZA8 A;  3MPS A;  1S3Q A;  1Z4A A;  4TOH A;  4E6K A;  5LG8 A;  3E6R A;  2HR5 A;  4EVB A;  2RBD A;  1LKP A;  3BVK A;  4EVD A;  1RCD A;  3PVT A;  4RC6 A;  2C41 A;  2C6R A;  2G4H A;  3AF7 X;  2HTN A;  1BFR A;  1UMN A;  2CLU A;  3U90 A;  1TK6 A;  2XJN A;  3HIU A;  4ZTT A;  4IXK A;  5J9V A;  2V2P A;  5D8R A;  3SH6 A;  5D8O A;  4CVT A;  5FFB A;  3BVE A;  3AF8 X;  4REU A;  3BVL A;  4ZMC A;  1NFV A;  2FFX J;  2CEI A;  4TOE A;  2V2L A;  3PVY A;  2XKQ A;  5K52 A;  5JKL G;  3UOI A;  3AK9 A; 
#chains in the Genus database with same CATH topology
 4M35 A;  1O9I A;  5HJH A;  3C23 A;  3E1N A;  4PG0 A;  1MFR A;  3Q4Q A;  3GHQ A;  1LKM A;  2CHP A;  3UFB A;  3KA9 A;  3SID A;  4E40 A;  2BK6 A;  2IU2 A;  1YUZ A;  3LKD A;  4XKS A;  3UOF A;  3FSE A;  2ZG9 X;  3N6O A;  2D5K A;  3WVV A;  3O7R A;  3BVI A;  3IS8 A;  3FRS A;  5D8P A;  1RCG A;  4TW3 A;  3KA6 A;  3E1L A;  3AF9 X;  4II4 A;  4CYA A;  5FFE A;  4ZKH A;  1ZS3 A;  1IES A;  3C1Z A;  4LQH A;  4U3G A;  3QZ3 A;  3RBC A;  3RGD A;  4ITW A;  3PW8 A;  3W54 A;  4TO9 A;  3EZU A;  3O7S A;  3BVF A;  3R2K A;  1R03 A;  4CVP A;  4IWK A;  3F33 A;  1XZ3 A;  3JZA B;  3QHC A;  1SQ3 A;  1VJX A;  2WLU A;  2YJJ A;  3KX9 A;  4AM5 A;  3F35 A;  3M6J A;  1Z6O M;  3AK8 A;  3FRR A;  3WVW A;  4RC6 B;  1YV1 A;  5GN8 A;  4ETR A;  1QYB A;  3PVR A;  3PZA A;  3R2O A;  3VV9 A;  2V2O A;  1S30 A;  3T9J A;  4RC7 A;  1JRE A;  3AJP A;  3A9Q A;  4DAS A;  5C6F A;  3FI6 A;  1VEI A;  4YXM A;  2YW6 A;  3KA3 A;  3KXU A;  2CHI A;  4LQN A;  4CVS A;  4LPJ A;  3R2M A;  3A68 A;  1JKU A;  4Z3B A;  1XZ1 A;  3E1Q A;  5FFA A;  2IY4 A;  4CYB A;  1UVH A;  4LYX A;  1ZUJ A;  3QB9 A;  4XKT A;  4R42 A;  5FFD A;  2CN7 A;  3QD8 A;  4PGK A;  2FZF A;  2CWL A;  2XGW A;  5GU3 X;  2CN6 A;  1GWG A;  5HU6 D;  5JDO B;  2GS4 A;  5JKM G;  3AJQ A;  1RCE A;  1RCC A;  2WWX B;  2Z6M A;  3RAV A;  5AXS A;  2VXI A;  2FG8 A;  2V15 A;  3ISE A;  4ERU A;  2BKC A;  3E1J A;  3GGY A;  5CMQ A;  3Q4R A;  3KDQ A;  4ML5 A;  3F32 A;  5HQO A;  1HRS A;  3RE7 A;  1OTK A;  2C2F A;  5CMR A;  4MJY A;  4Y08 A;  3R2S A;  2MGY A;  1DAT A;  3E2C A;  3F34 A;  3PWQ A;  4DYY A;  4W4L B;  1JKV A;  1JYB A;  2ZUR X;  3SHX A;  4MKU A;  3UNO A;  4DYZ A;  2V2R A;  1LB3 A;  4ISM A;  3F37 A;  4II4 B;  3R2L A;  3HL1 A;  2GYD A;  1EUM A;  3GVY A;  3GE4 A;  1F30 A;  1DVB A;  1VLG A;  2W0O A;  2V2J A;  1IER A;  2OC5 A;  2OH3 A;  2XJO A;  4DI0 A;  4ZL6 A;  1AEW A;  4P18 A;  3WNW A;  3PW1 B;  2UX1 A;  2Y3Q A;  3GGZ A;  2ZA6 A;  1VEQ A;  1Z6O A;  2G38 B;  2VXX A;  1L8I A;  3ERZ A;  4LQJ A;  4DE6 A;  5HJF A;  5JAC A;  1YUX A;  2PYB A;  2YJK A;  2ITB A;  4CMY A;  2JD7 0;  4TOA A;  4A25 A;  3OGH A;  5K53 A;  2FHA A;  4XGS A;  3EZ0 A;  3IQ1 A;  5LG2 A;  2WTL A;  1TKO A;  3L0M A;  4Z5S A;  5LBH A;  4ZLW A;  4LYU A;  5E2D A;  4MXP A;  4DZ0 A;  4LQV A;  4KVR A;  3PVR B;  2FG4 A;  5D8Y A;  4CVR A;  1B71 A;  5ERJ A;  3H7G A;  4RC8 A;  5FFC A;  3PVT B;  1JGC A;  2FJC A;  5LS9 A;  2IB0 A;  2V2M A;  5CZU A;  2QF9 A;  3QVD A;  5GOU A;  4M34 A;  4RC5 A;  4DYU A;  4LPN A;  5JKL A;  3ES3 A;  3AJO A;  1JI5 A;  2CIH A;  3NOZ X;  2FKZ A;  1BG7 A;  5J8S A;  4TOF A;  4M33 A;  3WVU A;  2JD6 0;  4ZJK A;  3KA4 A;  1H96 A;  1KRQ A;  4LPM A;  1JIG A;  1NF6 A;  1RCI A;  1NNQ A;  5D8X A;  5IX6 A;  1O9R A;  3JZ9 A;  3PVY B;  4CY9 A;  4ZKX A;  2Z5R A;  2WLA A;  3KWO A;  3VVA A;  1QGH A;  4M32 A;  1LKO A;  2VZB A;  2Z5Q A;  2FL0 A;  4W4K B;  3VNX A;  2F7N A;  4OYN A;  1JI4 A;  3PW8 C;  1S2Z A;  2XJM A;  3KA8 A;  3Q4N A;  3D19 A;  4PG1 A;  1L8H A;  5GU1 X;  2CF7 A;  3QHB A;  3RD0 A;  4ITT A;  4KVS A;  2GYQ A;  2Z5P A;  3BT5 A;  4EVC A;  4PGI A;  2BW1 A;  5J8W A;  4IWJ A;  4YKH A;  1SOF A;  2ZA7 A;  4TOD A;  3V3K B;  4WJG 4;  1JTS A;  1TKP A;  3R2R A;  5JDO A;  2QQY A;  1NF4 A;  2ZG7 X;  4ZKW A;  3R2H A;  5D8Q A;  2BJY A;  4CMY V;  3DBY A;  3F39 A;  4KVQ A;  2Y44 A;  3NP0 X;  3TA8 A;  4MY7 A;  5ERK A;  5D8S A;  2CLB A;  3E1M A;  4ISP A;  2V2I A;  1F33 A;  4MUD A;  3BKN A;  2V2N A;  3F36 A;  2Z90 A;  3F38 A;  3SE1 A;  2YW7 A;  3IS7 A;  5GU0 X;  1J30 A;  5E1U A;  4KXR B;  4AM2 A;  4TOC A;  3NP2 X;  4QUW A;  5GN8 B;  4EVE A;  1TJO A;  2ZG8 X;  3EGM A;  3E1P A;  1VEL A;  1DPS A;  1N1Q A;  2V8T A;  3FVB A;  2X17 0;  3E6S A;  3PWF A;  3Q4O A;  4RC7 B;  2C2U A;  5FEJ A;  4AM4 A;  4RC5 B;  4ZL5 A;  3KHK A;  4XKU A;  1MOJ A;  3PW1 A;  5J93 A;  3PWQ C;  4TOG A;  3E1O A;  4YVZ A;  3OJ5 A;  3ISF A;  5JKM A;  5I4J A;  2OKC A;  2JD8 0;  2V2S A;  2C2J A;  1RYT A;  1BCF A;  5GU2 X;  3C1Y A;  4MN9 A;  1FHA A;  4TOB A;  4DYX A;  2ZA8 A;  3MPS A;  3C21 A;  1S3Q A;  1Z4A A;  4TOH A;  4E6K A;  5LG8 A;  3E6R A;  2HR5 A;  4EVB A;  4YXJ A;  2RBD A;  2AR0 A;  1LKP A;  3BVK A;  4EVD A;  1RCD A;  3PVT A;  4RC6 A;  2C41 A;  2C6R A;  2G4H A;  3AF7 X;  2HTN A;  1BFR A;  1UMN A;  2CLU A;  2N02 A;  3U90 A;  1TK6 A;  2XJN A;  3HIU A;  4X0J A;  4IXK A;  4ZTT A;  5J9V A;  2V2P A;  5D8R A;  3SH6 A;  2V8U A;  5D8O A;  4CVT A;  5FFB A;  3BVE A;  3AF8 X;  4REU A;  3BVL A;  4ZMC A;  1NFV A;  2FFX J;  2CEI A;  4TOE A;  2V2L A;  3PVY A;  2XKQ A;  5K52 A;  5JKL G;  3UOI A;  3AK9 A; 
#chains in the Genus database with same CATH homology
 4M35 A;  1O9I A;  5HJH A;  3C23 A;  3E1N A;  4PG0 A;  1MFR A;  3Q4Q A;  3GHQ A;  1LKM A;  2CHP A;  3UFB A;  3KA9 A;  3SID A;  4E40 A;  2BK6 A;  2IU2 A;  1YUZ A;  3LKD A;  4XKS A;  3UOF A;  3FSE A;  2ZG9 X;  3N6O A;  2D5K A;  3WVV A;  3O7R A;  3BVI A;  3IS8 A;  3FRS A;  5D8P A;  1RCG A;  4TW3 A;  3KA6 A;  3E1L A;  3AF9 X;  4II4 A;  4CYA A;  5FFE A;  4ZKH A;  1ZS3 A;  1IES A;  3C1Z A;  4LQH A;  4U3G A;  3QZ3 A;  3RBC A;  3RGD A;  4ITW A;  3PW8 A;  3W54 A;  4TO9 A;  3EZU A;  3O7S A;  3BVF A;  3R2K A;  1R03 A;  4CVP A;  4IWK A;  3F33 A;  1XZ3 A;  3JZA B;  3QHC A;  1SQ3 A;  1VJX A;  2WLU A;  2YJJ A;  3KX9 A;  4AM5 A;  3F35 A;  3M6J A;  1Z6O M;  3AK8 A;  3FRR A;  3WVW A;  4RC6 B;  1YV1 A;  5GN8 A;  4ETR A;  1QYB A;  3PVR A;  3PZA A;  3R2O A;  3VV9 A;  2V2O A;  1S30 A;  3T9J A;  4RC7 A;  1JRE A;  3AJP A;  3A9Q A;  4DAS A;  5C6F A;  3FI6 A;  1VEI A;  4YXM A;  2YW6 A;  3KA3 A;  3KXU A;  2CHI A;  4LQN A;  4CVS A;  4LPJ A;  3R2M A;  3A68 A;  1JKU A;  4Z3B A;  1XZ1 A;  3E1Q A;  5FFA A;  2IY4 A;  4CYB A;  1UVH A;  4LYX A;  1ZUJ A;  3QB9 A;  4XKT A;  4R42 A;  5FFD A;  2CN7 A;  3QD8 A;  4PGK A;  2FZF A;  2CWL A;  2XGW A;  5GU3 X;  2CN6 A;  1GWG A;  5HU6 D;  5JDO B;  2GS4 A;  5JKM G;  3AJQ A;  1RCE A;  1RCC A;  2WWX B;  2Z6M A;  3RAV A;  5AXS A;  2VXI A;  2FG8 A;  2V15 A;  3ISE A;  4ERU A;  2BKC A;  3E1J A;  3GGY A;  5CMQ A;  3Q4R A;  3KDQ A;  4ML5 A;  3F32 A;  5HQO A;  1HRS A;  3RE7 A;  1OTK A;  2C2F A;  5CMR A;  4MJY A;  4Y08 A;  3R2S A;  2MGY A;  1DAT A;  3E2C A;  3F34 A;  3PWQ A;  4DYY A;  4W4L B;  1JKV A;  1JYB A;  2ZUR X;  3SHX A;  4MKU A;  3UNO A;  4DYZ A;  2V2R A;  1LB3 A;  4ISM A;  3F37 A;  4II4 B;  3R2L A;  3HL1 A;  2GYD A;  1EUM A;  3GVY A;  3GE4 A;  1F30 A;  1DVB A;  1VLG A;  2W0O A;  2V2J A;  1IER A;  2OC5 A;  2OH3 A;  2XJO A;  4DI0 A;  4ZL6 A;  1AEW A;  4P18 A;  3WNW A;  3PW1 B;  2UX1 A;  2Y3Q A;  3GGZ A;  2ZA6 A;  1VEQ A;  1Z6O A;  2G38 B;  2VXX A;  1L8I A;  3ERZ A;  4LQJ A;  4DE6 A;  5HJF A;  5JAC A;  1YUX A;  2PYB A;  2YJK A;  2ITB A;  4CMY A;  2JD7 0;  4TOA A;  4A25 A;  3OGH A;  5K53 A;  2FHA A;  4XGS A;  3EZ0 A;  3IQ1 A;  5LG2 A;  2WTL A;  1TKO A;  3L0M A;  4Z5S A;  5LBH A;  4ZLW A;  4LYU A;  5E2D A;  4MXP A;  4DZ0 A;  4LQV A;  4KVR A;  3PVR B;  2FG4 A;  5D8Y A;  4CVR A;  1B71 A;  5ERJ A;  3H7G A;  4RC8 A;  5FFC A;  3PVT B;  1JGC A;  2FJC A;  5LS9 A;  2IB0 A;  2V2M A;  5CZU A;  2QF9 A;  3QVD A;  5GOU A;  4M34 A;  4RC5 A;  4DYU A;  4LPN A;  5JKL A;  3ES3 A;  3AJO A;  1JI5 A;  2CIH A;  3NOZ X;  2FKZ A;  1BG7 A;  5J8S A;  4TOF A;  4M33 A;  3WVU A;  2JD6 0;  4ZJK A;  3KA4 A;  1H96 A;  1KRQ A;  4LPM A;  1JIG A;  1NF6 A;  1RCI A;  1NNQ A;  5D8X A;  5IX6 A;  1O9R A;  3JZ9 A;  3PVY B;  4CY9 A;  4ZKX A;  2Z5R A;  2WLA A;  3KWO A;  3VVA A;  1QGH A;  4M32 A;  1LKO A;  2VZB A;  2Z5Q A;  2FL0 A;  4W4K B;  3VNX A;  2F7N A;  4OYN A;  1JI4 A;  3PW8 C;  1S2Z A;  2XJM A;  3KA8 A;  3Q4N A;  3D19 A;  4PG1 A;  1L8H A;  5GU1 X;  2CF7 A;  3QHB A;  3RD0 A;  4ITT A;  4KVS A;  2GYQ A;  2Z5P A;  3BT5 A;  4EVC A;  4PGI A;  2BW1 A;  5J8W A;  4IWJ A;  4YKH A;  1SOF A;  2ZA7 A;  4TOD A;  3V3K B;  4WJG 4;  1JTS A;  1TKP A;  3R2R A;  5JDO A;  2QQY A;  1NF4 A;  2ZG7 X;  4ZKW A;  3R2H A;  5D8Q A;  2BJY A;  4CMY V;  3DBY A;  3F39 A;  4KVQ A;  2Y44 A;  3NP0 X;  3TA8 A;  4MY7 A;  5ERK A;  5D8S A;  2CLB A;  3E1M A;  4ISP A;  2V2I A;  1F33 A;  4MUD A;  3BKN A;  2V2N A;  3F36 A;  2Z90 A;  3F38 A;  3SE1 A;  2YW7 A;  3IS7 A;  5GU0 X;  1J30 A;  5E1U A;  4KXR B;  4AM2 A;  4TOC A;  3NP2 X;  4QUW A;  5GN8 B;  4EVE A;  1TJO A;  2ZG8 X;  3EGM A;  3E1P A;  1VEL A;  1DPS A;  1N1Q A;  2V8T A;  3FVB A;  2X17 0;  3E6S A;  3PWF A;  3Q4O A;  4RC7 B;  2C2U A;  5FEJ A;  4AM4 A;  4RC5 B;  4ZL5 A;  3KHK A;  4XKU A;  1MOJ A;  3PW1 A;  5J93 A;  3PWQ C;  4TOG A;  3E1O A;  4YVZ A;  3OJ5 A;  3ISF A;  5JKM A;  5I4J A;  2OKC A;  2JD8 0;  2V2S A;  2C2J A;  1RYT A;  1BCF A;  5GU2 X;  3C1Y A;  4MN9 A;  1FHA A;  4TOB A;  4DYX A;  2ZA8 A;  3MPS A;  3C21 A;  1S3Q A;  1Z4A A;  4TOH A;  4E6K A;  5LG8 A;  3E6R A;  2HR5 A;  4EVB A;  4YXJ A;  2RBD A;  2AR0 A;  1LKP A;  3BVK A;  4EVD A;  1RCD A;  3PVT A;  4RC6 A;  2C41 A;  2C6R A;  2G4H A;  3AF7 X;  2HTN A;  1BFR A;  1UMN A;  2CLU A;  2N02 A;  3U90 A;  1TK6 A;  2XJN A;  3HIU A;  4X0J A;  4IXK A;  4ZTT A;  5J9V A;  2V2P A;  5D8R A;  3SH6 A;  2V8U A;  5D8O A;  4CVT A;  5FFB A;  3BVE A;  3AF8 X;  4REU A;  3BVL A;  4ZMC A;  1NFV A;  2FFX J;  2CEI A;  4TOE A;  2V2L A;  3PVY A;  2XKQ A;  5K52 A;  5JKL G;  3UOI A;  3AK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...