5I4JA

Dps4 from nostoc punctiforme in complex with zn ions
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
177
structure length
177
Chain Sequence
TLLRNFGNVYDNPVLLDRSVTAPVTEGFNVVLASFQALYLQYQKHHFVVEGSEFYSLHEFFNESYNQVQDHIHEIGERLDGLGGVPVATFSKLAELTCFEQESEGVYSSRQMVENDLAAEQAIIGVIRRQAAQAESLGDRGTRYLYEKILLKTEERAYHLSHFLAKDSLTLGFVQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ferritin, Dps family protein
publication title On the trail of iron into Dps4 from N. punctiforme
rcsb
source organism Nostoc punctiforme
total genus 71
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5i4jA00
4ML5A 1N1QA 4RC5B 5D8PA 4CMYV 1AEWA 3KXUA 2YW6A 3E1QA 3O7SA 2BK6A 5D8QA 3PWQA 1ZUJA 2XGWA 1VELA 3A68A 1TJOA 4LYXA 2XJOA 3QB9A 4REUA 2YJJA 2WTLA 1Z4AA 2BW1A 1GWGA 2HR5A 3F35A 3IS7A 4DYXA 2FG4A 5LBHA 3WVVA 4XKSA 3PVYB 5JACA 3KA4A 3NP0X 1JKUA 1SOFA 4M34A 5FFBA 1HRSA 3PW8C 1MFRA 3RAVA 2UX1A 4IWJA 3HIUA 5IX6A 2GYQA 3IQ1A 5GOUA 1NF4A 1RYTA 3A9QA 3H7GA 4LQJA 2OH3A 2D5KA 5HQOA 4OYNA 2VXIA 5J9VA 4TOCA 5ERKA 2IU2A 2V2RA 4A25A 3ISEA 1ZS3A 3R2SA 4TOBA 4DYYA 3FSEA 3AJOA 4TOFA 4ZKXA 2V2NA 2V2OA 3BVEA 2IY4A 1L8HA 5D8RA 1RCDA 4CVRA 3R2OA 3E6SA 4RC6A 4ZL5A 4LYUA 1VEIA 4M32A 4RC7B 2FG8A 4DYUA 1FHAA 5D8YA 3BVKA 1JI4A 3MPSA 1NFVA 1LKPA 4KVRA 1JIGA 1VLGA 4U3GA 3F36A 2VZBA 3AJPA 4II4B 3RGDA 3E6RA 1SQ3A 3WVWA 5LS9A 2C2UA 1IESA 4LQHA 3QHCA 4EVBA 2Z5RA 2YW7A 3GVYA 4DE6A 2XJNA 2JD60 4TO9A 5GU2X 3PVRB 2Z90A 4EVEA 3AK8A 4ZKHA 4ITWA 2CLUA 4ZKWA 5FFCA 5CMQA 4TOEA 3BKNA 4MN9A 1LB3A 2Z5PA 1S2ZA 1UVHA 1DATA 4ISPA 3RD0A 4PG1A 5JKLA 1O9RA 1RCCA 3E2CA 1RCIA 4Y08A 4AM4A 3SH6A 1S3QA 3GE4A 1XZ1A 2ZG8X 1JI5A 4PGIA 5J8WA 3Q4NA 3PVTA 3AF9X 3WNWA 2Z5QA 3KA3A 1YV1A 4E6KA 1EUMA 5J8SA 3BT5A 5FEJA 2VXXA 2ZA6A 3PW1B 3RE7A 3FI6A 2BKCA 3AJQA 5J93A 1RCGA 3E1MA 1VJXA 2FKZA 2WLUA 4PG0A 2ZA7A 1Z6OM 1LKOA 5K52A 1JGCA 2FZFA 2OC5A 5JKMA 3GHQA 1OTKA 4IXKA 4CVTA 3F33A 4CVPA 4LPJA 4LQNA 3SIDA 4ZMCA 2V2SA 4RC5A 1H96A 2ITBA 3E1JA 5D8XA 1UMNA 3BVIA 3F34A 1Z6OA 3OJ5A 4CYAA 5FFAA 4KVSA 3NOZX 1F30A 2Z6MA 4DI0A 3E1OA 4CYBA 1BFRA 2ZG9X 1F33A 5FFEA 3UNOA 4ZJKA 1LKMA 3R2KA 3O7RA 1BG7A 1TKPA 4DZ0A 4QUWA 2FL0A 4LPNA 1BCFA 2V2LA 3EGMA 3KA9A 4CVSA 2CEIA 3KX9A 4ERUA 3Q4QA 5CZUA 5HJFA 2YJKA 2GS4A 2CLBA 4ZL6A 3T9JA 3Q4RA 2V2IA 2QQYA 1QGHA 2XJMA 4RC8A 1YUZA 4MY7A 5I4JA 3UOFA 2ZA8A 5E2DA 2FHAA 3VNXA 2GYDA 1RCEA 3KA8A 1NF6A 4IWKA 2PYBA 1KRQA 2ZG7X 3BVFA 5GU3X 5E1UA 5JKLG 3QHBA 1J30A 2Y3QA 3SHXA 3PZAA 4AM2A 1QYBA 1NNQA 2CF7A 4PGKA 1IERA 4DYZA 4EVCA 3QD8A 3EZ0A 4ETRA 3Q4OA 4TOAA 4RC7A 3PW8A 4AM5A 1VEQA 3EZUA 4KVQA 3NP2X 4XKTA 2CHPA 5D8OA 4P18A 5AXSA 5C6FA 3F38A 3E1PA 5GN8A 3R2RA 4II4A 5LG2A 5CMRA 2QF9A 4LPMA 5GU1X 3HL1A 1JTSA 4Z3BA 4RC6B 1DVBA 3PVRA 2V2PA 3PWQC 3KWOA 4YKHA 1S30A 3UOIA 3ERZA 5JKMG 2G4HA 1O9IA 1YUXA 2CN6A 4EVDA 2CHIA 3WVUA 5D8SA 1XZ3A 2X170 4M33A 2V2MA 2C2JA 4MKUA 2IB0A 1JKVA 3PWFA 2XKQA 3AF7X 2JD80 3IS8A 2ZURX 4CMYA 4R42A 3QVDA 2V15A 3ISFA 4DASA 2F7NA 4Z5SA 3PVYA 3PW1A 5LG8A 2C6RA 4TOGA 5FFDA 3TA8A 4ZLWA 4TOHA 3PVTB 3BVLA 5HJHA 3E1LA 3R2LA 2JD70 4MUDA 2FFXJ 4ITTA 4TW3A 4TODA 4ISMA 4XGSA 1B71A 3E1NA 5GN8B 5GU0X 1JYBA 3AF8X 3QZ3A 3KA6A 4M35A 3U90A 1MOJA 2W0OA 3FVBA 3OGHA 5ERJA 2FJCA 3F39A 1DPSA 2BJYA 3AK9A 1TKOA 2CN7A 4LQVA 2C2FA 1L8IA 3F32A 4ZTTA 2RBDA 1TK6A 2V2JA 2WLAA 3SE1A 3ES3A 2CIHA 3F37A 5K53A 1JREA 4MJYA 4XKUA 3R2HA 1R03A 2C41A 3R2MA 4CY9A 2HTNA 3RBCA
chains in the Genus database with same CATH superfamily
4ML5A 1N1QA 4RC5B 5D8PA 4CMYV 1AEWA 3KXUA 2YW6A 3E1QA 3O7SA 4WJG4 2BK6A 5D8QA 3PWQA 1ZUJA 2XGWA 1VELA 3A68A 1TJOA 4LYXA 2XJOA 3QB9A 4REUA 2YJJA 2WTLA 1Z4AA 2BW1A 1GWGA 2HR5A 3F35A 3JZAB 3IS7A 4DYXA 2FG4A 5LBHA 3WVVA 4XKSA 3PVYB 5JACA 3KA4A 3NP0X 3C1ZA 1JKUA 1SOFA 4M34A 5FFBA 1HRSA 3PW8C 1MFRA 3RAVA 2UX1A 3JZ9A 4IWJA 3HIUA 5IX6A 2GYQA 3IQ1A 5GOUA 1NF4A 1RYTA 3A9QA 3H7GA 4LQJA 2OH3A 2D5KA 5HQOA 4OYNA 2VXIA 3VVAA 5J9VA 4TOCA 5ERKA 2IU2A 3LKDA 2V2RA 4A25A 3ISEA 1ZS3A 3R2SA 4TOBA 4DYYA 3FSEA 3AJOA 4TOFA 4ZKXA 2V2NA 2V2OA 2WWXB 3BVEA 2IY4A 1L8HA 4W4LB 5D8RA 1RCDA 4CVRA 3L0MA 3R2OA 3E6SA 2AR0A 4RC6A 4ZL5A 4LYUA 1VEIA 4M32A 4RC7B 3FRSA 2FG8A 4DYUA 1FHAA 5D8YA 3BVKA 5JDOB 1JI4A 3MPSA 1NFVA 4E40A 1LKPA 4KVRA 1JIGA 1VLGA 4U3GA 3F36A 2VZBA 3AJPA 4II4B 3RGDA 3E6RA 1SQ3A 3WVWA 5LS9A 2C2UA 1IESA 4LQHA 3QHCA 4EVBA 2Z5RA 2YW7A 3GVYA 4DE6A 2XJNA 2JD60 4TO9A 5GU2X 3PVRB 2Z90A 3W54A 4EVEA 3AK8A 4ZKHA 4ITWA 2CLUA 4ZKWA 5FFCA 5CMQA 4TOEA 2N02A 3BKNA 4MN9A 1LB3A 2Z5PA 1S2ZA 1UVHA 1DATA 4ISPA 3RD0A 4PG1A 5JKLA 1O9RA 1RCCA 3E2CA 1RCIA 4Y08A 4AM4A 3SH6A 1S3QA 3GE4A 1XZ1A 2ZG8X 1JI5A 4PGIA 5J8WA 3Q4NA 3PVTA 3AF9X 3WNWA 2Z5QA 3KA3A 1YV1A 4E6KA 1EUMA 5J8SA 3VV9A 3BT5A 5FEJA 2VXXA 2ZA6A 3PW1B 3RE7A 3FI6A 2BKCA 3AJQA 5J93A 1RCGA 3E1MA 1VJXA 2FKZA 2WLUA 2G38B 4PG0A 3V3KB 2ZA7A 1Z6OM 1LKOA 5K52A 1JGCA 2FZFA 2OC5A 5JKMA 3GHQA 1OTKA 4IXKA 4CVTA 3F33A 4CVPA 4LPJA 4LQNA 3SIDA 4ZMCA 2V2SA 4RC5A 3FRRA 1H96A 2ITBA 3E1JA 2CWLA 5D8XA 1UMNA 3BVIA 4MXPA 3F34A 1Z6OA 3KDQA 3OJ5A 4CYAA 5FFAA 4KVSA 3NOZX 1F30A 2Z6MA 4DI0A 3E1OA 4CYBA 1BFRA 2ZG9X 1F33A 5FFEA 3UNOA 4ZJKA 1LKMA 3R2KA 3O7RA 1BG7A 1TKPA 4DZ0A 4QUWA 3UFBA 2FL0A 4LPNA 1BCFA 2V2LA 3EGMA 3KA9A 4CVSA 2Y44A 2CEIA 3KX9A 4ERUA 3Q4QA 5CZUA 5HJFA 2YJKA 2GS4A 2CLBA 3C21A 4ZL6A 3T9JA 3Q4RA 2V2IA 2QQYA 1QGHA 2XJMA 3C1YA 4RC8A 1YUZA 4MY7A 5I4JA 3UOFA 2ZA8A 5E2DA 2FHAA 3VNXA 2GYDA 1RCEA 3KA8A 1NF6A 5HU6D 4IWKA 2PYBA 1KRQA 2ZG7X 4YXJA 4YVZA 3BVFA 5GU3X 5E1UA 5JKLG 3QHBA 1J30A 2Y3QA 3SHXA 3PZAA 4AM2A 1QYBA 1NNQA 2CF7A 4PGKA 3GGZA 1IERA 2V8TA 4DYZA 4W4KB 3M6JA 4EVCA 3QD8A 3EZ0A 4ETRA 3Q4OA 4TOAA 4RC7A 3PW8A 4AM5A 1VEQA 2V8UA 3EZUA 4KVQA 3NP2X 4XKTA 2CHPA 5D8OA 5JDOA 4P18A 5AXSA 5C6FA 3F38A 3E1PA 5GN8A 3R2RA 4II4A 5LG2A 5CMRA 2QF9A 4LPMA 5GU1X 2OKCA 3HL1A 1JTSA 4Z3BA 4RC6B 1DVBA 3PVRA 2MGYA 2V2PA 3PWQC 3KWOA 4YKHA 1S30A 3UOIA 3ERZA 5JKMG 2G4HA 1O9IA 1YUXA 2CN6A 4EVDA 2CHIA 3WVUA 5D8SA 1XZ3A 4X0JA 2X170 4M33A 2V2MA 2C2JA 4MKUA 2IB0A 1JKVA 3PWFA 2XKQA 3AF7X 2JD80 3IS8A 2ZURX 4CMYA 4R42A 3QVDA 2V15A 3ISFA 4DASA 4YXMA 2F7NA 4Z5SA 3PVYA 3PW1A 5LG8A 2C6RA 4TOGA 5FFDA 3TA8A 4ZLWA 4TOHA 3N6OA 3PVTB 3BVLA 3D19A 5HJHA 3E1LA 3R2LA 2JD70 4MUDA 2FFXJ 4ITTA 4TW3A 4KXRB 4TODA 4ISMA 4XGSA 1B71A 3E1NA 5GN8B 5GU0X 1JYBA 3AF8X 3QZ3A 3KA6A 4M35A 3U90A 1MOJA 2W0OA 3FVBA 3OGHA 3GGYA 2FJCA 3F39A 1DPSA 2BJYA 5ERJA 3C23A 3AK9A 1TKOA 2CN7A 3DBYA 4LQVA 2C2FA 1L8IA 3F32A 4ZTTA 2RBDA 1TK6A 2V2JA 2WLAA 3SE1A 3ES3A 3KHKA 2CIHA 3F37A 5K53A 1JREA 4MJYA 4XKUA 3R2HA 1R03A 2C41A 3R2MA 4CY9A 2HTNA 3RBCA
chains in the Genus database with same CATH topology
4ML5A 1N1QA 4RC5B 5D8PA 4CMYV 1AEWA 3KXUA 2YW6A 3E1QA 3O7SA 4WJG4 2BK6A 5D8QA 3PWQA 1ZUJA 2XGWA 1VELA 3A68A 1TJOA 4LYXA 2XJOA 3QB9A 4REUA 2YJJA 2WTLA 1Z4AA 2BW1A 1GWGA 2HR5A 3F35A 3JZAB 3IS7A 4DYXA 2FG4A 5LBHA 3WVVA 4XKSA 3PVYB 5JACA 3KA4A 3NP0X 3C1ZA 1JKUA 1SOFA 4M34A 5FFBA 1HRSA 3PW8C 1MFRA 3RAVA 2UX1A 3JZ9A 4IWJA 3HIUA 5IX6A 2GYQA 3IQ1A 5GOUA 1NF4A 1RYTA 3A9QA 3H7GA 4LQJA 2OH3A 2D5KA 5HQOA 4OYNA 2VXIA 3VVAA 5J9VA 4TOCA 5ERKA 2IU2A 3LKDA 2V2RA 4A25A 3ISEA 1ZS3A 3R2SA 4TOBA 4DYYA 3FSEA 3AJOA 4TOFA 4ZKXA 2V2NA 2V2OA 2WWXB 3BVEA 2IY4A 1L8HA 4W4LB 5D8RA 1RCDA 4CVRA 3L0MA 3R2OA 3E6SA 2AR0A 4RC6A 4ZL5A 4LYUA 1VEIA 4M32A 4RC7B 3FRSA 2FG8A 4DYUA 1FHAA 5D8YA 3BVKA 5JDOB 1JI4A 3MPSA 1NFVA 4E40A 1LKPA 4KVRA 1JIGA 1VLGA 4U3GA 3F36A 2VZBA 3AJPA 4II4B 3RGDA 3E6RA 1SQ3A 3WVWA 5LS9A 2C2UA 1IESA 4LQHA 3QHCA 4EVBA 2Z5RA 2YW7A 3GVYA 4DE6A 2XJNA 2JD60 4TO9A 5GU2X 3PVRB 2Z90A 3W54A 4EVEA 3AK8A 4ZKHA 4ITWA 2CLUA 4ZKWA 5FFCA 5CMQA 4TOEA 2N02A 3BKNA 4MN9A 1LB3A 2Z5PA 1S2ZA 1UVHA 1DATA 4ISPA 3RD0A 4PG1A 5JKLA 1O9RA 1RCCA 3E2CA 1RCIA 4Y08A 4AM4A 3SH6A 1S3QA 3GE4A 1XZ1A 2ZG8X 1JI5A 4PGIA 5J8WA 3Q4NA 3PVTA 3AF9X 3WNWA 2Z5QA 3KA3A 1YV1A 4E6KA 1EUMA 5J8SA 3VV9A 3BT5A 5FEJA 2VXXA 2ZA6A 3PW1B 3RE7A 3FI6A 2BKCA 3AJQA 5J93A 1RCGA 3E1MA 1VJXA 2FKZA 2WLUA 2G38B 4PG0A 3V3KB 2ZA7A 1Z6OM 1LKOA 5K52A 1JGCA 2FZFA 2OC5A 5JKMA 3GHQA 1OTKA 4IXKA 4CVTA 3F33A 4CVPA 4LPJA 4LQNA 3SIDA 4ZMCA 2V2SA 4RC5A 3FRRA 1H96A 2ITBA 3E1JA 2CWLA 5D8XA 1UMNA 3BVIA 4MXPA 3F34A 1Z6OA 3KDQA 3OJ5A 4CYAA 5FFAA 4KVSA 3NOZX 1F30A 2Z6MA 4DI0A 3E1OA 4CYBA 1BFRA 2ZG9X 1F33A 5FFEA 3UNOA 4ZJKA 1LKMA 3R2KA 3O7RA 1BG7A 1TKPA 4DZ0A 4QUWA 3UFBA 2FL0A 4LPNA 1BCFA 2V2LA 3EGMA 3KA9A 4CVSA 2Y44A 2CEIA 3KX9A 4ERUA 3Q4QA 5CZUA 5HJFA 2YJKA 2GS4A 2CLBA 3C21A 4ZL6A 3T9JA 3Q4RA 2V2IA 2QQYA 1QGHA 2XJMA 3C1YA 4RC8A 1YUZA 4MY7A 5I4JA 3UOFA 2ZA8A 5E2DA 2FHAA 3VNXA 2GYDA 1RCEA 3KA8A 1NF6A 5HU6D 4IWKA 2PYBA 1KRQA 2ZG7X 4YXJA 4YVZA 3BVFA 5GU3X 5E1UA 5JKLG 3QHBA 1J30A 2Y3QA 3SHXA 3PZAA 4AM2A 1QYBA 1NNQA 2CF7A 4PGKA 3GGZA 1IERA 2V8TA 4DYZA 4W4KB 3M6JA 4EVCA 3QD8A 3EZ0A 4ETRA 3Q4OA 4TOAA 4RC7A 3PW8A 4AM5A 1VEQA 2V8UA 3EZUA 4KVQA 3NP2X 4XKTA 2CHPA 5D8OA 5JDOA 4P18A 5AXSA 5C6FA 3F38A 3E1PA 5GN8A 3R2RA 4II4A 5LG2A 5CMRA 2QF9A 4LPMA 5GU1X 2OKCA 3HL1A 1JTSA 4Z3BA 4RC6B 1DVBA 3PVRA 2MGYA 2V2PA 3PWQC 3KWOA 4YKHA 1S30A 3UOIA 3ERZA 5JKMG 2G4HA 1O9IA 1YUXA 2CN6A 4EVDA 2CHIA 3WVUA 5D8SA 1XZ3A 4X0JA 2X170 4M33A 2V2MA 2C2JA 4MKUA 2IB0A 1JKVA 3PWFA 2XKQA 3AF7X 2JD80 3IS8A 2ZURX 4CMYA 4R42A 3QVDA 2V15A 3ISFA 4DASA 4YXMA 2F7NA 4Z5SA 3PVYA 3PW1A 5LG8A 2C6RA 4TOGA 5FFDA 3TA8A 4ZLWA 4TOHA 3N6OA 3PVTB 3BVLA 3D19A 5HJHA 3E1LA 3R2LA 2JD70 4MUDA 2FFXJ 4ITTA 4TW3A 4KXRB 4TODA 4ISMA 4XGSA 1B71A 3E1NA 5GN8B 5GU0X 1JYBA 3AF8X 3QZ3A 3KA6A 4M35A 3U90A 1MOJA 2W0OA 3FVBA 3OGHA 3GGYA 2FJCA 3F39A 1DPSA 2BJYA 5ERJA 3C23A 3AK9A 1TKOA 2CN7A 3DBYA 4LQVA 2C2FA 1L8IA 3F32A 4ZTTA 2RBDA 1TK6A 2V2JA 2WLAA 3SE1A 3ES3A 3KHKA 2CIHA 3F37A 5K53A 1JREA 4MJYA 4XKUA 3R2HA 1R03A 2C41A 3R2MA 4CY9A 2HTNA 3RBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ML5 A;  1N1Q A;  4RC5 B;  5D8P A;  4CMY V;  1AEW A;  3KXU A;  2YW6 A;  3E1Q A;  3O7S A;  2BK6 A;  5D8Q A;  3PWQ A;  1ZUJ A;  2XGW A;  1VEL A;  3A68 A;  1TJO A;  4LYX A;  2XJO A;  3QB9 A;  4REU A;  2YJJ A;  2WTL A;  1Z4A A;  2BW1 A;  1GWG A;  2HR5 A;  3F35 A;  3IS7 A;  4DYX A;  2FG4 A;  5LBH A;  3WVV A;  4XKS A;  3PVY B;  5JAC A;  3KA4 A;  3NP0 X;  1JKU A;  1SOF A;  4M34 A;  5FFB A;  1HRS A;  3PW8 C;  1MFR A;  3RAV A;  2UX1 A;  4IWJ A;  3HIU A;  5IX6 A;  2GYQ A;  3IQ1 A;  5GOU A;  1NF4 A;  1RYT A;  3A9Q A;  3H7G A;  4LQJ A;  2OH3 A;  2D5K A;  5HQO A;  4OYN A;  2VXI A;  5J9V A;  4TOC A;  5ERK A;  2IU2 A;  2V2R A;  4A25 A;  3ISE A;  1ZS3 A;  3R2S A;  4TOB A;  4DYY A;  3FSE A;  3AJO A;  4TOF A;  4ZKX A;  2V2N A;  2V2O A;  3BVE A;  2IY4 A;  1L8H A;  5D8R A;  1RCD A;  4CVR A;  3R2O A;  3E6S A;  4RC6 A;  4ZL5 A;  4LYU A;  1VEI A;  4M32 A;  4RC7 B;  2FG8 A;  4DYU A;  1FHA A;  5D8Y A;  3BVK A;  1JI4 A;  3MPS A;  1NFV A;  1LKP A;  4KVR A;  1JIG A;  1VLG A;  4U3G A;  3F36 A;  2VZB A;  3AJP A;  4II4 B;  3RGD A;  3E6R A;  1SQ3 A;  3WVW A;  5LS9 A;  2C2U A;  1IES A;  4LQH A;  3QHC A;  4EVB A;  2Z5R A;  2YW7 A;  3GVY A;  4DE6 A;  2XJN A;  2JD6 0;  4TO9 A;  5GU2 X;  3PVR B;  2Z90 A;  4EVE A;  3AK8 A;  4ZKH A;  4ITW A;  2CLU A;  4ZKW A;  5FFC A;  5CMQ A;  4TOE A;  3BKN A;  4MN9 A;  1LB3 A;  2Z5P A;  1S2Z A;  1UVH A;  1DAT A;  4ISP A;  3RD0 A;  4PG1 A;  5JKL A;  1O9R A;  1RCC A;  3E2C A;  1RCI A;  4Y08 A;  4AM4 A;  3SH6 A;  1S3Q A;  3GE4 A;  1XZ1 A;  2ZG8 X;  1JI5 A;  4PGI A;  5J8W A;  3Q4N A;  3PVT A;  3AF9 X;  3WNW A;  2Z5Q A;  3KA3 A;  1YV1 A;  4E6K A;  1EUM A;  5J8S A;  3BT5 A;  5FEJ A;  2VXX A;  2ZA6 A;  3PW1 B;  3RE7 A;  3FI6 A;  2BKC A;  3AJQ A;  5J93 A;  1RCG A;  3E1M A;  1VJX A;  2FKZ A;  2WLU A;  4PG0 A;  2ZA7 A;  1Z6O M;  1LKO A;  5K52 A;  1JGC A;  2FZF A;  2OC5 A;  5JKM A;  3GHQ A;  1OTK A;  4IXK A;  4CVT A;  3F33 A;  4CVP A;  4LPJ A;  4LQN A;  3SID A;  4ZMC A;  2V2S A;  4RC5 A;  1H96 A;  2ITB A;  3E1J A;  5D8X A;  1UMN A;  3BVI A;  3F34 A;  1Z6O A;  3OJ5 A;  4CYA A;  5FFA A;  4KVS A;  3NOZ X;  1F30 A;  2Z6M A;  4DI0 A;  3E1O A;  4CYB A;  1BFR A;  2ZG9 X;  1F33 A;  5FFE A;  3UNO A;  4ZJK A;  1LKM A;  3R2K A;  3O7R A;  1BG7 A;  1TKP A;  4DZ0 A;  4QUW A;  2FL0 A;  4LPN A;  1BCF A;  2V2L A;  3EGM A;  3KA9 A;  4CVS A;  2CEI A;  3KX9 A;  4ERU A;  3Q4Q A;  5CZU A;  5HJF A;  2YJK A;  2GS4 A;  2CLB A;  4ZL6 A;  3T9J A;  3Q4R A;  2V2I A;  2QQY A;  1QGH A;  2XJM A;  4RC8 A;  1YUZ A;  4MY7 A;  5I4J A;  3UOF A;  2ZA8 A;  5E2D A;  2FHA A;  3VNX A;  2GYD A;  1RCE A;  3KA8 A;  1NF6 A;  4IWK A;  2PYB A;  1KRQ A;  2ZG7 X;  3BVF A;  5GU3 X;  5E1U A;  5JKL G;  3QHB A;  1J30 A;  2Y3Q A;  3SHX A;  3PZA A;  4AM2 A;  1QYB A;  1NNQ A;  2CF7 A;  4PGK A;  1IER A;  4DYZ A;  4EVC A;  3QD8 A;  3EZ0 A;  4ETR A;  3Q4O A;  4TOA A;  4RC7 A;  3PW8 A;  4AM5 A;  1VEQ A;  3EZU A;  4KVQ A;  3NP2 X;  4XKT A;  2CHP A;  5D8O A;  4P18 A;  5AXS A;  5C6F A;  3F38 A;  3E1P A;  5GN8 A;  3R2R A;  4II4 A;  5LG2 A;  5CMR A;  2QF9 A;  4LPM A;  5GU1 X;  3HL1 A;  1JTS A;  4Z3B A;  4RC6 B;  1DVB A;  3PVR A;  2V2P A;  3PWQ C;  3KWO A;  4YKH A;  1S30 A;  3UOI A;  3ERZ A;  5JKM G;  2G4H A;  1O9I A;  1YUX A;  2CN6 A;  4EVD A;  2CHI A;  3WVU A;  5D8S A;  1XZ3 A;  2X17 0;  4M33 A;  2V2M A;  2C2J A;  4MKU A;  2IB0 A;  1JKV A;  3PWF A;  2XKQ A;  3AF7 X;  2JD8 0;  3IS8 A;  2ZUR X;  4CMY A;  4R42 A;  3QVD A;  2V15 A;  3ISF A;  4DAS A;  2F7N A;  4Z5S A;  3PVY A;  3PW1 A;  5LG8 A;  2C6R A;  4TOG A;  5FFD A;  3TA8 A;  4ZLW A;  4TOH A;  3PVT B;  3BVL A;  5HJH A;  3E1L A;  3R2L A;  2JD7 0;  4MUD A;  2FFX J;  4ITT A;  4TW3 A;  4TOD A;  4ISM A;  4XGS A;  1B71 A;  3E1N A;  5GN8 B;  5GU0 X;  1JYB A;  3AF8 X;  3QZ3 A;  3KA6 A;  4M35 A;  3U90 A;  1MOJ A;  2W0O A;  3FVB A;  3OGH A;  5ERJ A;  2FJC A;  3F39 A;  1DPS A;  2BJY A;  3AK9 A;  1TKO A;  2CN7 A;  4LQV A;  2C2F A;  1L8I A;  3F32 A;  4ZTT A;  2RBD A;  1TK6 A;  2V2J A;  2WLA A;  3SE1 A;  3ES3 A;  2CIH A;  3F37 A;  5K53 A;  1JRE A;  4MJY A;  4XKU A;  3R2H A;  1R03 A;  2C41 A;  3R2M A;  4CY9 A;  2HTN A;  3RBC A; 
#chains in the Genus database with same CATH topology
 4ML5 A;  1N1Q A;  4RC5 B;  5D8P A;  4CMY V;  1AEW A;  3KXU A;  2YW6 A;  3E1Q A;  3O7S A;  4WJG 4;  2BK6 A;  5D8Q A;  3PWQ A;  1ZUJ A;  2XGW A;  1VEL A;  3A68 A;  1TJO A;  4LYX A;  2XJO A;  3QB9 A;  4REU A;  2YJJ A;  2WTL A;  1Z4A A;  2BW1 A;  1GWG A;  2HR5 A;  3F35 A;  3JZA B;  3IS7 A;  4DYX A;  2FG4 A;  5LBH A;  3WVV A;  4XKS A;  3PVY B;  5JAC A;  3KA4 A;  3NP0 X;  3C1Z A;  1JKU A;  1SOF A;  4M34 A;  5FFB A;  1HRS A;  3PW8 C;  1MFR A;  3RAV A;  2UX1 A;  3JZ9 A;  4IWJ A;  3HIU A;  5IX6 A;  2GYQ A;  3IQ1 A;  5GOU A;  1NF4 A;  1RYT A;  3A9Q A;  3H7G A;  4LQJ A;  2OH3 A;  2D5K A;  5HQO A;  4OYN A;  2VXI A;  3VVA A;  5J9V A;  4TOC A;  5ERK A;  2IU2 A;  3LKD A;  2V2R A;  4A25 A;  3ISE A;  1ZS3 A;  3R2S A;  4TOB A;  4DYY A;  3FSE A;  3AJO A;  4TOF A;  4ZKX A;  2V2N A;  2V2O A;  2WWX B;  3BVE A;  2IY4 A;  1L8H A;  4W4L B;  5D8R A;  1RCD A;  4CVR A;  3L0M A;  3R2O A;  3E6S A;  2AR0 A;  4RC6 A;  4ZL5 A;  4LYU A;  1VEI A;  4M32 A;  4RC7 B;  3FRS A;  2FG8 A;  4DYU A;  1FHA A;  5D8Y A;  3BVK A;  5JDO B;  1JI4 A;  3MPS A;  1NFV A;  4E40 A;  1LKP A;  4KVR A;  1JIG A;  1VLG A;  4U3G A;  3F36 A;  2VZB A;  3AJP A;  4II4 B;  3RGD A;  3E6R A;  1SQ3 A;  3WVW A;  5LS9 A;  2C2U A;  1IES A;  4LQH A;  3QHC A;  4EVB A;  2Z5R A;  2YW7 A;  3GVY A;  4DE6 A;  2XJN A;  2JD6 0;  4TO9 A;  5GU2 X;  3PVR B;  2Z90 A;  3W54 A;  4EVE A;  3AK8 A;  4ZKH A;  4ITW A;  2CLU A;  4ZKW A;  5FFC A;  5CMQ A;  4TOE A;  2N02 A;  3BKN A;  4MN9 A;  1LB3 A;  2Z5P A;  1S2Z A;  1UVH A;  1DAT A;  4ISP A;  3RD0 A;  4PG1 A;  5JKL A;  1O9R A;  1RCC A;  3E2C A;  1RCI A;  4Y08 A;  4AM4 A;  3SH6 A;  1S3Q A;  3GE4 A;  1XZ1 A;  2ZG8 X;  1JI5 A;  4PGI A;  5J8W A;  3Q4N A;  3PVT A;  3AF9 X;  3WNW A;  2Z5Q A;  3KA3 A;  1YV1 A;  4E6K A;  1EUM A;  5J8S A;  3VV9 A;  3BT5 A;  5FEJ A;  2VXX A;  2ZA6 A;  3PW1 B;  3RE7 A;  3FI6 A;  2BKC A;  3AJQ A;  5J93 A;  1RCG A;  3E1M A;  1VJX A;  2FKZ A;  2WLU A;  2G38 B;  4PG0 A;  3V3K B;  2ZA7 A;  1Z6O M;  1LKO A;  5K52 A;  1JGC A;  2FZF A;  2OC5 A;  5JKM A;  3GHQ A;  1OTK A;  4IXK A;  4CVT A;  3F33 A;  4CVP A;  4LPJ A;  4LQN A;  3SID A;  4ZMC A;  2V2S A;  4RC5 A;  3FRR A;  1H96 A;  2ITB A;  3E1J A;  2CWL A;  5D8X A;  1UMN A;  3BVI A;  4MXP A;  3F34 A;  1Z6O A;  3KDQ A;  3OJ5 A;  4CYA A;  5FFA A;  4KVS A;  3NOZ X;  1F30 A;  2Z6M A;  4DI0 A;  3E1O A;  4CYB A;  1BFR A;  2ZG9 X;  1F33 A;  5FFE A;  3UNO A;  4ZJK A;  1LKM A;  3R2K A;  3O7R A;  1BG7 A;  1TKP A;  4DZ0 A;  4QUW A;  3UFB A;  2FL0 A;  4LPN A;  1BCF A;  2V2L A;  3EGM A;  3KA9 A;  4CVS A;  2Y44 A;  2CEI A;  3KX9 A;  4ERU A;  3Q4Q A;  5CZU A;  5HJF A;  2YJK A;  2GS4 A;  2CLB A;  3C21 A;  4ZL6 A;  3T9J A;  3Q4R A;  2V2I A;  2QQY A;  1QGH A;  2XJM A;  3C1Y A;  4RC8 A;  1YUZ A;  4MY7 A;  5I4J A;  3UOF A;  2ZA8 A;  5E2D A;  2FHA A;  3VNX A;  2GYD A;  1RCE A;  3KA8 A;  1NF6 A;  5HU6 D;  4IWK A;  2PYB A;  1KRQ A;  2ZG7 X;  4YXJ A;  4YVZ A;  3BVF A;  5GU3 X;  5E1U A;  5JKL G;  3QHB A;  1J30 A;  2Y3Q A;  3SHX A;  3PZA A;  4AM2 A;  1QYB A;  1NNQ A;  2CF7 A;  4PGK A;  3GGZ A;  1IER A;  2V8T A;  4DYZ A;  4W4K B;  3M6J A;  4EVC A;  3QD8 A;  3EZ0 A;  4ETR A;  3Q4O A;  4TOA A;  4RC7 A;  3PW8 A;  4AM5 A;  1VEQ A;  2V8U A;  3EZU A;  4KVQ A;  3NP2 X;  4XKT A;  2CHP A;  5D8O A;  5JDO A;  4P18 A;  5AXS A;  5C6F A;  3F38 A;  3E1P A;  5GN8 A;  3R2R A;  4II4 A;  5LG2 A;  5CMR A;  2QF9 A;  4LPM A;  5GU1 X;  2OKC A;  3HL1 A;  1JTS A;  4Z3B A;  4RC6 B;  1DVB A;  3PVR A;  2MGY A;  2V2P A;  3PWQ C;  3KWO A;  4YKH A;  1S30 A;  3UOI A;  3ERZ A;  5JKM G;  2G4H A;  1O9I A;  1YUX A;  2CN6 A;  4EVD A;  2CHI A;  3WVU A;  5D8S A;  1XZ3 A;  4X0J A;  2X17 0;  4M33 A;  2V2M A;  2C2J A;  4MKU A;  2IB0 A;  1JKV A;  3PWF A;  2XKQ A;  3AF7 X;  2JD8 0;  3IS8 A;  2ZUR X;  4CMY A;  4R42 A;  3QVD A;  2V15 A;  3ISF A;  4DAS A;  4YXM A;  2F7N A;  4Z5S A;  3PVY A;  3PW1 A;  5LG8 A;  2C6R A;  4TOG A;  5FFD A;  3TA8 A;  4ZLW A;  4TOH A;  3N6O A;  3PVT B;  3BVL A;  3D19 A;  5HJH A;  3E1L A;  3R2L A;  2JD7 0;  4MUD A;  2FFX J;  4ITT A;  4TW3 A;  4KXR B;  4TOD A;  4ISM A;  4XGS A;  1B71 A;  3E1N A;  5GN8 B;  5GU0 X;  1JYB A;  3AF8 X;  3QZ3 A;  3KA6 A;  4M35 A;  3U90 A;  1MOJ A;  2W0O A;  3FVB A;  3OGH A;  3GGY A;  2FJC A;  3F39 A;  1DPS A;  2BJY A;  5ERJ A;  3C23 A;  3AK9 A;  1TKO A;  2CN7 A;  3DBY A;  4LQV A;  2C2F A;  1L8I A;  3F32 A;  4ZTT A;  2RBD A;  1TK6 A;  2V2J A;  2WLA A;  3SE1 A;  3ES3 A;  3KHK A;  2CIH A;  3F37 A;  5K53 A;  1JRE A;  4MJY A;  4XKU A;  3R2H A;  1R03 A;  2C41 A;  3R2M A;  4CY9 A;  2HTN A;  3RBC A; 
#chains in the Genus database with same CATH homology
 4ML5 A;  1N1Q A;  4RC5 B;  5D8P A;  4CMY V;  1AEW A;  3KXU A;  2YW6 A;  3E1Q A;  3O7S A;  4WJG 4;  2BK6 A;  5D8Q A;  3PWQ A;  1ZUJ A;  2XGW A;  1VEL A;  3A68 A;  1TJO A;  4LYX A;  2XJO A;  3QB9 A;  4REU A;  2YJJ A;  2WTL A;  1Z4A A;  2BW1 A;  1GWG A;  2HR5 A;  3F35 A;  3JZA B;  3IS7 A;  4DYX A;  2FG4 A;  5LBH A;  3WVV A;  4XKS A;  3PVY B;  5JAC A;  3KA4 A;  3NP0 X;  3C1Z A;  1JKU A;  1SOF A;  4M34 A;  5FFB A;  1HRS A;  3PW8 C;  1MFR A;  3RAV A;  2UX1 A;  3JZ9 A;  4IWJ A;  3HIU A;  5IX6 A;  2GYQ A;  3IQ1 A;  5GOU A;  1NF4 A;  1RYT A;  3A9Q A;  3H7G A;  4LQJ A;  2OH3 A;  2D5K A;  5HQO A;  4OYN A;  2VXI A;  3VVA A;  5J9V A;  4TOC A;  5ERK A;  2IU2 A;  3LKD A;  2V2R A;  4A25 A;  3ISE A;  1ZS3 A;  3R2S A;  4TOB A;  4DYY A;  3FSE A;  3AJO A;  4TOF A;  4ZKX A;  2V2N A;  2V2O A;  2WWX B;  3BVE A;  2IY4 A;  1L8H A;  4W4L B;  5D8R A;  1RCD A;  4CVR A;  3L0M A;  3R2O A;  3E6S A;  2AR0 A;  4RC6 A;  4ZL5 A;  4LYU A;  1VEI A;  4M32 A;  4RC7 B;  3FRS A;  2FG8 A;  4DYU A;  1FHA A;  5D8Y A;  3BVK A;  5JDO B;  1JI4 A;  3MPS A;  1NFV A;  4E40 A;  1LKP A;  4KVR A;  1JIG A;  1VLG A;  4U3G A;  3F36 A;  2VZB A;  3AJP A;  4II4 B;  3RGD A;  3E6R A;  1SQ3 A;  3WVW A;  5LS9 A;  2C2U A;  1IES A;  4LQH A;  3QHC A;  4EVB A;  2Z5R A;  2YW7 A;  3GVY A;  4DE6 A;  2XJN A;  2JD6 0;  4TO9 A;  5GU2 X;  3PVR B;  2Z90 A;  3W54 A;  4EVE A;  3AK8 A;  4ZKH A;  4ITW A;  2CLU A;  4ZKW A;  5FFC A;  5CMQ A;  4TOE A;  2N02 A;  3BKN A;  4MN9 A;  1LB3 A;  2Z5P A;  1S2Z A;  1UVH A;  1DAT A;  4ISP A;  3RD0 A;  4PG1 A;  5JKL A;  1O9R A;  1RCC A;  3E2C A;  1RCI A;  4Y08 A;  4AM4 A;  3SH6 A;  1S3Q A;  3GE4 A;  1XZ1 A;  2ZG8 X;  1JI5 A;  4PGI A;  5J8W A;  3Q4N A;  3PVT A;  3AF9 X;  3WNW A;  2Z5Q A;  3KA3 A;  1YV1 A;  4E6K A;  1EUM A;  5J8S A;  3VV9 A;  3BT5 A;  5FEJ A;  2VXX A;  2ZA6 A;  3PW1 B;  3RE7 A;  3FI6 A;  2BKC A;  3AJQ A;  5J93 A;  1RCG A;  3E1M A;  1VJX A;  2FKZ A;  2WLU A;  2G38 B;  4PG0 A;  3V3K B;  2ZA7 A;  1Z6O M;  1LKO A;  5K52 A;  1JGC A;  2FZF A;  2OC5 A;  5JKM A;  3GHQ A;  1OTK A;  4IXK A;  4CVT A;  3F33 A;  4CVP A;  4LPJ A;  4LQN A;  3SID A;  4ZMC A;  2V2S A;  4RC5 A;  3FRR A;  1H96 A;  2ITB A;  3E1J A;  2CWL A;  5D8X A;  1UMN A;  3BVI A;  4MXP A;  3F34 A;  1Z6O A;  3KDQ A;  3OJ5 A;  4CYA A;  5FFA A;  4KVS A;  3NOZ X;  1F30 A;  2Z6M A;  4DI0 A;  3E1O A;  4CYB A;  1BFR A;  2ZG9 X;  1F33 A;  5FFE A;  3UNO A;  4ZJK A;  1LKM A;  3R2K A;  3O7R A;  1BG7 A;  1TKP A;  4DZ0 A;  4QUW A;  3UFB A;  2FL0 A;  4LPN A;  1BCF A;  2V2L A;  3EGM A;  3KA9 A;  4CVS A;  2Y44 A;  2CEI A;  3KX9 A;  4ERU A;  3Q4Q A;  5CZU A;  5HJF A;  2YJK A;  2GS4 A;  2CLB A;  3C21 A;  4ZL6 A;  3T9J A;  3Q4R A;  2V2I A;  2QQY A;  1QGH A;  2XJM A;  3C1Y A;  4RC8 A;  1YUZ A;  4MY7 A;  5I4J A;  3UOF A;  2ZA8 A;  5E2D A;  2FHA A;  3VNX A;  2GYD A;  1RCE A;  3KA8 A;  1NF6 A;  5HU6 D;  4IWK A;  2PYB A;  1KRQ A;  2ZG7 X;  4YXJ A;  4YVZ A;  3BVF A;  5GU3 X;  5E1U A;  5JKL G;  3QHB A;  1J30 A;  2Y3Q A;  3SHX A;  3PZA A;  4AM2 A;  1QYB A;  1NNQ A;  2CF7 A;  4PGK A;  3GGZ A;  1IER A;  2V8T A;  4DYZ A;  4W4K B;  3M6J A;  4EVC A;  3QD8 A;  3EZ0 A;  4ETR A;  3Q4O A;  4TOA A;  4RC7 A;  3PW8 A;  4AM5 A;  1VEQ A;  2V8U A;  3EZU A;  4KVQ A;  3NP2 X;  4XKT A;  2CHP A;  5D8O A;  5JDO A;  4P18 A;  5AXS A;  5C6F A;  3F38 A;  3E1P A;  5GN8 A;  3R2R A;  4II4 A;  5LG2 A;  5CMR A;  2QF9 A;  4LPM A;  5GU1 X;  2OKC A;  3HL1 A;  1JTS A;  4Z3B A;  4RC6 B;  1DVB A;  3PVR A;  2MGY A;  2V2P A;  3PWQ C;  3KWO A;  4YKH A;  1S30 A;  3UOI A;  3ERZ A;  5JKM G;  2G4H A;  1O9I A;  1YUX A;  2CN6 A;  4EVD A;  2CHI A;  3WVU A;  5D8S A;  1XZ3 A;  4X0J A;  2X17 0;  4M33 A;  2V2M A;  2C2J A;  4MKU A;  2IB0 A;  1JKV A;  3PWF A;  2XKQ A;  3AF7 X;  2JD8 0;  3IS8 A;  2ZUR X;  4CMY A;  4R42 A;  3QVD A;  2V15 A;  3ISF A;  4DAS A;  4YXM A;  2F7N A;  4Z5S A;  3PVY A;  3PW1 A;  5LG8 A;  2C6R A;  4TOG A;  5FFD A;  3TA8 A;  4ZLW A;  4TOH A;  3N6O A;  3PVT B;  3BVL A;  3D19 A;  5HJH A;  3E1L A;  3R2L A;  2JD7 0;  4MUD A;  2FFX J;  4ITT A;  4TW3 A;  4KXR B;  4TOD A;  4ISM A;  4XGS A;  1B71 A;  3E1N A;  5GN8 B;  5GU0 X;  1JYB A;  3AF8 X;  3QZ3 A;  3KA6 A;  4M35 A;  3U90 A;  1MOJ A;  2W0O A;  3FVB A;  3OGH A;  3GGY A;  2FJC A;  3F39 A;  1DPS A;  2BJY A;  5ERJ A;  3C23 A;  3AK9 A;  1TKO A;  2CN7 A;  3DBY A;  4LQV A;  2C2F A;  1L8I A;  3F32 A;  4ZTT A;  2RBD A;  1TK6 A;  2V2J A;  2WLA A;  3SE1 A;  3ES3 A;  3KHK A;  2CIH A;  3F37 A;  5K53 A;  1JRE A;  4MJY A;  4XKU A;  3R2H A;  1R03 A;  2C41 A;  3R2M A;  4CY9 A;  2HTN A;  3RBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...