5I4JA

Dps4 from nostoc punctiforme in complex with zn ions
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
177
structure length
177
Chain Sequence
b'TLLRNFGNVYDNPVLLDRSVTAPVTEGFNVVLASFQALYLQYQKHHFVVEGSEFYSLHEFFNESYNQVQDHIHEIGERLDGLGGVPVATFSKLAELTCFEQESEGVYSSRQMVENDLAAEQAIIGVIRRQAAQAESLGDRGTRYLYEKILLKTEERAYHLSHFLAKDSLTLGFVQAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin, Dps family protein
publication title On the trail of iron into Dps4 from N. punctiforme
rcsb
source organism Nostoc punctiforme
molecule tags Metal binding protein
total genus 71
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5i4jA00
1JI4A 1SQ3A 2W0OA 1UVHA 5D8OA 2WLUA 3PW8C 4ISMA 4RC5A 3PVTB 4LPNA 4MY7A 4Z5SA 2FL0A 1JGCA 4II4B 1UMNA 5GN8B 3WVVA 1S3QA 3E1JA 2JD70 4DYUA 3F36A 2V2PA 4IXKA 1F30A 2ZG8X 3F37A 4DE6A 4RC7B 4A25A 2BKCA 1NF4A 1VJXA 3BVEA 5D8PA 2HTNA 2IB0A 4MJYA 2QF9A 4PGKA 3E1QA 2VXIA 1RYTA 2V2RA 2XJNA 5C6FA 5FFEA 1VELA 3F38A 4ERUA 1LB3A 3F39A 4ZKHA 3NP2X 3E1PA 4RC6A 2V2JA 2IU2A 4LQVA 3KXUA 5HJFA 3R2LA 4CMYA 1J30A 3E1OA 4MKUA 4TOHA 5CMRA 4YKHA 2C2JA 4II4A 2G4HA 2X170 4U3GA 1JTSA 4PGIA 5GU2X 4EVCA 2YW6A 1TKOA 1MFRA 3ISEA 2FHAA 4ZMCA 4PG0A 3PVYA 4KVRA 2VZBA 3R2KA 2BW1A 3EGMA 5IX6A 4Z3BA 1AEWA 4CYAA 4EVBA 1JKVA 1DVBA 4TODA 1LKPA 4AM5A 3EZUA 2FJCA 1YV1A 1S30A 4CVPA 2QQYA 1NNQA 3A9QA 3R2OA 1VEIA 3IS8A 2C41A 2V15A 1VLGA 1BFRA 5K52A 3Q4RA 4DI0A 2ZG7X 4IWKA 1MOJA 3AK9A 5FFDA 1JKUA 5AXSA 3E1MA 3PWFA 1XZ3A 2JD80 3HL1A 3AF8X 4TOBA 3QB9A 2XKQA 2IY4A 3KA3A 5D8XA 2Z5RA 3BKNA 3KWOA 3FI6A 2OC5A 5FFBA 3ERZA 4OYNA 4LQNA 3KA8A 2C2UA 3AJOA 3AF7X 1VEQA 2WLAA 3R2HA 2GS4A 3F35A 4TOFA 4CY9A 3PW1B 5GU1X 4ZL5A 2Z6MA 2BK6A 3RD0A 5LG8A 3OJ5A 5JKLG 2VXXA 3PVRA 3PZAA 1Z6OM 2ZA8A 3NOZX 1DATA 1ZS3A 1LKOA 4ZKXA 3SIDA 4ISPA 4ZJKA 2BJYA 4CMYV 2V2SA 5JKLA 2RBDA 4DZ0A 3UOFA 1BG7A 1L8HA 2ZURX 1BCFA 1RCIA 2CN6A 2Z90A 3AK8A 1JYBA 3ES3A 2CF7A 3EZ0A 3ISFA 2V2LA 4MUDA 3AJQA 3AJPA 4TO9A 1IESA 3QHCA 5K53A 3PVTA 5GU0X 5ERJA 4ML5A 1YUZA 2XGWA 5J93A 5CMQA 5GN8A 3PW1A 4REUA 3F34A 2ZA6A 1Z6OA 1TK6A 2CLBA 2V2IA 1FHAA 4DYXA 1ZUJA 2FFXJ 3PWQA 2XJOA 4RC7A 3T9JA 3OGHA 3RGDA 5D8RA 3QZ3A 4ITTA 1NFVA 4EVEA 2FZFA 5LS9A 3KA6A 3U90A 2WTLA 3O7RA 3Q4OA 3AF9X 1EUMA 5CZUA 4RC5B 4M34A 1H96A 3F32A 5GU3X 2CHIA 3KA4A 4XKSA 3E6RA 1IERA 3F33A 4LPJA 4ZTTA 5JKMA 2Y3QA 3Q4QA 3WVUA 5E2DA 3QHBA 5HJHA 2Z5QA 2C6RA 3QD8A 5FFCA 3A68A 3NP0X 3SHXA 2FKZA 1JIGA 4TOCA 5FFAA 1QGHA 3WNWA 3RBCA 4M33A 4QUWA 3UNOA 4RC8A 5ERKA 4ZL6A 2CLUA 4RC6B 3R2MA 1B71A 3FSEA 4IWJA 2PYBA 1XZ1A 2V2MA 4R42A 1KRQA 4MN9A 5J9VA 1RCCA 1N1QA 3BVIA 5J8SA 3VNXA 5D8QA 3BVFA 2CEIA 3PW8A 1L8IA 1JI5A 1RCEA 2CIHA 1O9IA 3UOIA 4CVRA 4LQJA 4CYBA 3MPSA 2F7NA 1O9RA 1JREA 3FVBA 4TOAA 4CVTA 3E2CA 2XJMA 3BVKA 4M32A 3PVYB 1RCGA 3WVWA 2OH3A 4TOEA 3RAVA 3PWQC 3R2RA 2GYQA 3QVDA 4LQHA 3GHQA 1TKPA 3IQ1A 3SH6A 1F33A 3R2SA 1GWGA 4LYXA 4Y08A 5LBHA 5JACA 5LG2A 2JD60 4XKTA 1TJOA 4TW3A 3O7SA 1R03A 5D8SA 3Q4NA 5HQOA 3KA9A 4XKUA 2YJJA 3TA8A 3E1NA 4DYYA 4KVQA 4CVSA 5E1UA 5D8YA 2ITBA 4M35A 3BVLA 3BT5A 4LPMA 1YUXA 5JKMG 4EVDA 2HR5A 1NF6A 4AM4A 3IS7A 4LYUA 4DASA 4DYZA 2FG4A 4KVSA 4PG1A 5FEJA 4ETRA 4TOGA 1SOFA 1S2ZA 4ZLWA 2GYDA 3PVRB 2CN7A 2C2FA 3H7GA 3RE7A 4AM2A 1Z4AA 2V2OA 2ZG9X 4P18A 2CHPA 5GOUA 4E6KA 2YW7A 1OTKA 3GVYA 1DPSA 3E6SA 4ITWA 3KX9A 5I4JA 4ZKWA 2ZA7A 2D5KA 3HIUA 3SE1A 5J8WA 2YJKA 1RCDA 2V2NA 4XGSA 1HRSA 1LKMA 2FG8A 3E1LA 1QYBA 2UX1A 3GE4A 2Z5PA
chains in the Genus database with same CATH superfamily
1JI4A 1SQ3A 3LKDA 2W0OA 1UVHA 5D8OA 2WLUA 3UFBA 3PW8C 4ISMA 4RC5A 3PVTB 4LPNA 4MY7A 4Z5SA 2FL0A 2OKCA 1JGCA 4II4B 1UMNA 4X0JA 5GN8B 3WVVA 1S3QA 3E1JA 2JD70 2WWXB 4DYUA 3F36A 2V2PA 4IXKA 1F30A 2ZG8X 3F37A 4DE6A 4RC7B 4A25A 2BKCA 3JZ9A 1NF4A 1VJXA 3BVEA 5D8PA 2HTNA 2IB0A 4MJYA 5HU6D 2QF9A 4PGKA 3E1QA 2VXIA 3FRSA 1RYTA 2V2RA 2XJNA 3GGZA 5C6FA 5FFEA 1VELA 3F38A 4ERUA 1LB3A 3F39A 4ZKHA 3NP2X 3E1PA 4RC6A 2V2JA 2IU2A 2Y44A 4LQVA 3KXUA 5HJFA 3R2LA 4CMYA 1J30A 3E1OA 4MKUA 4TOHA 5CMRA 4YKHA 2C2JA 4II4A 2G4HA 2X170 4U3GA 1JTSA 4PGIA 5GU2X 3C21A 4EVCA 2YW6A 1TKOA 5JDOB 2G38B 1MFRA 3ISEA 2FHAA 4ZMCA 4PG0A 3PVYA 4KVRA 2VZBA 3R2KA 2BW1A 3EGMA 5IX6A 3C1ZA 4Z3BA 1AEWA 4CYAA 4EVBA 1JKVA 1DVBA 4TODA 1LKPA 4AM5A 3EZUA 2FJCA 1YV1A 1S30A 4CVPA 3KHKA 2QQYA 1NNQA 3A9QA 3R2OA 1VEIA 3IS8A 2C41A 2V15A 1VLGA 1BFRA 5K52A 3Q4RA 4DI0A 2ZG7X 4IWKA 1MOJA 2AR0A 3AK9A 5FFDA 1JKUA 5AXSA 3E1MA 3PWFA 1XZ3A 2JD80 3HL1A 3AF8X 4TOBA 3QB9A 2XKQA 2IY4A 3KA3A 5D8XA 2Z5RA 3BKNA 3KWOA 3FI6A 2OC5A 5FFBA 3ERZA 4OYNA 4LQNA 3KA8A 2C2UA 3AJOA 3DBYA 3AF7X 1VEQA 2WLAA 3R2HA 2GS4A 3F35A 4TOFA 4CY9A 3PW1B 5GU1X 4ZL5A 2Z6MA 2BK6A 3RD0A 4E40A 5LG8A 3OJ5A 5JKLG 2VXXA 3PVRA 3PZAA 1Z6OM 2ZA8A 3NOZX 1DATA 1ZS3A 1LKOA 4ZKXA 4YXMA 3M6JA 3SIDA 4ISPA 4ZJKA 2BJYA 4CMYV 2V2SA 5JKLA 2RBDA 4DZ0A 3UOFA 3N6OA 1BG7A 1L8HA 2ZURX 1BCFA 1RCIA 2CN6A 2Z90A 3AK8A 1JYBA 3ES3A 2CF7A 3EZ0A 3ISFA 2V2LA 4MUDA 3AJQA 4W4KB 3AJPA 4TO9A 1IESA 3QHCA 5K53A 3PVTA 2CWLA 5GU0X 3C23A 5ERJA 4ML5A 1YUZA 2XGWA 4MXPA 5J93A 5CMQA 5GN8A 3PW1A 4REUA 4YVZA 3F34A 2ZA6A 1Z6OA 1TK6A 2CLBA 2V2IA 1FHAA 4DYXA 1ZUJA 2MGYA 2FFXJ 3PWQA 2XJOA 3C1YA 4RC7A 3T9JA 4YXJA 3OGHA 3RGDA 5D8RA 3QZ3A 4ITTA 1NFVA 4EVEA 2FZFA 5LS9A 3VVAA 3KA6A 3U90A 2WTLA 3O7RA 3Q4OA 3AF9X 1EUMA 5CZUA 4RC5B 4M34A 1H96A 3F32A 5GU3X 2CHIA 3KA4A 4XKSA 3E6RA 2V8TA 1IERA 3F33A 4LPJA 4ZTTA 5JKMA 2Y3QA 3Q4QA 3WVUA 5E2DA 3QHBA 5HJHA 4WJG4 2Z5QA 2C6RA 3QD8A 5JDOA 5FFCA 3KDQA 3A68A 3NP0X 4KXRB 3SHXA 2FKZA 1JIGA 4TOCA 5FFAA 1QGHA 3WNWA 3RBCA 4M33A 4QUWA 3UNOA 4RC8A 5ERKA 4ZL6A 2CLUA 3GGYA 4RC6B 3R2MA 1B71A 3FSEA 4IWJA 2PYBA 3W54A 1XZ1A 2V2MA 3V3KB 4R42A 1KRQA 4MN9A 5J9VA 1RCCA 1N1QA 3BVIA 5J8SA 3VNXA 5D8QA 3BVFA 2CEIA 3PW8A 1L8IA 1JI5A 1RCEA 2CIHA 1O9IA 3UOIA 4CVRA 4LQJA 4CYBA 3MPSA 2F7NA 1O9RA 1JREA 3FVBA 4TOAA 4CVTA 3E2CA 2XJMA 3BVKA 4M32A 3PVYB 1RCGA 3L0MA 3WVWA 2OH3A 4TOEA 3RAVA 3PWQC 3R2RA 2GYQA 3QVDA 4LQHA 3GHQA 3JZAB 1TKPA 3IQ1A 3SH6A 1F33A 3R2SA 1GWGA 4LYXA 4Y08A 5LBHA 5JACA 2V8UA 4W4LB 5LG2A 2JD60 4XKTA 1TJOA 4TW3A 3O7SA 1R03A 5D8SA 3Q4NA 5HQOA 3KA9A 4XKUA 3FRRA 2YJJA 3TA8A 3E1NA 4DYYA 4KVQA 4CVSA 5E1UA 5D8YA 2ITBA 4M35A 3BVLA 3VV9A 3BT5A 4LPMA 1YUXA 5JKMG 4EVDA 2HR5A 1NF6A 4AM4A 3IS7A 4LYUA 4DASA 4DYZA 2FG4A 4KVSA 4PG1A 5FEJA 4ETRA 4TOGA 1SOFA 1S2ZA 2N02A 4ZLWA 2GYDA 3PVRB 2CN7A 2C2FA 3H7GA 3RE7A 4AM2A 3D19A 1Z4AA 2V2OA 2ZG9X 4P18A 2CHPA 5GOUA 4E6KA 2YW7A 1OTKA 3GVYA 1DPSA 3E6SA 4ITWA 3KX9A 5I4JA 4ZKWA 2ZA7A 2D5KA 3HIUA 3SE1A 5J8WA 2YJKA 1RCDA 2V2NA 4XGSA 1HRSA 1LKMA 2FG8A 3E1LA 1QYBA 2UX1A 3GE4A 2Z5PA
chains in the Genus database with same CATH topology
1JI4A 1SQ3A 3LKDA 2W0OA 1UVHA 5D8OA 2WLUA 3UFBA 3PW8C 4ISMA 4RC5A 3PVTB 4LPNA 4MY7A 4Z5SA 2FL0A 2OKCA 1JGCA 4II4B 1UMNA 4X0JA 5GN8B 3WVVA 1S3QA 3E1JA 2JD70 2WWXB 4DYUA 3F36A 2V2PA 4IXKA 1F30A 2ZG8X 3F37A 4DE6A 4RC7B 4A25A 2BKCA 3JZ9A 1NF4A 1VJXA 3BVEA 5D8PA 2HTNA 2IB0A 4MJYA 5HU6D 2QF9A 4PGKA 3E1QA 2VXIA 3FRSA 1RYTA 2V2RA 2XJNA 3GGZA 5C6FA 5FFEA 1VELA 3F38A 4ERUA 1LB3A 3F39A 4ZKHA 3NP2X 3E1PA 4RC6A 2V2JA 2IU2A 2Y44A 4LQVA 3KXUA 5HJFA 3R2LA 4CMYA 1J30A 3E1OA 4MKUA 4TOHA 5CMRA 4YKHA 2C2JA 4II4A 2G4HA 2X170 4U3GA 1JTSA 4PGIA 5GU2X 3C21A 4EVCA 2YW6A 1TKOA 5JDOB 2G38B 1MFRA 3ISEA 2FHAA 4ZMCA 4PG0A 3PVYA 4KVRA 2VZBA 3R2KA 2BW1A 3EGMA 5IX6A 3C1ZA 4Z3BA 1AEWA 4CYAA 4EVBA 1JKVA 1DVBA 4TODA 1LKPA 4AM5A 3EZUA 2FJCA 1YV1A 1S30A 4CVPA 3KHKA 2QQYA 1NNQA 3A9QA 3R2OA 1VEIA 3IS8A 2C41A 2V15A 1VLGA 1BFRA 5K52A 3Q4RA 4DI0A 2ZG7X 4IWKA 1MOJA 2AR0A 3AK9A 5FFDA 1JKUA 5AXSA 3E1MA 3PWFA 1XZ3A 2JD80 3HL1A 3AF8X 4TOBA 3QB9A 2XKQA 2IY4A 3KA3A 5D8XA 2Z5RA 3BKNA 3KWOA 3FI6A 2OC5A 5FFBA 3ERZA 4OYNA 4LQNA 3KA8A 2C2UA 3AJOA 3DBYA 3AF7X 1VEQA 2WLAA 3R2HA 2GS4A 3F35A 4TOFA 4CY9A 3PW1B 5GU1X 4ZL5A 2Z6MA 2BK6A 3RD0A 4E40A 5LG8A 3OJ5A 5JKLG 2VXXA 3PVRA 3PZAA 1Z6OM 2ZA8A 3NOZX 1DATA 1ZS3A 1LKOA 4ZKXA 4YXMA 3M6JA 3SIDA 4ISPA 4ZJKA 2BJYA 4CMYV 2V2SA 5JKLA 2RBDA 4DZ0A 3UOFA 3N6OA 1BG7A 1L8HA 2ZURX 1BCFA 1RCIA 2CN6A 2Z90A 3AK8A 1JYBA 3ES3A 2CF7A 3EZ0A 3ISFA 2V2LA 4MUDA 3AJQA 4W4KB 3AJPA 4TO9A 1IESA 3QHCA 5K53A 3PVTA 2CWLA 5GU0X 3C23A 5ERJA 4ML5A 1YUZA 2XGWA 4MXPA 5J93A 5CMQA 5GN8A 3PW1A 4REUA 4YVZA 3F34A 2ZA6A 1Z6OA 1TK6A 2CLBA 2V2IA 1FHAA 4DYXA 1ZUJA 2MGYA 2FFXJ 3PWQA 2XJOA 3C1YA 4RC7A 3T9JA 4YXJA 3OGHA 3RGDA 5D8RA 3QZ3A 4ITTA 1NFVA 4EVEA 2FZFA 5LS9A 3VVAA 3KA6A 3U90A 2WTLA 3O7RA 3Q4OA 3AF9X 1EUMA 5CZUA 4RC5B 4M34A 1H96A 3F32A 5GU3X 2CHIA 3KA4A 4XKSA 3E6RA 2V8TA 1IERA 3F33A 4LPJA 4ZTTA 5JKMA 2Y3QA 3Q4QA 3WVUA 5E2DA 3QHBA 5HJHA 4WJG4 2Z5QA 2C6RA 3QD8A 5JDOA 5FFCA 3KDQA 3A68A 3NP0X 4KXRB 3SHXA 2FKZA 1JIGA 4TOCA 5FFAA 1QGHA 3WNWA 3RBCA 4M33A 4QUWA 3UNOA 4RC8A 5ERKA 4ZL6A 2CLUA 3GGYA 4RC6B 3R2MA 1B71A 3FSEA 4IWJA 2PYBA 3W54A 1XZ1A 2V2MA 3V3KB 4R42A 1KRQA 4MN9A 5J9VA 1RCCA 1N1QA 3BVIA 5J8SA 3VNXA 5D8QA 3BVFA 2CEIA 3PW8A 1L8IA 1JI5A 1RCEA 2CIHA 1O9IA 3UOIA 4CVRA 4LQJA 4CYBA 3MPSA 2F7NA 1O9RA 1JREA 3FVBA 4TOAA 4CVTA 3E2CA 2XJMA 3BVKA 4M32A 3PVYB 1RCGA 3L0MA 3WVWA 2OH3A 4TOEA 3RAVA 3PWQC 3R2RA 2GYQA 3QVDA 4LQHA 3GHQA 3JZAB 1TKPA 3IQ1A 3SH6A 1F33A 3R2SA 1GWGA 4LYXA 4Y08A 5LBHA 5JACA 2V8UA 4W4LB 5LG2A 2JD60 4XKTA 1TJOA 4TW3A 3O7SA 1R03A 5D8SA 3Q4NA 5HQOA 3KA9A 4XKUA 3FRRA 2YJJA 3TA8A 3E1NA 4DYYA 4KVQA 4CVSA 5E1UA 5D8YA 2ITBA 4M35A 3BVLA 3VV9A 3BT5A 4LPMA 1YUXA 5JKMG 4EVDA 2HR5A 1NF6A 4AM4A 3IS7A 4LYUA 4DASA 4DYZA 2FG4A 4KVSA 4PG1A 5FEJA 4ETRA 4TOGA 1SOFA 1S2ZA 2N02A 4ZLWA 2GYDA 3PVRB 2CN7A 2C2FA 3H7GA 3RE7A 4AM2A 3D19A 1Z4AA 2V2OA 2ZG9X 4P18A 2CHPA 5GOUA 4E6KA 2YW7A 1OTKA 3GVYA 1DPSA 3E6SA 4ITWA 3KX9A 5I4JA 4ZKWA 2ZA7A 2D5KA 3HIUA 3SE1A 5J8WA 2YJKA 1RCDA 2V2NA 4XGSA 1HRSA 1LKMA 2FG8A 3E1LA 1QYBA 2UX1A 3GE4A 2Z5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI4 A;  1SQ3 A;  2W0O A;  1UVH A;  5D8O A;  2WLU A;  3PW8 C;  4ISM A;  4RC5 A;  3PVT B;  4LPN A;  4MY7 A;  4Z5S A;  2FL0 A;  1JGC A;  4II4 B;  1UMN A;  5GN8 B;  3WVV A;  1S3Q A;  3E1J A;  2JD7 0;  4DYU A;  3F36 A;  2V2P A;  4IXK A;  1F30 A;  2ZG8 X;  3F37 A;  4DE6 A;  4RC7 B;  4A25 A;  2BKC A;  1NF4 A;  1VJX A;  3BVE A;  5D8P A;  2HTN A;  2IB0 A;  4MJY A;  2QF9 A;  4PGK A;  3E1Q A;  2VXI A;  1RYT A;  2V2R A;  2XJN A;  5C6F A;  5FFE A;  1VEL A;  3F38 A;  4ERU A;  1LB3 A;  3F39 A;  4ZKH A;  3NP2 X;  3E1P A;  4RC6 A;  2V2J A;  2IU2 A;  4LQV A;  3KXU A;  5HJF A;  3R2L A;  4CMY A;  1J30 A;  3E1O A;  4MKU A;  4TOH A;  5CMR A;  4YKH A;  2C2J A;  4II4 A;  2G4H A;  2X17 0;  4U3G A;  1JTS A;  4PGI A;  5GU2 X;  4EVC A;  2YW6 A;  1TKO A;  1MFR A;  3ISE A;  2FHA A;  4ZMC A;  4PG0 A;  3PVY A;  4KVR A;  2VZB A;  3R2K A;  2BW1 A;  3EGM A;  5IX6 A;  4Z3B A;  1AEW A;  4CYA A;  4EVB A;  1JKV A;  1DVB A;  4TOD A;  1LKP A;  4AM5 A;  3EZU A;  2FJC A;  1YV1 A;  1S30 A;  4CVP A;  2QQY A;  1NNQ A;  3A9Q A;  3R2O A;  1VEI A;  3IS8 A;  2C41 A;  2V15 A;  1VLG A;  1BFR A;  5K52 A;  3Q4R A;  4DI0 A;  2ZG7 X;  4IWK A;  1MOJ A;  3AK9 A;  5FFD A;  1JKU A;  5AXS A;  3E1M A;  3PWF A;  1XZ3 A;  2JD8 0;  3HL1 A;  3AF8 X;  4TOB A;  3QB9 A;  2XKQ A;  2IY4 A;  3KA3 A;  5D8X A;  2Z5R A;  3BKN A;  3KWO A;  3FI6 A;  2OC5 A;  5FFB A;  3ERZ A;  4OYN A;  4LQN A;  3KA8 A;  2C2U A;  3AJO A;  3AF7 X;  1VEQ A;  2WLA A;  3R2H A;  2GS4 A;  3F35 A;  4TOF A;  4CY9 A;  3PW1 B;  5GU1 X;  4ZL5 A;  2Z6M A;  2BK6 A;  3RD0 A;  5LG8 A;  3OJ5 A;  5JKL G;  2VXX A;  3PVR A;  3PZA A;  1Z6O M;  2ZA8 A;  3NOZ X;  1DAT A;  1ZS3 A;  1LKO A;  4ZKX A;  3SID A;  4ISP A;  4ZJK A;  2BJY A;  4CMY V;  2V2S A;  5JKL A;  2RBD A;  4DZ0 A;  3UOF A;  1BG7 A;  1L8H A;  2ZUR X;  1BCF A;  1RCI A;  2CN6 A;  2Z90 A;  3AK8 A;  1JYB A;  3ES3 A;  2CF7 A;  3EZ0 A;  3ISF A;  2V2L A;  4MUD A;  3AJQ A;  3AJP A;  4TO9 A;  1IES A;  3QHC A;  5K53 A;  3PVT A;  5GU0 X;  5ERJ A;  4ML5 A;  1YUZ A;  2XGW A;  5J93 A;  5CMQ A;  5GN8 A;  3PW1 A;  4REU A;  3F34 A;  2ZA6 A;  1Z6O A;  1TK6 A;  2CLB A;  2V2I A;  1FHA A;  4DYX A;  1ZUJ A;  2FFX J;  3PWQ A;  2XJO A;  4RC7 A;  3T9J A;  3OGH A;  3RGD A;  5D8R A;  3QZ3 A;  4ITT A;  1NFV A;  4EVE A;  2FZF A;  5LS9 A;  3KA6 A;  3U90 A;  2WTL A;  3O7R A;  3Q4O A;  3AF9 X;  1EUM A;  5CZU A;  4RC5 B;  4M34 A;  1H96 A;  3F32 A;  5GU3 X;  2CHI A;  3KA4 A;  4XKS A;  3E6R A;  1IER A;  3F33 A;  4LPJ A;  4ZTT A;  5JKM A;  2Y3Q A;  3Q4Q A;  3WVU A;  5E2D A;  3QHB A;  5HJH A;  2Z5Q A;  2C6R A;  3QD8 A;  5FFC A;  3A68 A;  3NP0 X;  3SHX A;  2FKZ A;  1JIG A;  4TOC A;  5FFA A;  1QGH A;  3WNW A;  3RBC A;  4M33 A;  4QUW A;  3UNO A;  4RC8 A;  5ERK A;  4ZL6 A;  2CLU A;  4RC6 B;  3R2M A;  1B71 A;  3FSE A;  4IWJ A;  2PYB A;  1XZ1 A;  2V2M A;  4R42 A;  1KRQ A;  4MN9 A;  5J9V A;  1RCC A;  1N1Q A;  3BVI A;  5J8S A;  3VNX A;  5D8Q A;  3BVF A;  2CEI A;  3PW8 A;  1L8I A;  1JI5 A;  1RCE A;  2CIH A;  1O9I A;  3UOI A;  4CVR A;  4LQJ A;  4CYB A;  3MPS A;  2F7N A;  1O9R A;  1JRE A;  3FVB A;  4TOA A;  4CVT A;  3E2C A;  2XJM A;  3BVK A;  4M32 A;  3PVY B;  1RCG A;  3WVW A;  2OH3 A;  4TOE A;  3RAV A;  3PWQ C;  3R2R A;  2GYQ A;  3QVD A;  4LQH A;  3GHQ A;  1TKP A;  3IQ1 A;  3SH6 A;  1F33 A;  3R2S A;  1GWG A;  4LYX A;  4Y08 A;  5LBH A;  5JAC A;  5LG2 A;  2JD6 0;  4XKT A;  1TJO A;  4TW3 A;  3O7S A;  1R03 A;  5D8S A;  3Q4N A;  5HQO A;  3KA9 A;  4XKU A;  2YJJ A;  3TA8 A;  3E1N A;  4DYY A;  4KVQ A;  4CVS A;  5E1U A;  5D8Y A;  2ITB A;  4M35 A;  3BVL A;  3BT5 A;  4LPM A;  1YUX A;  5JKM G;  4EVD A;  2HR5 A;  1NF6 A;  4AM4 A;  3IS7 A;  4LYU A;  4DAS A;  4DYZ A;  2FG4 A;  4KVS A;  4PG1 A;  5FEJ A;  4ETR A;  4TOG A;  1SOF A;  1S2Z A;  4ZLW A;  2GYD A;  3PVR B;  2CN7 A;  2C2F A;  3H7G A;  3RE7 A;  4AM2 A;  1Z4A A;  2V2O A;  2ZG9 X;  4P18 A;  2CHP A;  5GOU A;  4E6K A;  2YW7 A;  1OTK A;  3GVY A;  1DPS A;  3E6S A;  4ITW A;  3KX9 A;  5I4J A;  4ZKW A;  2ZA7 A;  2D5K A;  3HIU A;  3SE1 A;  5J8W A;  2YJK A;  1RCD A;  2V2N A;  4XGS A;  1HRS A;  1LKM A;  2FG8 A;  3E1L A;  1QYB A;  2UX1 A;  3GE4 A;  2Z5P A; 
#chains in the Genus database with same CATH topology
 1JI4 A;  1SQ3 A;  3LKD A;  2W0O A;  1UVH A;  5D8O A;  2WLU A;  3UFB A;  3PW8 C;  4ISM A;  4RC5 A;  3PVT B;  4LPN A;  4MY7 A;  4Z5S A;  2FL0 A;  2OKC A;  1JGC A;  4II4 B;  1UMN A;  4X0J A;  5GN8 B;  3WVV A;  1S3Q A;  3E1J A;  2JD7 0;  2WWX B;  4DYU A;  3F36 A;  2V2P A;  4IXK A;  1F30 A;  2ZG8 X;  3F37 A;  4DE6 A;  4RC7 B;  4A25 A;  2BKC A;  3JZ9 A;  1NF4 A;  1VJX A;  3BVE A;  5D8P A;  2HTN A;  2IB0 A;  4MJY A;  5HU6 D;  2QF9 A;  4PGK A;  3E1Q A;  2VXI A;  3FRS A;  1RYT A;  2V2R A;  2XJN A;  3GGZ A;  5C6F A;  5FFE A;  1VEL A;  3F38 A;  4ERU A;  1LB3 A;  3F39 A;  4ZKH A;  3NP2 X;  3E1P A;  4RC6 A;  2V2J A;  2IU2 A;  2Y44 A;  4LQV A;  3KXU A;  5HJF A;  3R2L A;  4CMY A;  1J30 A;  3E1O A;  4MKU A;  4TOH A;  5CMR A;  4YKH A;  2C2J A;  4II4 A;  2G4H A;  2X17 0;  4U3G A;  1JTS A;  4PGI A;  5GU2 X;  3C21 A;  4EVC A;  2YW6 A;  1TKO A;  5JDO B;  2G38 B;  1MFR A;  3ISE A;  2FHA A;  4ZMC A;  4PG0 A;  3PVY A;  4KVR A;  2VZB A;  3R2K A;  2BW1 A;  3EGM A;  5IX6 A;  3C1Z A;  4Z3B A;  1AEW A;  4CYA A;  4EVB A;  1JKV A;  1DVB A;  4TOD A;  1LKP A;  4AM5 A;  3EZU A;  2FJC A;  1YV1 A;  1S30 A;  4CVP A;  3KHK A;  2QQY A;  1NNQ A;  3A9Q A;  3R2O A;  1VEI A;  3IS8 A;  2C41 A;  2V15 A;  1VLG A;  1BFR A;  5K52 A;  3Q4R A;  4DI0 A;  2ZG7 X;  4IWK A;  1MOJ A;  2AR0 A;  3AK9 A;  5FFD A;  1JKU A;  5AXS A;  3E1M A;  3PWF A;  1XZ3 A;  2JD8 0;  3HL1 A;  3AF8 X;  4TOB A;  3QB9 A;  2XKQ A;  2IY4 A;  3KA3 A;  5D8X A;  2Z5R A;  3BKN A;  3KWO A;  3FI6 A;  2OC5 A;  5FFB A;  3ERZ A;  4OYN A;  4LQN A;  3KA8 A;  2C2U A;  3AJO A;  3DBY A;  3AF7 X;  1VEQ A;  2WLA A;  3R2H A;  2GS4 A;  3F35 A;  4TOF A;  4CY9 A;  3PW1 B;  5GU1 X;  4ZL5 A;  2Z6M A;  2BK6 A;  3RD0 A;  4E40 A;  5LG8 A;  3OJ5 A;  5JKL G;  2VXX A;  3PVR A;  3PZA A;  1Z6O M;  2ZA8 A;  3NOZ X;  1DAT A;  1ZS3 A;  1LKO A;  4ZKX A;  4YXM A;  3M6J A;  3SID A;  4ISP A;  4ZJK A;  2BJY A;  4CMY V;  2V2S A;  5JKL A;  2RBD A;  4DZ0 A;  3UOF A;  3N6O A;  1BG7 A;  1L8H A;  2ZUR X;  1BCF A;  1RCI A;  2CN6 A;  2Z90 A;  3AK8 A;  1JYB A;  3ES3 A;  2CF7 A;  3EZ0 A;  3ISF A;  2V2L A;  4MUD A;  3AJQ A;  4W4K B;  3AJP A;  4TO9 A;  1IES A;  3QHC A;  5K53 A;  3PVT A;  2CWL A;  5GU0 X;  3C23 A;  5ERJ A;  4ML5 A;  1YUZ A;  2XGW A;  4MXP A;  5J93 A;  5CMQ A;  5GN8 A;  3PW1 A;  4REU A;  4YVZ A;  3F34 A;  2ZA6 A;  1Z6O A;  1TK6 A;  2CLB A;  2V2I A;  1FHA A;  4DYX A;  1ZUJ A;  2MGY A;  2FFX J;  3PWQ A;  2XJO A;  3C1Y A;  4RC7 A;  3T9J A;  4YXJ A;  3OGH A;  3RGD A;  5D8R A;  3QZ3 A;  4ITT A;  1NFV A;  4EVE A;  2FZF A;  5LS9 A;  3VVA A;  3KA6 A;  3U90 A;  2WTL A;  3O7R A;  3Q4O A;  3AF9 X;  1EUM A;  5CZU A;  4RC5 B;  4M34 A;  1H96 A;  3F32 A;  5GU3 X;  2CHI A;  3KA4 A;  4XKS A;  3E6R A;  2V8T A;  1IER A;  3F33 A;  4LPJ A;  4ZTT A;  5JKM A;  2Y3Q A;  3Q4Q A;  3WVU A;  5E2D A;  3QHB A;  5HJH A;  4WJG 4;  2Z5Q A;  2C6R A;  3QD8 A;  5JDO A;  5FFC A;  3KDQ A;  3A68 A;  3NP0 X;  4KXR B;  3SHX A;  2FKZ A;  1JIG A;  4TOC A;  5FFA A;  1QGH A;  3WNW A;  3RBC A;  4M33 A;  4QUW A;  3UNO A;  4RC8 A;  5ERK A;  4ZL6 A;  2CLU A;  3GGY A;  4RC6 B;  3R2M A;  1B71 A;  3FSE A;  4IWJ A;  2PYB A;  3W54 A;  1XZ1 A;  2V2M A;  3V3K B;  4R42 A;  1KRQ A;  4MN9 A;  5J9V A;  1RCC A;  1N1Q A;  3BVI A;  5J8S A;  3VNX A;  5D8Q A;  3BVF A;  2CEI A;  3PW8 A;  1L8I A;  1JI5 A;  1RCE A;  2CIH A;  1O9I A;  3UOI A;  4CVR A;  4LQJ A;  4CYB A;  3MPS A;  2F7N A;  1O9R A;  1JRE A;  3FVB A;  4TOA A;  4CVT A;  3E2C A;  2XJM A;  3BVK A;  4M32 A;  3PVY B;  1RCG A;  3L0M A;  3WVW A;  2OH3 A;  4TOE A;  3RAV A;  3PWQ C;  3R2R A;  2GYQ A;  3QVD A;  4LQH A;  3GHQ A;  3JZA B;  1TKP A;  3IQ1 A;  3SH6 A;  1F33 A;  3R2S A;  1GWG A;  4LYX A;  4Y08 A;  5LBH A;  5JAC A;  2V8U A;  4W4L B;  5LG2 A;  2JD6 0;  4XKT A;  1TJO A;  4TW3 A;  3O7S A;  1R03 A;  5D8S A;  3Q4N A;  5HQO A;  3KA9 A;  4XKU A;  3FRR A;  2YJJ A;  3TA8 A;  3E1N A;  4DYY A;  4KVQ A;  4CVS A;  5E1U A;  5D8Y A;  2ITB A;  4M35 A;  3BVL A;  3VV9 A;  3BT5 A;  4LPM A;  1YUX A;  5JKM G;  4EVD A;  2HR5 A;  1NF6 A;  4AM4 A;  3IS7 A;  4LYU A;  4DAS A;  4DYZ A;  2FG4 A;  4KVS A;  4PG1 A;  5FEJ A;  4ETR A;  4TOG A;  1SOF A;  1S2Z A;  2N02 A;  4ZLW A;  2GYD A;  3PVR B;  2CN7 A;  2C2F A;  3H7G A;  3RE7 A;  4AM2 A;  3D19 A;  1Z4A A;  2V2O A;  2ZG9 X;  4P18 A;  2CHP A;  5GOU A;  4E6K A;  2YW7 A;  1OTK A;  3GVY A;  1DPS A;  3E6S A;  4ITW A;  3KX9 A;  5I4J A;  4ZKW A;  2ZA7 A;  2D5K A;  3HIU A;  3SE1 A;  5J8W A;  2YJK A;  1RCD A;  2V2N A;  4XGS A;  1HRS A;  1LKM A;  2FG8 A;  3E1L A;  1QYB A;  2UX1 A;  3GE4 A;  2Z5P A; 
#chains in the Genus database with same CATH homology
 1JI4 A;  1SQ3 A;  3LKD A;  2W0O A;  1UVH A;  5D8O A;  2WLU A;  3UFB A;  3PW8 C;  4ISM A;  4RC5 A;  3PVT B;  4LPN A;  4MY7 A;  4Z5S A;  2FL0 A;  2OKC A;  1JGC A;  4II4 B;  1UMN A;  4X0J A;  5GN8 B;  3WVV A;  1S3Q A;  3E1J A;  2JD7 0;  2WWX B;  4DYU A;  3F36 A;  2V2P A;  4IXK A;  1F30 A;  2ZG8 X;  3F37 A;  4DE6 A;  4RC7 B;  4A25 A;  2BKC A;  3JZ9 A;  1NF4 A;  1VJX A;  3BVE A;  5D8P A;  2HTN A;  2IB0 A;  4MJY A;  5HU6 D;  2QF9 A;  4PGK A;  3E1Q A;  2VXI A;  3FRS A;  1RYT A;  2V2R A;  2XJN A;  3GGZ A;  5C6F A;  5FFE A;  1VEL A;  3F38 A;  4ERU A;  1LB3 A;  3F39 A;  4ZKH A;  3NP2 X;  3E1P A;  4RC6 A;  2V2J A;  2IU2 A;  2Y44 A;  4LQV A;  3KXU A;  5HJF A;  3R2L A;  4CMY A;  1J30 A;  3E1O A;  4MKU A;  4TOH A;  5CMR A;  4YKH A;  2C2J A;  4II4 A;  2G4H A;  2X17 0;  4U3G A;  1JTS A;  4PGI A;  5GU2 X;  3C21 A;  4EVC A;  2YW6 A;  1TKO A;  5JDO B;  2G38 B;  1MFR A;  3ISE A;  2FHA A;  4ZMC A;  4PG0 A;  3PVY A;  4KVR A;  2VZB A;  3R2K A;  2BW1 A;  3EGM A;  5IX6 A;  3C1Z A;  4Z3B A;  1AEW A;  4CYA A;  4EVB A;  1JKV A;  1DVB A;  4TOD A;  1LKP A;  4AM5 A;  3EZU A;  2FJC A;  1YV1 A;  1S30 A;  4CVP A;  3KHK A;  2QQY A;  1NNQ A;  3A9Q A;  3R2O A;  1VEI A;  3IS8 A;  2C41 A;  2V15 A;  1VLG A;  1BFR A;  5K52 A;  3Q4R A;  4DI0 A;  2ZG7 X;  4IWK A;  1MOJ A;  2AR0 A;  3AK9 A;  5FFD A;  1JKU A;  5AXS A;  3E1M A;  3PWF A;  1XZ3 A;  2JD8 0;  3HL1 A;  3AF8 X;  4TOB A;  3QB9 A;  2XKQ A;  2IY4 A;  3KA3 A;  5D8X A;  2Z5R A;  3BKN A;  3KWO A;  3FI6 A;  2OC5 A;  5FFB A;  3ERZ A;  4OYN A;  4LQN A;  3KA8 A;  2C2U A;  3AJO A;  3DBY A;  3AF7 X;  1VEQ A;  2WLA A;  3R2H A;  2GS4 A;  3F35 A;  4TOF A;  4CY9 A;  3PW1 B;  5GU1 X;  4ZL5 A;  2Z6M A;  2BK6 A;  3RD0 A;  4E40 A;  5LG8 A;  3OJ5 A;  5JKL G;  2VXX A;  3PVR A;  3PZA A;  1Z6O M;  2ZA8 A;  3NOZ X;  1DAT A;  1ZS3 A;  1LKO A;  4ZKX A;  4YXM A;  3M6J A;  3SID A;  4ISP A;  4ZJK A;  2BJY A;  4CMY V;  2V2S A;  5JKL A;  2RBD A;  4DZ0 A;  3UOF A;  3N6O A;  1BG7 A;  1L8H A;  2ZUR X;  1BCF A;  1RCI A;  2CN6 A;  2Z90 A;  3AK8 A;  1JYB A;  3ES3 A;  2CF7 A;  3EZ0 A;  3ISF A;  2V2L A;  4MUD A;  3AJQ A;  4W4K B;  3AJP A;  4TO9 A;  1IES A;  3QHC A;  5K53 A;  3PVT A;  2CWL A;  5GU0 X;  3C23 A;  5ERJ A;  4ML5 A;  1YUZ A;  2XGW A;  4MXP A;  5J93 A;  5CMQ A;  5GN8 A;  3PW1 A;  4REU A;  4YVZ A;  3F34 A;  2ZA6 A;  1Z6O A;  1TK6 A;  2CLB A;  2V2I A;  1FHA A;  4DYX A;  1ZUJ A;  2MGY A;  2FFX J;  3PWQ A;  2XJO A;  3C1Y A;  4RC7 A;  3T9J A;  4YXJ A;  3OGH A;  3RGD A;  5D8R A;  3QZ3 A;  4ITT A;  1NFV A;  4EVE A;  2FZF A;  5LS9 A;  3VVA A;  3KA6 A;  3U90 A;  2WTL A;  3O7R A;  3Q4O A;  3AF9 X;  1EUM A;  5CZU A;  4RC5 B;  4M34 A;  1H96 A;  3F32 A;  5GU3 X;  2CHI A;  3KA4 A;  4XKS A;  3E6R A;  2V8T A;  1IER A;  3F33 A;  4LPJ A;  4ZTT A;  5JKM A;  2Y3Q A;  3Q4Q A;  3WVU A;  5E2D A;  3QHB A;  5HJH A;  4WJG 4;  2Z5Q A;  2C6R A;  3QD8 A;  5JDO A;  5FFC A;  3KDQ A;  3A68 A;  3NP0 X;  4KXR B;  3SHX A;  2FKZ A;  1JIG A;  4TOC A;  5FFA A;  1QGH A;  3WNW A;  3RBC A;  4M33 A;  4QUW A;  3UNO A;  4RC8 A;  5ERK A;  4ZL6 A;  2CLU A;  3GGY A;  4RC6 B;  3R2M A;  1B71 A;  3FSE A;  4IWJ A;  2PYB A;  3W54 A;  1XZ1 A;  2V2M A;  3V3K B;  4R42 A;  1KRQ A;  4MN9 A;  5J9V A;  1RCC A;  1N1Q A;  3BVI A;  5J8S A;  3VNX A;  5D8Q A;  3BVF A;  2CEI A;  3PW8 A;  1L8I A;  1JI5 A;  1RCE A;  2CIH A;  1O9I A;  3UOI A;  4CVR A;  4LQJ A;  4CYB A;  3MPS A;  2F7N A;  1O9R A;  1JRE A;  3FVB A;  4TOA A;  4CVT A;  3E2C A;  2XJM A;  3BVK A;  4M32 A;  3PVY B;  1RCG A;  3L0M A;  3WVW A;  2OH3 A;  4TOE A;  3RAV A;  3PWQ C;  3R2R A;  2GYQ A;  3QVD A;  4LQH A;  3GHQ A;  3JZA B;  1TKP A;  3IQ1 A;  3SH6 A;  1F33 A;  3R2S A;  1GWG A;  4LYX A;  4Y08 A;  5LBH A;  5JAC A;  2V8U A;  4W4L B;  5LG2 A;  2JD6 0;  4XKT A;  1TJO A;  4TW3 A;  3O7S A;  1R03 A;  5D8S A;  3Q4N A;  5HQO A;  3KA9 A;  4XKU A;  3FRR A;  2YJJ A;  3TA8 A;  3E1N A;  4DYY A;  4KVQ A;  4CVS A;  5E1U A;  5D8Y A;  2ITB A;  4M35 A;  3BVL A;  3VV9 A;  3BT5 A;  4LPM A;  1YUX A;  5JKM G;  4EVD A;  2HR5 A;  1NF6 A;  4AM4 A;  3IS7 A;  4LYU A;  4DAS A;  4DYZ A;  2FG4 A;  4KVS A;  4PG1 A;  5FEJ A;  4ETR A;  4TOG A;  1SOF A;  1S2Z A;  2N02 A;  4ZLW A;  2GYD A;  3PVR B;  2CN7 A;  2C2F A;  3H7G A;  3RE7 A;  4AM2 A;  3D19 A;  1Z4A A;  2V2O A;  2ZG9 X;  4P18 A;  2CHP A;  5GOU A;  4E6K A;  2YW7 A;  1OTK A;  3GVY A;  1DPS A;  3E6S A;  4ITW A;  3KX9 A;  5I4J A;  4ZKW A;  2ZA7 A;  2D5K A;  3HIU A;  3SE1 A;  5J8W A;  2YJK A;  1RCD A;  2V2N A;  4XGS A;  1HRS A;  1LKM A;  2FG8 A;  3E1L A;  1QYB A;  2UX1 A;  3GE4 A;  2Z5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...