4ZL5A

Crystal structure of the pmftn variant e44h soaked in iron (45 min)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
158
structure length
157
Chain Sequence
SEELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAHSAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin
publication title A Diatom Ferritin Optimized for Iron Oxidation but Not Iron Storage.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
total genus 72
structure length 157
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4zl5A00
3SHXA 1LKMA 5HJFA 1JTSA 3FVBA 1JKUA 4EVCA 4XKTA 5D8RA 2FFXJ 3BVEA 4RC7A 4II4B 2FJCA 3E1LA 2BK6A 4LPJA 5I4JA 4TOCA 2W0OA 4CMYV 1TKPA 2V2PA 2Z6MA 3E6RA 2YW6A 3GHQA 1O9IA 4ITTA 2JD80 4LPNA 4IXKA 2XKQA 4KVSA 3E1OA 3AJPA 4TOBA 2V2NA 2X170 3SIDA 1FHAA 3UOFA 1RCEA 3BVKA 3FSEA 4RC5A 5FFCA 2WLUA 3F38A 1UMNA 1TKOA 2Y3QA 1RYTA 2CN7A 4LQVA 4TOGA 4U3GA 2UX1A 2ZA6A 1L8HA 2V2IA 4DE6A 3BVLA 1HRSA 4MUDA 5FFAA 2BKCA 3VNXA 1Z6OA 3H7GA 1S30A 1YUZA 4YKHA 3UNOA 4AM5A 1XZ1A 3A9QA 3GE4A 1JI4A 4TOFA 1OTKA 4ISPA 4CYBA 2ZG7X 1LKOA 3KA3A 5FFBA 2FL0A 1R03A 1F33A 3E1NA 3AJQA 5D8XA 4E6KA 5GU0X 1XZ3A 2XJMA 3Q4RA 4R42A 3PW8C 4DASA 4TW3A 4QUWA 4ZKWA 5GN8B 1JKVA 2CLUA 3PWFA 2RBDA 3QB9A 4LQHA 1Z4AA 4ZKXA 3RBCA 1S3QA 4TOEA 4ITWA 1NFVA 4ZL6A 3PVTA 3TA8A 5GU1X 4M33A 2ZG9X 3T9JA 5E1UA 4EVDA 4CVPA 3E1QA 2JD70 1JYBA 3EZ0A 1DPSA 3IS8A 1NF4A 1VEQA 2V15A 3HIUA 3R2MA 5FEJA 3WVWA 3BVFA 3WVVA 5IX6A 4ZLWA 4DZ0A 5K52A 2GYQA 4ZMCA 2VZBA 3KX9A 2ZA7A 2HTNA 2GS4A 1O9RA 1RCCA 3QHBA 4M34A 3E6SA 1GWGA 4LYXA 4MY7A 3O7SA 3R2RA 5J8SA 4PG1A 3E1JA 2CF7A 4II4A 2XJOA 4TO9A 4ERUA 4CVTA 2Z5RA 5JACA 2CLBA 3EZUA 4Z3BA 3PVYB 4DYZA 2F7NA 3ISEA 5GU3X 4DYUA 1SQ3A 3NP0X 4CVSA 2V2JA 3PVRA 1QYBA 3OGHA 4MJYA 4XKUA 4RC6B 1JI5A 2Z90A 2HR5A 2WLAA 3RGDA 2YJKA 3AF7X 3A68A 3Q4OA 4ZJKA 3AK9A 1NNQA 2QQYA 3FI6A 4IWJA 1BG7A 1JREA 4ML5A 3QHCA 1H96A 3E1PA 3F36A 3F39A 2YW7A 1F30A 1SOFA 1YUXA 3PW1B 5GOUA 2FZFA 2IY4A 1RCIA 1JGCA 4DI0A 3Q4QA 4Z5SA 1AEWA 4LQJA 4XKSA 2ZA8A 3MPSA 4ZL5A 2C2FA 4Y08A 5JKMA 3NP2X 3R2LA 1TJOA 3HL1A 1MFRA 3KA8A 3ISFA 2V2RA 4MKUA 1ZS3A 1LKPA 1ZUJA 5K53A 3RAVA 4DYXA 4XGSA 3PWQC 3PW8A 4RC8A 3F35A 3E2CA 5E2DA 2BJYA 3BKNA 3Q4NA 5GN8A 5JKMG 1VEIA 5JKLA 5GU2X 4LQNA 5LG2A 5J93A 1IERA 5D8SA 2CHIA 2Z5PA 5HJHA 4CVRA 2ITBA 3PVTB 4PG0A 2CEIA 2CHPA 2V2SA 3OJ5A 4M32A 2JD60 5HQOA 5D8QA 4EVEA 1MOJA 1DATA 2XJNA 5J8WA 3F37A 2CIHA 4TODA 5JKLG 1NF6A 3E1MA 4ZTTA 4PGKA 3EGMA 5LBHA 2OH3A 2XGWA 2WTLA 1VLGA 2OC5A 2PYBA 1VJXA 1KRQA 4CYAA 3QD8A 4RC7B 5C6FA 3SE1A 2C41A 3NOZX 1BFRA 2QF9A 3AJOA 5CMQA 3RE7A 1TK6A 4AM2A 3ERZA 3F34A 4P18A 2V2LA 5LS9A 5CMRA 4TOAA 1JIGA 2C2UA 1RCGA 3KA4A 2FKZA 3PVYA 3AF8X 3F32A 3IQ1A 3UOIA 2ZG8X 2FHAA 4RC5B 5ERKA 1Z6OM 4LPMA 3RD0A 3PVRB 5D8PA 1IESA 4RC6A 2CN6A 2C2JA 5D8YA 1VELA 1UVHA 4MN9A 5CZUA 3QZ3A 1QGHA 1L8IA 1S2ZA 2V2OA 5FFEA 4KVRA 3KWOA 2V2MA 4DYYA 3PW1A 3R2OA 2ZURX 3AF9X 4OYNA 3R2KA 3R2SA 4M35A 5D8OA 3WVUA 2IB0A 4ZKHA 3BVIA 1RCDA 1YV1A 3F33A 3KA9A 3ES3A 3WNWA 3KXUA 3QVDA 2VXIA 3PWQA 4KVQA 2YJJA 4CMYA 1LB3A 2IU2A 2VXXA 5LG8A 1N1QA 2BW1A 3GVYA 2FG4A 4CY9A 3AK8A 4IWKA 1B71A 1BCFA 3PZAA 3KA6A 2D5KA 4ISMA 1DVBA 4EVBA 3U90A 2G4HA 3SH6A 3R2HA 5ERJA 1EUMA 5J9VA 4TOHA 3O7RA 1J30A 4ETRA 5FFDA 3IS7A 4REUA 2FG8A 4AM4A 3BT5A 4LYUA 2GYDA 4PGIA 4A25A 2C6RA 5AXSA 2Z5QA
chains in the Genus database with same CATH superfamily
3SHXA 1LKMA 5HJFA 1JTSA 3FVBA 1JKUA 4EVCA 4XKTA 5D8RA 2FFXJ 2CWLA 3BVEA 4RC7A 4II4B 2FJCA 3E1LA 2BK6A 4YVZA 4LPJA 5I4JA 4TOCA 2W0OA 4CMYV 1TKPA 2V2PA 2Z6MA 3E6RA 2YW6A 3GHQA 1O9IA 4ITTA 2JD80 4LPNA 4IXKA 2XKQA 4KVSA 2V8UA 3E1OA 3AJPA 4TOBA 2V2NA 2X170 3SIDA 1FHAA 3UOFA 1RCEA 3BVKA 3FSEA 3D19A 4RC5A 5FFCA 2WLUA 3F38A 1UMNA 1TKOA 2Y3QA 1RYTA 2CN7A 4LQVA 4TOGA 4U3GA 2UX1A 2ZA6A 1L8HA 2V2IA 4DE6A 3BVLA 1HRSA 4MUDA 5FFAA 2BKCA 3VNXA 1Z6OA 3H7GA 1S30A 1YUZA 4YKHA 3UNOA 4AM5A 1XZ1A 3A9QA 3GE4A 1JI4A 4TOFA 1OTKA 3FRRA 4ISPA 3JZ9A 4CYBA 2ZG7X 1LKOA 3KA3A 5FFBA 2FL0A 1R03A 4E40A 1F33A 3E1NA 3AJQA 5D8XA 4E6KA 5GU0X 1XZ3A 2XJMA 3Q4RA 4R42A 2G38B 3PW8C 4DASA 4TW3A 4QUWA 4ZKWA 5GN8B 1JKVA 2CLUA 3PWFA 2RBDA 3QB9A 1Z4AA 4LQHA 4ZKXA 5JDOB 2MGYA 3RBCA 1S3QA 4TOEA 4ITWA 1NFVA 4ZL6A 3PVTA 3TA8A 5GU1X 4M33A 2ZG9X 3T9JA 5E1UA 4EVDA 4CVPA 3E1QA 2JD70 1JYBA 3EZ0A 1DPSA 3IS8A 1NF4A 1VEQA 2V15A 3HIUA 3R2MA 5FEJA 3WVWA 3BVFA 3WVVA 5IX6A 4ZLWA 4DZ0A 5K52A 2GYQA 2Y44A 4ZMCA 2VZBA 3KX9A 2ZA7A 2HTNA 2GS4A 1O9RA 1RCCA 3QHBA 4M34A 3E6SA 1GWGA 4LYXA 3GGZA 4MY7A 3O7SA 3R2RA 5J8SA 4PG1A 3E1JA 2CF7A 4II4A 2XJOA 4TO9A 4ERUA 4CVTA 2Z5RA 5JACA 2N02A 3DBYA 2CLBA 4YXMA 3W54A 3EZUA 4Z3BA 3PVYB 3UFBA 4DYZA 2F7NA 3ISEA 5GU3X 4DYUA 1SQ3A 3NP0X 4CVSA 2V2JA 3PVRA 1QYBA 3OGHA 4MJYA 4XKUA 4RC6B 1JI5A 2Z90A 2HR5A 2WLAA 3RGDA 2YJKA 3AF7X 3A68A 3Q4OA 4ZJKA 3AK9A 1NNQA 2QQYA 3FI6A 4IWJA 1BG7A 1JREA 4ML5A 3QHCA 1H96A 3E1PA 3F36A 3F39A 2YW7A 1F30A 1SOFA 1YUXA 3PW1B 5GOUA 2FZFA 2IY4A 4X0JA 1RCIA 1JGCA 4DI0A 3Q4QA 2V8TA 4Z5SA 1AEWA 4LQJA 3N6OA 2ZA8A 4XKSA 3MPSA 4ZL5A 2C2FA 3C23A 3KHKA 4Y08A 5JKMA 3NP2X 3KDQA 3R2LA 1TJOA 2OKCA 3C21A 3HL1A 1MFRA 3KA8A 3ISFA 2V2RA 4MKUA 1ZS3A 1LKPA 1ZUJA 5K53A 3RAVA 4DYXA 4XGSA 3PWQC 3PW8A 4RC8A 3L0MA 3F35A 3E2CA 5E2DA 2BJYA 3BKNA 3Q4NA 5GN8A 5JKMG 1VEIA 5JKLA 5GU2X 4LQNA 5LG2A 5HU6D 1IERA 5J93A 5JDOA 5D8SA 2CHIA 3GGYA 2Z5PA 5HJHA 4CVRA 2ITBA 3PVTB 4PG0A 2CEIA 2CHPA 2V2SA 3OJ5A 4M32A 2JD60 5HQOA 5D8QA 4EVEA 1MOJA 1DATA 2XJNA 5J8WA 3F37A 2CIHA 4TODA 5JKLG 1NF6A 3E1MA 4ZTTA 4PGKA 3EGMA 5LBHA 2OH3A 3VV9A 2XGWA 2WTLA 1VLGA 2OC5A 2PYBA 3M6JA 1VJXA 1KRQA 4MXPA 4CYAA 3QD8A 4RC7B 5C6FA 3SE1A 2C41A 3VVAA 3NOZX 1BFRA 2QF9A 3AJOA 5CMQA 3RE7A 1TK6A 4AM2A 3ERZA 3F34A 4P18A 2V2LA 3FRSA 5LS9A 5CMRA 4TOAA 1JIGA 2C2UA 1RCGA 3KA4A 2FKZA 3PVYA 4KXRB 3AF8X 3F32A 3IQ1A 3UOIA 2WWXB 2ZG8X 2FHAA 4RC5B 5ERKA 1Z6OM 4LPMA 3RD0A 3PVRB 5D8PA 1IESA 4RC6A 2CN6A 2C2JA 5D8YA 1VELA 1UVHA 4MN9A 5CZUA 3QZ3A 1QGHA 1L8IA 1S2ZA 2V2OA 5FFEA 4KVRA 3KWOA 3LKDA 2V2MA 4DYYA 3PW1A 3R2OA 2ZURX 3V3KB 3AF9X 4OYNA 3R2KA 3R2SA 4M35A 5D8OA 3WVUA 2IB0A 4ZKHA 3BVIA 2AR0A 1RCDA 1YV1A 4W4KB 3F33A 3KA9A 4W4LB 3ES3A 3WNWA 3JZAB 3KXUA 3QVDA 2VXIA 3PWQA 4KVQA 2YJJA 4CMYA 1LB3A 2IU2A 2VXXA 5LG8A 1N1QA 2BW1A 3GVYA 2FG4A 4CY9A 3AK8A 4IWKA 1B71A 1BCFA 3PZAA 3KA6A 2D5KA 4ISMA 1DVBA 4EVBA 3U90A 2G4HA 3SH6A 3R2HA 3C1ZA 5ERJA 1EUMA 5J9VA 4TOHA 4WJG4 3O7RA 1J30A 4ETRA 5FFDA 3IS7A 4YXJA 4REUA 2FG8A 4AM4A 3BT5A 4LYUA 2GYDA 4PGIA 4A25A 2C6RA 5AXSA 3C1YA 2Z5QA
chains in the Genus database with same CATH topology
3SHXA 1LKMA 5HJFA 1JTSA 3FVBA 1JKUA 4EVCA 4XKTA 5D8RA 2FFXJ 2CWLA 3BVEA 4RC7A 4II4B 2FJCA 3E1LA 2BK6A 4YVZA 4LPJA 5I4JA 4TOCA 2W0OA 4CMYV 1TKPA 2V2PA 2Z6MA 3E6RA 2YW6A 3GHQA 1O9IA 4ITTA 2JD80 4LPNA 4IXKA 2XKQA 4KVSA 2V8UA 3E1OA 3AJPA 4TOBA 2V2NA 2X170 3SIDA 1FHAA 3UOFA 1RCEA 3BVKA 3FSEA 3D19A 4RC5A 5FFCA 2WLUA 3F38A 1UMNA 1TKOA 2Y3QA 1RYTA 2CN7A 4LQVA 4TOGA 4U3GA 2UX1A 2ZA6A 1L8HA 2V2IA 4DE6A 3BVLA 1HRSA 4MUDA 5FFAA 2BKCA 3VNXA 1Z6OA 3H7GA 1S30A 1YUZA 4YKHA 3UNOA 4AM5A 1XZ1A 3A9QA 3GE4A 1JI4A 4TOFA 1OTKA 3FRRA 4ISPA 3JZ9A 4CYBA 2ZG7X 1LKOA 3KA3A 5FFBA 2FL0A 1R03A 4E40A 1F33A 3E1NA 3AJQA 5D8XA 4E6KA 5GU0X 1XZ3A 2XJMA 3Q4RA 4R42A 2G38B 3PW8C 4DASA 4TW3A 4QUWA 4ZKWA 5GN8B 1JKVA 2CLUA 3PWFA 2RBDA 3QB9A 1Z4AA 4LQHA 4ZKXA 5JDOB 2MGYA 3RBCA 1S3QA 4TOEA 4ITWA 1NFVA 4ZL6A 3PVTA 3TA8A 5GU1X 4M33A 2ZG9X 3T9JA 5E1UA 4EVDA 4CVPA 3E1QA 2JD70 1JYBA 3EZ0A 1DPSA 3IS8A 1NF4A 1VEQA 2V15A 3HIUA 3R2MA 5FEJA 3WVWA 3BVFA 3WVVA 5IX6A 4ZLWA 4DZ0A 5K52A 2GYQA 2Y44A 4ZMCA 2VZBA 3KX9A 2ZA7A 2HTNA 2GS4A 1O9RA 1RCCA 3QHBA 4M34A 3E6SA 1GWGA 4LYXA 3GGZA 4MY7A 3O7SA 3R2RA 5J8SA 4PG1A 3E1JA 2CF7A 4II4A 2XJOA 4TO9A 4ERUA 4CVTA 2Z5RA 5JACA 2N02A 3DBYA 2CLBA 4YXMA 3W54A 3EZUA 4Z3BA 3PVYB 3UFBA 4DYZA 2F7NA 3ISEA 5GU3X 4DYUA 1SQ3A 3NP0X 4CVSA 2V2JA 3PVRA 1QYBA 3OGHA 4MJYA 4XKUA 4RC6B 1JI5A 2Z90A 2HR5A 2WLAA 3RGDA 2YJKA 3AF7X 3A68A 3Q4OA 4ZJKA 3AK9A 1NNQA 2QQYA 3FI6A 4IWJA 1BG7A 1JREA 4ML5A 3QHCA 1H96A 3E1PA 3F36A 3F39A 2YW7A 1F30A 1SOFA 1YUXA 3PW1B 5GOUA 2FZFA 2IY4A 4X0JA 1RCIA 1JGCA 4DI0A 3Q4QA 2V8TA 4Z5SA 1AEWA 4LQJA 3N6OA 2ZA8A 4XKSA 3MPSA 4ZL5A 2C2FA 3C23A 3KHKA 4Y08A 5JKMA 3NP2X 3KDQA 3R2LA 1TJOA 2OKCA 3C21A 3HL1A 1MFRA 3KA8A 3ISFA 2V2RA 4MKUA 1ZS3A 1LKPA 1ZUJA 5K53A 3RAVA 4DYXA 4XGSA 3PWQC 3PW8A 4RC8A 3L0MA 3F35A 3E2CA 5E2DA 2BJYA 3BKNA 3Q4NA 5GN8A 5JKMG 1VEIA 5JKLA 5GU2X 4LQNA 5LG2A 5HU6D 1IERA 5J93A 5JDOA 5D8SA 2CHIA 3GGYA 2Z5PA 5HJHA 4CVRA 2ITBA 3PVTB 4PG0A 2CEIA 2CHPA 2V2SA 3OJ5A 4M32A 2JD60 5HQOA 5D8QA 4EVEA 1MOJA 1DATA 2XJNA 5J8WA 3F37A 2CIHA 4TODA 5JKLG 1NF6A 3E1MA 4ZTTA 4PGKA 3EGMA 5LBHA 2OH3A 3VV9A 2XGWA 2WTLA 1VLGA 2OC5A 2PYBA 3M6JA 1VJXA 1KRQA 4MXPA 4CYAA 3QD8A 4RC7B 5C6FA 3SE1A 2C41A 3VVAA 3NOZX 1BFRA 2QF9A 3AJOA 5CMQA 3RE7A 1TK6A 4AM2A 3ERZA 3F34A 4P18A 2V2LA 3FRSA 5LS9A 5CMRA 4TOAA 1JIGA 2C2UA 1RCGA 3KA4A 2FKZA 3PVYA 4KXRB 3AF8X 3F32A 3IQ1A 3UOIA 2WWXB 2ZG8X 2FHAA 4RC5B 5ERKA 1Z6OM 4LPMA 3RD0A 3PVRB 5D8PA 1IESA 4RC6A 2CN6A 2C2JA 5D8YA 1VELA 1UVHA 4MN9A 5CZUA 3QZ3A 1QGHA 1L8IA 1S2ZA 2V2OA 5FFEA 4KVRA 3KWOA 3LKDA 2V2MA 4DYYA 3PW1A 3R2OA 2ZURX 3V3KB 3AF9X 4OYNA 3R2KA 3R2SA 4M35A 5D8OA 3WVUA 2IB0A 4ZKHA 3BVIA 2AR0A 1RCDA 1YV1A 4W4KB 3F33A 3KA9A 4W4LB 3ES3A 3WNWA 3JZAB 3KXUA 3QVDA 2VXIA 3PWQA 4KVQA 2YJJA 4CMYA 1LB3A 2IU2A 2VXXA 5LG8A 1N1QA 2BW1A 3GVYA 2FG4A 4CY9A 3AK8A 4IWKA 1B71A 1BCFA 3PZAA 3KA6A 2D5KA 4ISMA 1DVBA 4EVBA 3U90A 2G4HA 3SH6A 3R2HA 3C1ZA 5ERJA 1EUMA 5J9VA 4TOHA 4WJG4 3O7RA 1J30A 4ETRA 5FFDA 3IS7A 4YXJA 4REUA 2FG8A 4AM4A 3BT5A 4LYUA 2GYDA 4PGIA 4A25A 2C6RA 5AXSA 3C1YA 2Z5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHX A;  1LKM A;  5HJF A;  1JTS A;  3FVB A;  1JKU A;  4EVC A;  4XKT A;  5D8R A;  2FFX J;  3BVE A;  4RC7 A;  4II4 B;  2FJC A;  3E1L A;  2BK6 A;  4LPJ A;  5I4J A;  4TOC A;  2W0O A;  4CMY V;  1TKP A;  2V2P A;  2Z6M A;  3E6R A;  2YW6 A;  3GHQ A;  1O9I A;  4ITT A;  2JD8 0;  4LPN A;  4IXK A;  2XKQ A;  4KVS A;  3E1O A;  3AJP A;  4TOB A;  2V2N A;  2X17 0;  3SID A;  1FHA A;  3UOF A;  1RCE A;  3BVK A;  3FSE A;  4RC5 A;  5FFC A;  2WLU A;  3F38 A;  1UMN A;  1TKO A;  2Y3Q A;  1RYT A;  2CN7 A;  4LQV A;  4TOG A;  4U3G A;  2UX1 A;  2ZA6 A;  1L8H A;  2V2I A;  4DE6 A;  3BVL A;  1HRS A;  4MUD A;  5FFA A;  2BKC A;  3VNX A;  1Z6O A;  3H7G A;  1S30 A;  1YUZ A;  4YKH A;  3UNO A;  4AM5 A;  1XZ1 A;  3A9Q A;  3GE4 A;  1JI4 A;  4TOF A;  1OTK A;  4ISP A;  4CYB A;  2ZG7 X;  1LKO A;  3KA3 A;  5FFB A;  2FL0 A;  1R03 A;  1F33 A;  3E1N A;  3AJQ A;  5D8X A;  4E6K A;  5GU0 X;  1XZ3 A;  2XJM A;  3Q4R A;  4R42 A;  3PW8 C;  4DAS A;  4TW3 A;  4QUW A;  4ZKW A;  5GN8 B;  1JKV A;  2CLU A;  3PWF A;  2RBD A;  3QB9 A;  4LQH A;  1Z4A A;  4ZKX A;  3RBC A;  1S3Q A;  4TOE A;  4ITW A;  1NFV A;  4ZL6 A;  3PVT A;  3TA8 A;  5GU1 X;  4M33 A;  2ZG9 X;  3T9J A;  5E1U A;  4EVD A;  4CVP A;  3E1Q A;  2JD7 0;  1JYB A;  3EZ0 A;  1DPS A;  3IS8 A;  1NF4 A;  1VEQ A;  2V15 A;  3HIU A;  3R2M A;  5FEJ A;  3WVW A;  3BVF A;  3WVV A;  5IX6 A;  4ZLW A;  4DZ0 A;  5K52 A;  2GYQ A;  4ZMC A;  2VZB A;  3KX9 A;  2ZA7 A;  2HTN A;  2GS4 A;  1O9R A;  1RCC A;  3QHB A;  4M34 A;  3E6S A;  1GWG A;  4LYX A;  4MY7 A;  3O7S A;  3R2R A;  5J8S A;  4PG1 A;  3E1J A;  2CF7 A;  4II4 A;  2XJO A;  4TO9 A;  4ERU A;  4CVT A;  2Z5R A;  5JAC A;  2CLB A;  3EZU A;  4Z3B A;  3PVY B;  4DYZ A;  2F7N A;  3ISE A;  5GU3 X;  4DYU A;  1SQ3 A;  3NP0 X;  4CVS A;  2V2J A;  3PVR A;  1QYB A;  3OGH A;  4MJY A;  4XKU A;  4RC6 B;  1JI5 A;  2Z90 A;  2HR5 A;  2WLA A;  3RGD A;  2YJK A;  3AF7 X;  3A68 A;  3Q4O A;  4ZJK A;  3AK9 A;  1NNQ A;  2QQY A;  3FI6 A;  4IWJ A;  1BG7 A;  1JRE A;  4ML5 A;  3QHC A;  1H96 A;  3E1P A;  3F36 A;  3F39 A;  2YW7 A;  1F30 A;  1SOF A;  1YUX A;  3PW1 B;  5GOU A;  2FZF A;  2IY4 A;  1RCI A;  1JGC A;  4DI0 A;  3Q4Q A;  4Z5S A;  1AEW A;  4LQJ A;  4XKS A;  2ZA8 A;  3MPS A;  4ZL5 A;  2C2F A;  4Y08 A;  5JKM A;  3NP2 X;  3R2L A;  1TJO A;  3HL1 A;  1MFR A;  3KA8 A;  3ISF A;  2V2R A;  4MKU A;  1ZS3 A;  1LKP A;  1ZUJ A;  5K53 A;  3RAV A;  4DYX A;  4XGS A;  3PWQ C;  3PW8 A;  4RC8 A;  3F35 A;  3E2C A;  5E2D A;  2BJY A;  3BKN A;  3Q4N A;  5GN8 A;  5JKM G;  1VEI A;  5JKL A;  5GU2 X;  4LQN A;  5LG2 A;  5J93 A;  1IER A;  5D8S A;  2CHI A;  2Z5P A;  5HJH A;  4CVR A;  2ITB A;  3PVT B;  4PG0 A;  2CEI A;  2CHP A;  2V2S A;  3OJ5 A;  4M32 A;  2JD6 0;  5HQO A;  5D8Q A;  4EVE A;  1MOJ A;  1DAT A;  2XJN A;  5J8W A;  3F37 A;  2CIH A;  4TOD A;  5JKL G;  1NF6 A;  3E1M A;  4ZTT A;  4PGK A;  3EGM A;  5LBH A;  2OH3 A;  2XGW A;  2WTL A;  1VLG A;  2OC5 A;  2PYB A;  1VJX A;  1KRQ A;  4CYA A;  3QD8 A;  4RC7 B;  5C6F A;  3SE1 A;  2C41 A;  3NOZ X;  1BFR A;  2QF9 A;  3AJO A;  5CMQ A;  3RE7 A;  1TK6 A;  4AM2 A;  3ERZ A;  3F34 A;  4P18 A;  2V2L A;  5LS9 A;  5CMR A;  4TOA A;  1JIG A;  2C2U A;  1RCG A;  3KA4 A;  2FKZ A;  3PVY A;  3AF8 X;  3F32 A;  3IQ1 A;  3UOI A;  2ZG8 X;  2FHA A;  4RC5 B;  5ERK A;  1Z6O M;  4LPM A;  3RD0 A;  3PVR B;  5D8P A;  1IES A;  4RC6 A;  2CN6 A;  2C2J A;  5D8Y A;  1VEL A;  1UVH A;  4MN9 A;  5CZU A;  3QZ3 A;  1QGH A;  1L8I A;  1S2Z A;  2V2O A;  5FFE A;  4KVR A;  3KWO A;  2V2M A;  4DYY A;  3PW1 A;  3R2O A;  2ZUR X;  3AF9 X;  4OYN A;  3R2K A;  3R2S A;  4M35 A;  5D8O A;  3WVU A;  2IB0 A;  4ZKH A;  3BVI A;  1RCD A;  1YV1 A;  3F33 A;  3KA9 A;  3ES3 A;  3WNW A;  3KXU A;  3QVD A;  2VXI A;  3PWQ A;  4KVQ A;  2YJJ A;  4CMY A;  1LB3 A;  2IU2 A;  2VXX A;  5LG8 A;  1N1Q A;  2BW1 A;  3GVY A;  2FG4 A;  4CY9 A;  3AK8 A;  4IWK A;  1B71 A;  1BCF A;  3PZA A;  3KA6 A;  2D5K A;  4ISM A;  1DVB A;  4EVB A;  3U90 A;  2G4H A;  3SH6 A;  3R2H A;  5ERJ A;  1EUM A;  5J9V A;  4TOH A;  3O7R A;  1J30 A;  4ETR A;  5FFD A;  3IS7 A;  4REU A;  2FG8 A;  4AM4 A;  3BT5 A;  4LYU A;  2GYD A;  4PGI A;  4A25 A;  2C6R A;  5AXS A;  2Z5Q A; 
#chains in the Genus database with same CATH topology
 3SHX A;  1LKM A;  5HJF A;  1JTS A;  3FVB A;  1JKU A;  4EVC A;  4XKT A;  5D8R A;  2FFX J;  2CWL A;  3BVE A;  4RC7 A;  4II4 B;  2FJC A;  3E1L A;  2BK6 A;  4YVZ A;  4LPJ A;  5I4J A;  4TOC A;  2W0O A;  4CMY V;  1TKP A;  2V2P A;  2Z6M A;  3E6R A;  2YW6 A;  3GHQ A;  1O9I A;  4ITT A;  2JD8 0;  4LPN A;  4IXK A;  2XKQ A;  4KVS A;  2V8U A;  3E1O A;  3AJP A;  4TOB A;  2V2N A;  2X17 0;  3SID A;  1FHA A;  3UOF A;  1RCE A;  3BVK A;  3FSE A;  3D19 A;  4RC5 A;  5FFC A;  2WLU A;  3F38 A;  1UMN A;  1TKO A;  2Y3Q A;  1RYT A;  2CN7 A;  4LQV A;  4TOG A;  4U3G A;  2UX1 A;  2ZA6 A;  1L8H A;  2V2I A;  4DE6 A;  3BVL A;  1HRS A;  4MUD A;  5FFA A;  2BKC A;  3VNX A;  1Z6O A;  3H7G A;  1S30 A;  1YUZ A;  4YKH A;  3UNO A;  4AM5 A;  1XZ1 A;  3A9Q A;  3GE4 A;  1JI4 A;  4TOF A;  1OTK A;  3FRR A;  4ISP A;  3JZ9 A;  4CYB A;  2ZG7 X;  1LKO A;  3KA3 A;  5FFB A;  2FL0 A;  1R03 A;  4E40 A;  1F33 A;  3E1N A;  3AJQ A;  5D8X A;  4E6K A;  5GU0 X;  1XZ3 A;  2XJM A;  3Q4R A;  4R42 A;  2G38 B;  3PW8 C;  4DAS A;  4TW3 A;  4QUW A;  4ZKW A;  5GN8 B;  1JKV A;  2CLU A;  3PWF A;  2RBD A;  3QB9 A;  1Z4A A;  4LQH A;  4ZKX A;  5JDO B;  2MGY A;  3RBC A;  1S3Q A;  4TOE A;  4ITW A;  1NFV A;  4ZL6 A;  3PVT A;  3TA8 A;  5GU1 X;  4M33 A;  2ZG9 X;  3T9J A;  5E1U A;  4EVD A;  4CVP A;  3E1Q A;  2JD7 0;  1JYB A;  3EZ0 A;  1DPS A;  3IS8 A;  1NF4 A;  1VEQ A;  2V15 A;  3HIU A;  3R2M A;  5FEJ A;  3WVW A;  3BVF A;  3WVV A;  5IX6 A;  4ZLW A;  4DZ0 A;  5K52 A;  2GYQ A;  2Y44 A;  4ZMC A;  2VZB A;  3KX9 A;  2ZA7 A;  2HTN A;  2GS4 A;  1O9R A;  1RCC A;  3QHB A;  4M34 A;  3E6S A;  1GWG A;  4LYX A;  3GGZ A;  4MY7 A;  3O7S A;  3R2R A;  5J8S A;  4PG1 A;  3E1J A;  2CF7 A;  4II4 A;  2XJO A;  4TO9 A;  4ERU A;  4CVT A;  2Z5R A;  5JAC A;  2N02 A;  3DBY A;  2CLB A;  4YXM A;  3W54 A;  3EZU A;  4Z3B A;  3PVY B;  3UFB A;  4DYZ A;  2F7N A;  3ISE A;  5GU3 X;  4DYU A;  1SQ3 A;  3NP0 X;  4CVS A;  2V2J A;  3PVR A;  1QYB A;  3OGH A;  4MJY A;  4XKU A;  4RC6 B;  1JI5 A;  2Z90 A;  2HR5 A;  2WLA A;  3RGD A;  2YJK A;  3AF7 X;  3A68 A;  3Q4O A;  4ZJK A;  3AK9 A;  1NNQ A;  2QQY A;  3FI6 A;  4IWJ A;  1BG7 A;  1JRE A;  4ML5 A;  3QHC A;  1H96 A;  3E1P A;  3F36 A;  3F39 A;  2YW7 A;  1F30 A;  1SOF A;  1YUX A;  3PW1 B;  5GOU A;  2FZF A;  2IY4 A;  4X0J A;  1RCI A;  1JGC A;  4DI0 A;  3Q4Q A;  2V8T A;  4Z5S A;  1AEW A;  4LQJ A;  3N6O A;  2ZA8 A;  4XKS A;  3MPS A;  4ZL5 A;  2C2F A;  3C23 A;  3KHK A;  4Y08 A;  5JKM A;  3NP2 X;  3KDQ A;  3R2L A;  1TJO A;  2OKC A;  3C21 A;  3HL1 A;  1MFR A;  3KA8 A;  3ISF A;  2V2R A;  4MKU A;  1ZS3 A;  1LKP A;  1ZUJ A;  5K53 A;  3RAV A;  4DYX A;  4XGS A;  3PWQ C;  3PW8 A;  4RC8 A;  3L0M A;  3F35 A;  3E2C A;  5E2D A;  2BJY A;  3BKN A;  3Q4N A;  5GN8 A;  5JKM G;  1VEI A;  5JKL A;  5GU2 X;  4LQN A;  5LG2 A;  5HU6 D;  1IER A;  5J93 A;  5JDO A;  5D8S A;  2CHI A;  3GGY A;  2Z5P A;  5HJH A;  4CVR A;  2ITB A;  3PVT B;  4PG0 A;  2CEI A;  2CHP A;  2V2S A;  3OJ5 A;  4M32 A;  2JD6 0;  5HQO A;  5D8Q A;  4EVE A;  1MOJ A;  1DAT A;  2XJN A;  5J8W A;  3F37 A;  2CIH A;  4TOD A;  5JKL G;  1NF6 A;  3E1M A;  4ZTT A;  4PGK A;  3EGM A;  5LBH A;  2OH3 A;  3VV9 A;  2XGW A;  2WTL A;  1VLG A;  2OC5 A;  2PYB A;  3M6J A;  1VJX A;  1KRQ A;  4MXP A;  4CYA A;  3QD8 A;  4RC7 B;  5C6F A;  3SE1 A;  2C41 A;  3VVA A;  3NOZ X;  1BFR A;  2QF9 A;  3AJO A;  5CMQ A;  3RE7 A;  1TK6 A;  4AM2 A;  3ERZ A;  3F34 A;  4P18 A;  2V2L A;  3FRS A;  5LS9 A;  5CMR A;  4TOA A;  1JIG A;  2C2U A;  1RCG A;  3KA4 A;  2FKZ A;  3PVY A;  4KXR B;  3AF8 X;  3F32 A;  3IQ1 A;  3UOI A;  2WWX B;  2ZG8 X;  2FHA A;  4RC5 B;  5ERK A;  1Z6O M;  4LPM A;  3RD0 A;  3PVR B;  5D8P A;  1IES A;  4RC6 A;  2CN6 A;  2C2J A;  5D8Y A;  1VEL A;  1UVH A;  4MN9 A;  5CZU A;  3QZ3 A;  1QGH A;  1L8I A;  1S2Z A;  2V2O A;  5FFE A;  4KVR A;  3KWO A;  3LKD A;  2V2M A;  4DYY A;  3PW1 A;  3R2O A;  2ZUR X;  3V3K B;  3AF9 X;  4OYN A;  3R2K A;  3R2S A;  4M35 A;  5D8O A;  3WVU A;  2IB0 A;  4ZKH A;  3BVI A;  2AR0 A;  1RCD A;  1YV1 A;  4W4K B;  3F33 A;  3KA9 A;  4W4L B;  3ES3 A;  3WNW A;  3JZA B;  3KXU A;  3QVD A;  2VXI A;  3PWQ A;  4KVQ A;  2YJJ A;  4CMY A;  1LB3 A;  2IU2 A;  2VXX A;  5LG8 A;  1N1Q A;  2BW1 A;  3GVY A;  2FG4 A;  4CY9 A;  3AK8 A;  4IWK A;  1B71 A;  1BCF A;  3PZA A;  3KA6 A;  2D5K A;  4ISM A;  1DVB A;  4EVB A;  3U90 A;  2G4H A;  3SH6 A;  3R2H A;  3C1Z A;  5ERJ A;  1EUM A;  5J9V A;  4TOH A;  4WJG 4;  3O7R A;  1J30 A;  4ETR A;  5FFD A;  3IS7 A;  4YXJ A;  4REU A;  2FG8 A;  4AM4 A;  3BT5 A;  4LYU A;  2GYD A;  4PGI A;  4A25 A;  2C6R A;  5AXS A;  3C1Y A;  2Z5Q A; 
#chains in the Genus database with same CATH homology
 3SHX A;  1LKM A;  5HJF A;  1JTS A;  3FVB A;  1JKU A;  4EVC A;  4XKT A;  5D8R A;  2FFX J;  2CWL A;  3BVE A;  4RC7 A;  4II4 B;  2FJC A;  3E1L A;  2BK6 A;  4YVZ A;  4LPJ A;  5I4J A;  4TOC A;  2W0O A;  4CMY V;  1TKP A;  2V2P A;  2Z6M A;  3E6R A;  2YW6 A;  3GHQ A;  1O9I A;  4ITT A;  2JD8 0;  4LPN A;  4IXK A;  2XKQ A;  4KVS A;  2V8U A;  3E1O A;  3AJP A;  4TOB A;  2V2N A;  2X17 0;  3SID A;  1FHA A;  3UOF A;  1RCE A;  3BVK A;  3FSE A;  3D19 A;  4RC5 A;  5FFC A;  2WLU A;  3F38 A;  1UMN A;  1TKO A;  2Y3Q A;  1RYT A;  2CN7 A;  4LQV A;  4TOG A;  4U3G A;  2UX1 A;  2ZA6 A;  1L8H A;  2V2I A;  4DE6 A;  3BVL A;  1HRS A;  4MUD A;  5FFA A;  2BKC A;  3VNX A;  1Z6O A;  3H7G A;  1S30 A;  1YUZ A;  4YKH A;  3UNO A;  4AM5 A;  1XZ1 A;  3A9Q A;  3GE4 A;  1JI4 A;  4TOF A;  1OTK A;  3FRR A;  4ISP A;  3JZ9 A;  4CYB A;  2ZG7 X;  1LKO A;  3KA3 A;  5FFB A;  2FL0 A;  1R03 A;  4E40 A;  1F33 A;  3E1N A;  3AJQ A;  5D8X A;  4E6K A;  5GU0 X;  1XZ3 A;  2XJM A;  3Q4R A;  4R42 A;  2G38 B;  3PW8 C;  4DAS A;  4TW3 A;  4QUW A;  4ZKW A;  5GN8 B;  1JKV A;  2CLU A;  3PWF A;  2RBD A;  3QB9 A;  1Z4A A;  4LQH A;  4ZKX A;  5JDO B;  2MGY A;  3RBC A;  1S3Q A;  4TOE A;  4ITW A;  1NFV A;  4ZL6 A;  3PVT A;  3TA8 A;  5GU1 X;  4M33 A;  2ZG9 X;  3T9J A;  5E1U A;  4EVD A;  4CVP A;  3E1Q A;  2JD7 0;  1JYB A;  3EZ0 A;  1DPS A;  3IS8 A;  1NF4 A;  1VEQ A;  2V15 A;  3HIU A;  3R2M A;  5FEJ A;  3WVW A;  3BVF A;  3WVV A;  5IX6 A;  4ZLW A;  4DZ0 A;  5K52 A;  2GYQ A;  2Y44 A;  4ZMC A;  2VZB A;  3KX9 A;  2ZA7 A;  2HTN A;  2GS4 A;  1O9R A;  1RCC A;  3QHB A;  4M34 A;  3E6S A;  1GWG A;  4LYX A;  3GGZ A;  4MY7 A;  3O7S A;  3R2R A;  5J8S A;  4PG1 A;  3E1J A;  2CF7 A;  4II4 A;  2XJO A;  4TO9 A;  4ERU A;  4CVT A;  2Z5R A;  5JAC A;  2N02 A;  3DBY A;  2CLB A;  4YXM A;  3W54 A;  3EZU A;  4Z3B A;  3PVY B;  3UFB A;  4DYZ A;  2F7N A;  3ISE A;  5GU3 X;  4DYU A;  1SQ3 A;  3NP0 X;  4CVS A;  2V2J A;  3PVR A;  1QYB A;  3OGH A;  4MJY A;  4XKU A;  4RC6 B;  1JI5 A;  2Z90 A;  2HR5 A;  2WLA A;  3RGD A;  2YJK A;  3AF7 X;  3A68 A;  3Q4O A;  4ZJK A;  3AK9 A;  1NNQ A;  2QQY A;  3FI6 A;  4IWJ A;  1BG7 A;  1JRE A;  4ML5 A;  3QHC A;  1H96 A;  3E1P A;  3F36 A;  3F39 A;  2YW7 A;  1F30 A;  1SOF A;  1YUX A;  3PW1 B;  5GOU A;  2FZF A;  2IY4 A;  4X0J A;  1RCI A;  1JGC A;  4DI0 A;  3Q4Q A;  2V8T A;  4Z5S A;  1AEW A;  4LQJ A;  3N6O A;  2ZA8 A;  4XKS A;  3MPS A;  4ZL5 A;  2C2F A;  3C23 A;  3KHK A;  4Y08 A;  5JKM A;  3NP2 X;  3KDQ A;  3R2L A;  1TJO A;  2OKC A;  3C21 A;  3HL1 A;  1MFR A;  3KA8 A;  3ISF A;  2V2R A;  4MKU A;  1ZS3 A;  1LKP A;  1ZUJ A;  5K53 A;  3RAV A;  4DYX A;  4XGS A;  3PWQ C;  3PW8 A;  4RC8 A;  3L0M A;  3F35 A;  3E2C A;  5E2D A;  2BJY A;  3BKN A;  3Q4N A;  5GN8 A;  5JKM G;  1VEI A;  5JKL A;  5GU2 X;  4LQN A;  5LG2 A;  5HU6 D;  1IER A;  5J93 A;  5JDO A;  5D8S A;  2CHI A;  3GGY A;  2Z5P A;  5HJH A;  4CVR A;  2ITB A;  3PVT B;  4PG0 A;  2CEI A;  2CHP A;  2V2S A;  3OJ5 A;  4M32 A;  2JD6 0;  5HQO A;  5D8Q A;  4EVE A;  1MOJ A;  1DAT A;  2XJN A;  5J8W A;  3F37 A;  2CIH A;  4TOD A;  5JKL G;  1NF6 A;  3E1M A;  4ZTT A;  4PGK A;  3EGM A;  5LBH A;  2OH3 A;  3VV9 A;  2XGW A;  2WTL A;  1VLG A;  2OC5 A;  2PYB A;  3M6J A;  1VJX A;  1KRQ A;  4MXP A;  4CYA A;  3QD8 A;  4RC7 B;  5C6F A;  3SE1 A;  2C41 A;  3VVA A;  3NOZ X;  1BFR A;  2QF9 A;  3AJO A;  5CMQ A;  3RE7 A;  1TK6 A;  4AM2 A;  3ERZ A;  3F34 A;  4P18 A;  2V2L A;  3FRS A;  5LS9 A;  5CMR A;  4TOA A;  1JIG A;  2C2U A;  1RCG A;  3KA4 A;  2FKZ A;  3PVY A;  4KXR B;  3AF8 X;  3F32 A;  3IQ1 A;  3UOI A;  2WWX B;  2ZG8 X;  2FHA A;  4RC5 B;  5ERK A;  1Z6O M;  4LPM A;  3RD0 A;  3PVR B;  5D8P A;  1IES A;  4RC6 A;  2CN6 A;  2C2J A;  5D8Y A;  1VEL A;  1UVH A;  4MN9 A;  5CZU A;  3QZ3 A;  1QGH A;  1L8I A;  1S2Z A;  2V2O A;  5FFE A;  4KVR A;  3KWO A;  3LKD A;  2V2M A;  4DYY A;  3PW1 A;  3R2O A;  2ZUR X;  3V3K B;  3AF9 X;  4OYN A;  3R2K A;  3R2S A;  4M35 A;  5D8O A;  3WVU A;  2IB0 A;  4ZKH A;  3BVI A;  2AR0 A;  1RCD A;  1YV1 A;  4W4K B;  3F33 A;  3KA9 A;  4W4L B;  3ES3 A;  3WNW A;  3JZA B;  3KXU A;  3QVD A;  2VXI A;  3PWQ A;  4KVQ A;  2YJJ A;  4CMY A;  1LB3 A;  2IU2 A;  2VXX A;  5LG8 A;  1N1Q A;  2BW1 A;  3GVY A;  2FG4 A;  4CY9 A;  3AK8 A;  4IWK A;  1B71 A;  1BCF A;  3PZA A;  3KA6 A;  2D5K A;  4ISM A;  1DVB A;  4EVB A;  3U90 A;  2G4H A;  3SH6 A;  3R2H A;  3C1Z A;  5ERJ A;  1EUM A;  5J9V A;  4TOH A;  4WJG 4;  3O7R A;  1J30 A;  4ETR A;  5FFD A;  3IS7 A;  4YXJ A;  4REU A;  2FG8 A;  4AM4 A;  3BT5 A;  4LYU A;  2GYD A;  4PGI A;  4A25 A;  2C6R A;  5AXS A;  3C1Y A;  2Z5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...