3E1JA

Crystal structure of e. coli bacterioferritin (bfr) with an unoccupied ferroxidase centre (apo-bfr).
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Bacterioferritin
publication title Structural basis for iron mineralization by bacterioferritin
pubmed doi rcsb
source organism Escherichia coli k12
total genus 72
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e1jA00
1DATA 2BW1A 3KA4A 5FFAA 4ML5A 4ISMA 2YJKA 1SOFA 5JACA 3F39A 4DASA 4CMYV 1OTKA 3AK9A 1JI5A 1O9RA 2F7NA 2BJYA 2C2UA 1S30A 3HL1A 1FHAA 3FVBA 4LPMA 3E1NA 5JKMA 3F32A 1IESA 3E2CA 3BVKA 4LPNA 4CVPA 5JKMG 3RE7A 4XKUA 4XKSA 5GU2X 5D8PA 3WVWA 2XKQA 2YJJA 5C6FA 3R2LA 1SQ3A 3E1QA 3Q4RA 5J93A 1EUMA 2CF7A 5D8QA 3E1LA 4RC5A 4TOEA 5GOUA 3KXUA 3ERZA 2Z6MA 3SE1A 3E1OA 3SH6A 1QYBA 3R2MA 4R42A 3HIUA 1LKMA 3IS8A 5IX6A 1VELA 1ZUJA 2Z5PA 3AK8A 3TA8A 1IERA 2ZA6A 4ITWA 4MY7A 1VLGA 2V2IA 4ZKHA 3GHQA 4LQNA 2IB0A 2XJOA 3E1PA 4CMYA 3PVRB 3U90A 3GE4A 3VNXA 2VXXA 4MN9A 5LS9A 3GVYA 3PW8A 3AJOA 3BVLA 4LQHA 1RCEA 4EVEA 3F36A 2VXIA 3F34A 2D5KA 1TKPA 1KRQA 2FKZA 2V2OA 4LPJA 3ISFA 4E6KA 2ZG9X 3NP2X 1NF4A 2X170 2CN6A 4CY9A 1O9IA 2CN7A 3A9QA 3F38A 3AF8X 4MJYA 2V2JA 3PW1B 1B71A 1YUXA 4II4B 2HR5A 4AM2A 4MKUA 5K52A 3QHCA 4M34A 1RYTA 2C2JA 2ITBA 3RGDA 1JI4A 3QZ3A 5ERKA 2BK6A 2RBDA 4EVCA 2WTLA 4PGKA 3PVTB 1Z4AA 4MUDA 4ZL5A 3AF7X 4EVBA 4M35A 5GN8B 5FFCA 4DE6A 5FFDA 1QGHA 4IWKA 2ZA7A 5HJFA 1L8HA 3BVEA 3FI6A 4RC7B 5D8SA 4Z3BA 2Z5QA 3KWOA 4LQJA 4ZKWA 4TOFA 2CLUA 4DI0A 4TOGA 2Y3QA 4RC6B 3PWFA 4DYUA 1VEQA 4DYZA 3IQ1A 3KA3A 1BCFA 3QHBA 4ERUA 1ZS3A 2OC5A 5FFBA 1UVHA 4TODA 2ZURX 1JIGA 1JREA 4ISPA 5E1UA 4XGSA 3EZ0A 3PZAA 4RC8A 3O7SA 5AXSA 3KX9A 1TKOA 4LYUA 3Q4NA 2FFXJ 5FFEA 3T9JA 1RCDA 5GU1X 2Z90A 3A68A 4ZTTA 2YW6A 2CHPA 4XKTA 1YV1A 1JYBA 3F35A 4II4A 3R2KA 5J8WA 1RCGA 1LB3A 1NF6A 3SHXA 3KA6A 1BG7A 2XJNA 5J8SA 4A25A 2GS4A 2OH3A 5CMRA 4LQVA 4KVQA 4TOBA 1S3QA 3PWQC 4ZKXA 4KVSA 5LG8A 3PVTA 4EVDA 5J9VA 2C6RA 2V2NA 1XZ1A 2HTNA 3WNWA 4TW3A 4LYXA 3R2RA 3QB9A 2FJCA 3R2OA 5HQOA 3BKNA 3E6RA 2G4HA 1HRSA 3EGMA 2CLBA 2IY4A 1BFRA 4RC7A 2C2FA 2Z5RA 3IS7A 1L8IA 5JKLA 4TOCA 4CVRA 1S2ZA 5JKLG 4RC5B 3R2SA 2FG8A 4AM4A 3RBCA 2V2LA 2ZG7X 1JGCA 1R03A 4Z5SA 2V2PA 4PG1A 1TJOA 5HJHA 1J30A 1Z6OA 3WVUA 1JKVA 3NP0X 2PYBA 1VJXA 3OJ5A 3EZUA 5I4JA 4CVTA 2JD60 5D8RA 1RCCA 3H7GA 1JKUA 3UNOA 3PVRA 3NOZX 2GYQA 4ZMCA 4TO9A 3BVFA 4M33A 2W0OA 5D8YA 2C41A 3UOFA 4U3GA 2VZBA 3AJQA 4ZL6A 3QVDA 3F33A 2IU2A 4IWJA 2XGWA 3Q4QA 4REUA 2V15A 3E6SA 3RAVA 1MOJA 2CEIA 5D8XA 3E1MA 4ETRA 3R2HA 3PVYB 4ZJKA 2UX1A 2WLUA 2BKCA 2JD70 4OYNA 1LKPA 5CMQA 5D8OA 2V2MA 1UMNA 4KVRA 4ZLWA 3WVVA 4P18A 5LG2A 1GWGA 3PW8C 2FG4A 1F30A 2YW7A 3BVIA 3ES3A 4DZ0A 1F33A 2FZFA 3SIDA 3ISEA 5ERJA 3OGHA 3PW1A 4PGIA 5E2DA 1DVBA 2V2SA 2GYDA 2WLAA 2ZG8X 3O7RA 4DYYA 1YUZA 1JTSA 2FHAA 3RD0A 1TK6A 5K53A 3E1JA 5CZUA 4M32A 5LBHA 4CVSA 4CYAA 3F37A 4CYBA 1DPSA 5GU3X 3BT5A 5GN8A 4YKHA 3MPSA 1VEIA 2JD80 3AJPA 3FSEA 4TOHA 1NFVA 1XZ3A 4TOAA 4AM5A 4QUWA 5GU0X 2V2RA 4Y08A 4RC6A 1NNQA 5FEJA 3KA8A 1Z6OM 3PVYA 1H96A 4PG0A 4DYXA 1LKOA 2ZA8A 1N1QA 3KA9A 2QQYA 4ITTA 3QD8A 3PWQA 3Q4OA 4IXKA 3UOIA 2XJMA 2CIHA 1AEWA 2CHIA 2FL0A 3AF9X 1RCIA 2QF9A 1MFRA
chains in the Genus database with same CATH superfamily
1DATA 2BW1A 3KA4A 5FFAA 4ML5A 4ISMA 2YJKA 1SOFA 5JACA 3F39A 4DASA 4CMYV 1OTKA 3AK9A 1JI5A 1O9RA 2F7NA 2BJYA 2C2UA 1S30A 3HL1A 1FHAA 3FVBA 4LPMA 3E1NA 5JKMA 3F32A 2G38B 1IESA 3E2CA 3BVKA 4LPNA 4CVPA 5JKMG 3RE7A 4XKUA 2N02A 3L0MA 4XKSA 5GU2X 2Y44A 5D8PA 3WVWA 4X0JA 2XKQA 2YJJA 5C6FA 3R2LA 1SQ3A 3E1QA 3Q4RA 5J93A 1EUMA 2CF7A 5D8QA 3E1LA 4RC5A 4TOEA 5GOUA 3KXUA 3ERZA 2Z6MA 3SE1A 3E1OA 3SH6A 3UFBA 1QYBA 3R2MA 4R42A 3HIUA 1LKMA 3IS8A 5IX6A 1VELA 1ZUJA 2Z5PA 3AK8A 3TA8A 1IERA 2ZA6A 4ITWA 4MY7A 4YXJA 1VLGA 2V2IA 4ZKHA 3GHQA 4LQNA 2IB0A 2XJOA 3E1PA 4CMYA 3PVRB 3U90A 3JZAB 3GE4A 3VNXA 2VXXA 4MN9A 5LS9A 3GVYA 3PW8A 3GGYA 3AJOA 3BVLA 4LQHA 1RCEA 2WWXB 3FRSA 4EVEA 3F36A 2VXIA 3F34A 2D5KA 1TKPA 1KRQA 2FKZA 2V2OA 3N6OA 4LPJA 3ISFA 4E6KA 2ZG9X 3NP2X 1NF4A 2X170 2CN6A 4CY9A 1O9IA 2CN7A 3A9QA 3F38A 3M6JA 3AF8X 4MJYA 2V8TA 3VV9A 2V2JA 3PW1B 1B71A 1YUXA 4II4B 2HR5A 4AM2A 4MKUA 5K52A 3QHCA 4M34A 4YVZA 1RYTA 2C2JA 2ITBA 3C23A 3RGDA 1JI4A 3QZ3A 5ERKA 2BK6A 2RBDA 4EVCA 2WTLA 4PGKA 3PVTB 1Z4AA 4MUDA 4ZL5A 3AF7X 4EVBA 4M35A 5GN8B 5FFCA 4DE6A 5FFDA 1QGHA 4IWKA 2ZA7A 5HJFA 1L8HA 3BVEA 3FI6A 3JZ9A 4RC7B 5D8SA 3C21A 2Z5QA 3KWOA 4LQJA 4Z3BA 4ZKWA 4TOFA 2CLUA 3LKDA 4DI0A 4TOGA 2Y3QA 4RC6B 3PWFA 4DYUA 1VEQA 4DYZA 3IQ1A 3KA3A 1BCFA 3QHBA 4ERUA 1ZS3A 2OC5A 5FFBA 1UVHA 4TODA 2ZURX 1JIGA 1JREA 4ISPA 5E1UA 4XGSA 3EZ0A 3PZAA 4RC8A 3O7SA 5AXSA 3KX9A 1TKOA 4LYUA 3Q4NA 2FFXJ 5FFEA 3T9JA 1RCDA 5GU1X 2Z90A 2V8UA 3A68A 4ZTTA 2YW6A 2CWLA 2CHPA 4XKTA 1YV1A 1JYBA 3F35A 4II4A 3R2KA 5J8WA 1RCGA 1LB3A 1NF6A 3SHXA 3KA6A 1BG7A 2XJNA 5J8SA 4A25A 2GS4A 2OH3A 5CMRA 4LQVA 4KVQA 4TOBA 1S3QA 3PWQC 4ZKXA 4KVSA 5LG8A 3PVTA 4EVDA 5J9VA 2C6RA 2V2NA 1XZ1A 2HTNA 3WNWA 4TW3A 4LYXA 3R2RA 3QB9A 2MGYA 2FJCA 3R2OA 3V3KB 5HQOA 3BKNA 3E6RA 2G4HA 1HRSA 3EGMA 2CLBA 2IY4A 1BFRA 4RC7A 2C2FA 2Z5RA 3IS7A 1L8IA 5JKLA 3FRRA 4TOCA 4CVRA 1S2ZA 5JKLG 4RC5B 3R2SA 2FG8A 4W4LB 4AM4A 3RBCA 2V2LA 2ZG7X 1JGCA 1R03A 4Z5SA 2V2PA 4PG1A 1TJOA 3GGZA 5HJHA 4YXMA 1J30A 1Z6OA 4KXRB 3WVUA 1JKVA 3NP0X 2PYBA 1VJXA 3OJ5A 3EZUA 5I4JA 4CVTA 2JD60 5D8RA 1RCCA 3H7GA 1JKUA 3DBYA 3UNOA 3PVRA 3NOZX 2GYQA 4ZMCA 4TO9A 3BVFA 4M33A 2W0OA 5D8YA 2C41A 3UOFA 4U3GA 2VZBA 3AJQA 4ZL6A 3QVDA 4E40A 3F33A 2IU2A 4IWJA 2XGWA 3Q4QA 5JDOB 4REUA 2V15A 3E6SA 3RAVA 1MOJA 2CEIA 5D8XA 3W54A 3E1MA 4ETRA 3R2HA 3D19A 4W4KB 3PVYB 4ZJKA 2UX1A 2WLUA 2BKCA 2JD70 4OYNA 1LKPA 5CMQA 5D8OA 2V2MA 1UMNA 4KVRA 4ZLWA 3WVVA 4P18A 5LG2A 1GWGA 3PW8C 2FG4A 1F30A 2YW7A 3BVIA 3ES3A 4DZ0A 1F33A 2FZFA 3SIDA 3ISEA 5ERJA 3OGHA 4WJG4 3PW1A 2AR0A 4PGIA 5E2DA 1DVBA 2V2SA 2GYDA 3C1ZA 2WLAA 2ZG8X 3O7RA 4DYYA 1YUZA 1JTSA 2FHAA 3RD0A 1TK6A 4MXPA 3E1JA 5K53A 3KHKA 5CZUA 4M32A 5LBHA 4CVSA 4CYAA 3F37A 4CYBA 1DPSA 5GU3X 3BT5A 5GN8A 4YKHA 3MPSA 1VEIA 2OKCA 2JD80 3AJPA 3FSEA 4TOHA 1NFVA 5JDOA 1XZ3A 4TOAA 4AM5A 4QUWA 5GU0X 2V2RA 4Y08A 4RC6A 3KDQA 1NNQA 5FEJA 3KA8A 1Z6OM 3PVYA 1H96A 4PG0A 4DYXA 1LKOA 2ZA8A 1N1QA 3KA9A 2QQYA 4ITTA 3QD8A 3PWQA 3Q4OA 4IXKA 3UOIA 3VVAA 3C1YA 5HU6D 2XJMA 2CIHA 1AEWA 2CHIA 2FL0A 3AF9X 1RCIA 2QF9A 1MFRA
chains in the Genus database with same CATH topology
1DATA 2BW1A 3KA4A 5FFAA 4ML5A 4ISMA 2YJKA 1SOFA 5JACA 3F39A 4DASA 4CMYV 1OTKA 3AK9A 1JI5A 1O9RA 2F7NA 2BJYA 2C2UA 1S30A 3HL1A 1FHAA 3FVBA 4LPMA 3E1NA 5JKMA 3F32A 2G38B 1IESA 3E2CA 3BVKA 4LPNA 4CVPA 5JKMG 3RE7A 4XKUA 2N02A 3L0MA 4XKSA 5GU2X 2Y44A 5D8PA 3WVWA 4X0JA 2XKQA 2YJJA 5C6FA 3R2LA 1SQ3A 3E1QA 3Q4RA 5J93A 1EUMA 2CF7A 5D8QA 3E1LA 4RC5A 4TOEA 5GOUA 3KXUA 3ERZA 2Z6MA 3SE1A 3E1OA 3SH6A 3UFBA 1QYBA 3R2MA 4R42A 3HIUA 1LKMA 3IS8A 5IX6A 1VELA 1ZUJA 2Z5PA 3AK8A 3TA8A 1IERA 2ZA6A 4ITWA 4MY7A 4YXJA 1VLGA 2V2IA 4ZKHA 3GHQA 4LQNA 2IB0A 2XJOA 3E1PA 4CMYA 3PVRB 3U90A 3JZAB 3GE4A 3VNXA 2VXXA 4MN9A 5LS9A 3GVYA 3PW8A 3GGYA 3AJOA 3BVLA 4LQHA 1RCEA 2WWXB 3FRSA 4EVEA 3F36A 2VXIA 3F34A 2D5KA 1TKPA 1KRQA 2FKZA 2V2OA 3N6OA 4LPJA 3ISFA 4E6KA 2ZG9X 3NP2X 1NF4A 2X170 2CN6A 4CY9A 1O9IA 2CN7A 3A9QA 3F38A 3M6JA 3AF8X 4MJYA 2V8TA 3VV9A 2V2JA 3PW1B 1B71A 1YUXA 4II4B 2HR5A 4AM2A 4MKUA 5K52A 3QHCA 4M34A 4YVZA 1RYTA 2C2JA 2ITBA 3C23A 3RGDA 1JI4A 3QZ3A 5ERKA 2BK6A 2RBDA 4EVCA 2WTLA 4PGKA 3PVTB 1Z4AA 4MUDA 4ZL5A 3AF7X 4EVBA 4M35A 5GN8B 5FFCA 4DE6A 5FFDA 1QGHA 4IWKA 2ZA7A 5HJFA 1L8HA 3BVEA 3FI6A 3JZ9A 4RC7B 5D8SA 3C21A 2Z5QA 3KWOA 4LQJA 4Z3BA 4ZKWA 4TOFA 2CLUA 3LKDA 4DI0A 4TOGA 2Y3QA 4RC6B 3PWFA 4DYUA 1VEQA 4DYZA 3IQ1A 3KA3A 1BCFA 3QHBA 4ERUA 1ZS3A 2OC5A 5FFBA 1UVHA 4TODA 2ZURX 1JIGA 1JREA 4ISPA 5E1UA 4XGSA 3EZ0A 3PZAA 4RC8A 3O7SA 5AXSA 3KX9A 1TKOA 4LYUA 3Q4NA 2FFXJ 5FFEA 3T9JA 1RCDA 5GU1X 2Z90A 2V8UA 3A68A 4ZTTA 2YW6A 2CWLA 2CHPA 4XKTA 1YV1A 1JYBA 3F35A 4II4A 3R2KA 5J8WA 1RCGA 1LB3A 1NF6A 3SHXA 3KA6A 1BG7A 2XJNA 5J8SA 4A25A 2GS4A 2OH3A 5CMRA 4LQVA 4KVQA 4TOBA 1S3QA 3PWQC 4ZKXA 4KVSA 5LG8A 3PVTA 4EVDA 5J9VA 2C6RA 2V2NA 1XZ1A 2HTNA 3WNWA 4TW3A 4LYXA 3R2RA 3QB9A 2MGYA 2FJCA 3R2OA 3V3KB 5HQOA 3BKNA 3E6RA 2G4HA 1HRSA 3EGMA 2CLBA 2IY4A 1BFRA 4RC7A 2C2FA 2Z5RA 3IS7A 1L8IA 5JKLA 3FRRA 4TOCA 4CVRA 1S2ZA 5JKLG 4RC5B 3R2SA 2FG8A 4W4LB 4AM4A 3RBCA 2V2LA 2ZG7X 1JGCA 1R03A 4Z5SA 2V2PA 4PG1A 1TJOA 3GGZA 5HJHA 4YXMA 1J30A 1Z6OA 4KXRB 3WVUA 1JKVA 3NP0X 2PYBA 1VJXA 3OJ5A 3EZUA 5I4JA 4CVTA 2JD60 5D8RA 1RCCA 3H7GA 1JKUA 3DBYA 3UNOA 3PVRA 3NOZX 2GYQA 4ZMCA 4TO9A 3BVFA 4M33A 2W0OA 5D8YA 2C41A 3UOFA 4U3GA 2VZBA 3AJQA 4ZL6A 3QVDA 4E40A 3F33A 2IU2A 4IWJA 2XGWA 3Q4QA 5JDOB 4REUA 2V15A 3E6SA 3RAVA 1MOJA 2CEIA 5D8XA 3W54A 3E1MA 4ETRA 3R2HA 3D19A 4W4KB 3PVYB 4ZJKA 2UX1A 2WLUA 2BKCA 2JD70 4OYNA 1LKPA 5CMQA 5D8OA 2V2MA 1UMNA 4KVRA 4ZLWA 3WVVA 4P18A 5LG2A 1GWGA 3PW8C 2FG4A 1F30A 2YW7A 3BVIA 3ES3A 4DZ0A 1F33A 2FZFA 3SIDA 3ISEA 5ERJA 3OGHA 4WJG4 3PW1A 2AR0A 4PGIA 5E2DA 1DVBA 2V2SA 2GYDA 3C1ZA 2WLAA 2ZG8X 3O7RA 4DYYA 1YUZA 1JTSA 2FHAA 3RD0A 1TK6A 4MXPA 3E1JA 5K53A 3KHKA 5CZUA 4M32A 5LBHA 4CVSA 4CYAA 3F37A 4CYBA 1DPSA 5GU3X 3BT5A 5GN8A 4YKHA 3MPSA 1VEIA 2OKCA 2JD80 3AJPA 3FSEA 4TOHA 1NFVA 5JDOA 1XZ3A 4TOAA 4AM5A 4QUWA 5GU0X 2V2RA 4Y08A 4RC6A 3KDQA 1NNQA 5FEJA 3KA8A 1Z6OM 3PVYA 1H96A 4PG0A 4DYXA 1LKOA 2ZA8A 1N1QA 3KA9A 2QQYA 4ITTA 3QD8A 3PWQA 3Q4OA 4IXKA 3UOIA 3VVAA 3C1YA 5HU6D 2XJMA 2CIHA 1AEWA 2CHIA 2FL0A 3AF9X 1RCIA 2QF9A 1MFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DAT A;  2BW1 A;  3KA4 A;  5FFA A;  4ML5 A;  4ISM A;  2YJK A;  1SOF A;  5JAC A;  3F39 A;  4DAS A;  4CMY V;  1OTK A;  3AK9 A;  1JI5 A;  1O9R A;  2F7N A;  2BJY A;  2C2U A;  1S30 A;  3HL1 A;  1FHA A;  3FVB A;  4LPM A;  3E1N A;  5JKM A;  3F32 A;  1IES A;  3E2C A;  3BVK A;  4LPN A;  4CVP A;  5JKM G;  3RE7 A;  4XKU A;  4XKS A;  5GU2 X;  5D8P A;  3WVW A;  2XKQ A;  2YJJ A;  5C6F A;  3R2L A;  1SQ3 A;  3E1Q A;  3Q4R A;  5J93 A;  1EUM A;  2CF7 A;  5D8Q A;  3E1L A;  4RC5 A;  4TOE A;  5GOU A;  3KXU A;  3ERZ A;  2Z6M A;  3SE1 A;  3E1O A;  3SH6 A;  1QYB A;  3R2M A;  4R42 A;  3HIU A;  1LKM A;  3IS8 A;  5IX6 A;  1VEL A;  1ZUJ A;  2Z5P A;  3AK8 A;  3TA8 A;  1IER A;  2ZA6 A;  4ITW A;  4MY7 A;  1VLG A;  2V2I A;  4ZKH A;  3GHQ A;  4LQN A;  2IB0 A;  2XJO A;  3E1P A;  4CMY A;  3PVR B;  3U90 A;  3GE4 A;  3VNX A;  2VXX A;  4MN9 A;  5LS9 A;  3GVY A;  3PW8 A;  3AJO A;  3BVL A;  4LQH A;  1RCE A;  4EVE A;  3F36 A;  2VXI A;  3F34 A;  2D5K A;  1TKP A;  1KRQ A;  2FKZ A;  2V2O A;  4LPJ A;  3ISF A;  4E6K A;  2ZG9 X;  3NP2 X;  1NF4 A;  2X17 0;  2CN6 A;  4CY9 A;  1O9I A;  2CN7 A;  3A9Q A;  3F38 A;  3AF8 X;  4MJY A;  2V2J A;  3PW1 B;  1B71 A;  1YUX A;  4II4 B;  2HR5 A;  4AM2 A;  4MKU A;  5K52 A;  3QHC A;  4M34 A;  1RYT A;  2C2J A;  2ITB A;  3RGD A;  1JI4 A;  3QZ3 A;  5ERK A;  2BK6 A;  2RBD A;  4EVC A;  2WTL A;  4PGK A;  3PVT B;  1Z4A A;  4MUD A;  4ZL5 A;  3AF7 X;  4EVB A;  4M35 A;  5GN8 B;  5FFC A;  4DE6 A;  5FFD A;  1QGH A;  4IWK A;  2ZA7 A;  5HJF A;  1L8H A;  3BVE A;  3FI6 A;  4RC7 B;  5D8S A;  4Z3B A;  2Z5Q A;  3KWO A;  4LQJ A;  4ZKW A;  4TOF A;  2CLU A;  4DI0 A;  4TOG A;  2Y3Q A;  4RC6 B;  3PWF A;  4DYU A;  1VEQ A;  4DYZ A;  3IQ1 A;  3KA3 A;  1BCF A;  3QHB A;  4ERU A;  1ZS3 A;  2OC5 A;  5FFB A;  1UVH A;  4TOD A;  2ZUR X;  1JIG A;  1JRE A;  4ISP A;  5E1U A;  4XGS A;  3EZ0 A;  3PZA A;  4RC8 A;  3O7S A;  5AXS A;  3KX9 A;  1TKO A;  4LYU A;  3Q4N A;  2FFX J;  5FFE A;  3T9J A;  1RCD A;  5GU1 X;  2Z90 A;  3A68 A;  4ZTT A;  2YW6 A;  2CHP A;  4XKT A;  1YV1 A;  1JYB A;  3F35 A;  4II4 A;  3R2K A;  5J8W A;  1RCG A;  1LB3 A;  1NF6 A;  3SHX A;  3KA6 A;  1BG7 A;  2XJN A;  5J8S A;  4A25 A;  2GS4 A;  2OH3 A;  5CMR A;  4LQV A;  4KVQ A;  4TOB A;  1S3Q A;  3PWQ C;  4ZKX A;  4KVS A;  5LG8 A;  3PVT A;  4EVD A;  5J9V A;  2C6R A;  2V2N A;  1XZ1 A;  2HTN A;  3WNW A;  4TW3 A;  4LYX A;  3R2R A;  3QB9 A;  2FJC A;  3R2O A;  5HQO A;  3BKN A;  3E6R A;  2G4H A;  1HRS A;  3EGM A;  2CLB A;  2IY4 A;  1BFR A;  4RC7 A;  2C2F A;  2Z5R A;  3IS7 A;  1L8I A;  5JKL A;  4TOC A;  4CVR A;  1S2Z A;  5JKL G;  4RC5 B;  3R2S A;  2FG8 A;  4AM4 A;  3RBC A;  2V2L A;  2ZG7 X;  1JGC A;  1R03 A;  4Z5S A;  2V2P A;  4PG1 A;  1TJO A;  5HJH A;  1J30 A;  1Z6O A;  3WVU A;  1JKV A;  3NP0 X;  2PYB A;  1VJX A;  3OJ5 A;  3EZU A;  5I4J A;  4CVT A;  2JD6 0;  5D8R A;  1RCC A;  3H7G A;  1JKU A;  3UNO A;  3PVR A;  3NOZ X;  2GYQ A;  4ZMC A;  4TO9 A;  3BVF A;  4M33 A;  2W0O A;  5D8Y A;  2C41 A;  3UOF A;  4U3G A;  2VZB A;  3AJQ A;  4ZL6 A;  3QVD A;  3F33 A;  2IU2 A;  4IWJ A;  2XGW A;  3Q4Q A;  4REU A;  2V15 A;  3E6S A;  3RAV A;  1MOJ A;  2CEI A;  5D8X A;  3E1M A;  4ETR A;  3R2H A;  3PVY B;  4ZJK A;  2UX1 A;  2WLU A;  2BKC A;  2JD7 0;  4OYN A;  1LKP A;  5CMQ A;  5D8O A;  2V2M A;  1UMN A;  4KVR A;  4ZLW A;  3WVV A;  4P18 A;  5LG2 A;  1GWG A;  3PW8 C;  2FG4 A;  1F30 A;  2YW7 A;  3BVI A;  3ES3 A;  4DZ0 A;  1F33 A;  2FZF A;  3SID A;  3ISE A;  5ERJ A;  3OGH A;  3PW1 A;  4PGI A;  5E2D A;  1DVB A;  2V2S A;  2GYD A;  2WLA A;  2ZG8 X;  3O7R A;  4DYY A;  1YUZ A;  1JTS A;  2FHA A;  3RD0 A;  1TK6 A;  5K53 A;  3E1J A;  5CZU A;  4M32 A;  5LBH A;  4CVS A;  4CYA A;  3F37 A;  4CYB A;  1DPS A;  5GU3 X;  3BT5 A;  5GN8 A;  4YKH A;  3MPS A;  1VEI A;  2JD8 0;  3AJP A;  3FSE A;  4TOH A;  1NFV A;  1XZ3 A;  4TOA A;  4AM5 A;  4QUW A;  5GU0 X;  2V2R A;  4Y08 A;  4RC6 A;  1NNQ A;  5FEJ A;  3KA8 A;  1Z6O M;  3PVY A;  1H96 A;  4PG0 A;  4DYX A;  1LKO A;  2ZA8 A;  1N1Q A;  3KA9 A;  2QQY A;  4ITT A;  3QD8 A;  3PWQ A;  3Q4O A;  4IXK A;  3UOI A;  2XJM A;  2CIH A;  1AEW A;  2CHI A;  2FL0 A;  3AF9 X;  1RCI A;  2QF9 A;  1MFR A; 
#chains in the Genus database with same CATH topology
 1DAT A;  2BW1 A;  3KA4 A;  5FFA A;  4ML5 A;  4ISM A;  2YJK A;  1SOF A;  5JAC A;  3F39 A;  4DAS A;  4CMY V;  1OTK A;  3AK9 A;  1JI5 A;  1O9R A;  2F7N A;  2BJY A;  2C2U A;  1S30 A;  3HL1 A;  1FHA A;  3FVB A;  4LPM A;  3E1N A;  5JKM A;  3F32 A;  2G38 B;  1IES A;  3E2C A;  3BVK A;  4LPN A;  4CVP A;  5JKM G;  3RE7 A;  4XKU A;  2N02 A;  3L0M A;  4XKS A;  5GU2 X;  2Y44 A;  5D8P A;  3WVW A;  4X0J A;  2XKQ A;  2YJJ A;  5C6F A;  3R2L A;  1SQ3 A;  3E1Q A;  3Q4R A;  5J93 A;  1EUM A;  2CF7 A;  5D8Q A;  3E1L A;  4RC5 A;  4TOE A;  5GOU A;  3KXU A;  3ERZ A;  2Z6M A;  3SE1 A;  3E1O A;  3SH6 A;  3UFB A;  1QYB A;  3R2M A;  4R42 A;  3HIU A;  1LKM A;  3IS8 A;  5IX6 A;  1VEL A;  1ZUJ A;  2Z5P A;  3AK8 A;  3TA8 A;  1IER A;  2ZA6 A;  4ITW A;  4MY7 A;  4YXJ A;  1VLG A;  2V2I A;  4ZKH A;  3GHQ A;  4LQN A;  2IB0 A;  2XJO A;  3E1P A;  4CMY A;  3PVR B;  3U90 A;  3JZA B;  3GE4 A;  3VNX A;  2VXX A;  4MN9 A;  5LS9 A;  3GVY A;  3PW8 A;  3GGY A;  3AJO A;  3BVL A;  4LQH A;  1RCE A;  2WWX B;  3FRS A;  4EVE A;  3F36 A;  2VXI A;  3F34 A;  2D5K A;  1TKP A;  1KRQ A;  2FKZ A;  2V2O A;  3N6O A;  4LPJ A;  3ISF A;  4E6K A;  2ZG9 X;  3NP2 X;  1NF4 A;  2X17 0;  2CN6 A;  4CY9 A;  1O9I A;  2CN7 A;  3A9Q A;  3F38 A;  3M6J A;  3AF8 X;  4MJY A;  2V8T A;  3VV9 A;  2V2J A;  3PW1 B;  1B71 A;  1YUX A;  4II4 B;  2HR5 A;  4AM2 A;  4MKU A;  5K52 A;  3QHC A;  4M34 A;  4YVZ A;  1RYT A;  2C2J A;  2ITB A;  3C23 A;  3RGD A;  1JI4 A;  3QZ3 A;  5ERK A;  2BK6 A;  2RBD A;  4EVC A;  2WTL A;  4PGK A;  3PVT B;  1Z4A A;  4MUD A;  4ZL5 A;  3AF7 X;  4EVB A;  4M35 A;  5GN8 B;  5FFC A;  4DE6 A;  5FFD A;  1QGH A;  4IWK A;  2ZA7 A;  5HJF A;  1L8H A;  3BVE A;  3FI6 A;  3JZ9 A;  4RC7 B;  5D8S A;  3C21 A;  2Z5Q A;  3KWO A;  4LQJ A;  4Z3B A;  4ZKW A;  4TOF A;  2CLU A;  3LKD A;  4DI0 A;  4TOG A;  2Y3Q A;  4RC6 B;  3PWF A;  4DYU A;  1VEQ A;  4DYZ A;  3IQ1 A;  3KA3 A;  1BCF A;  3QHB A;  4ERU A;  1ZS3 A;  2OC5 A;  5FFB A;  1UVH A;  4TOD A;  2ZUR X;  1JIG A;  1JRE A;  4ISP A;  5E1U A;  4XGS A;  3EZ0 A;  3PZA A;  4RC8 A;  3O7S A;  5AXS A;  3KX9 A;  1TKO A;  4LYU A;  3Q4N A;  2FFX J;  5FFE A;  3T9J A;  1RCD A;  5GU1 X;  2Z90 A;  2V8U A;  3A68 A;  4ZTT A;  2YW6 A;  2CWL A;  2CHP A;  4XKT A;  1YV1 A;  1JYB A;  3F35 A;  4II4 A;  3R2K A;  5J8W A;  1RCG A;  1LB3 A;  1NF6 A;  3SHX A;  3KA6 A;  1BG7 A;  2XJN A;  5J8S A;  4A25 A;  2GS4 A;  2OH3 A;  5CMR A;  4LQV A;  4KVQ A;  4TOB A;  1S3Q A;  3PWQ C;  4ZKX A;  4KVS A;  5LG8 A;  3PVT A;  4EVD A;  5J9V A;  2C6R A;  2V2N A;  1XZ1 A;  2HTN A;  3WNW A;  4TW3 A;  4LYX A;  3R2R A;  3QB9 A;  2MGY A;  2FJC A;  3R2O A;  3V3K B;  5HQO A;  3BKN A;  3E6R A;  2G4H A;  1HRS A;  3EGM A;  2CLB A;  2IY4 A;  1BFR A;  4RC7 A;  2C2F A;  2Z5R A;  3IS7 A;  1L8I A;  5JKL A;  3FRR A;  4TOC A;  4CVR A;  1S2Z A;  5JKL G;  4RC5 B;  3R2S A;  2FG8 A;  4W4L B;  4AM4 A;  3RBC A;  2V2L A;  2ZG7 X;  1JGC A;  1R03 A;  4Z5S A;  2V2P A;  4PG1 A;  1TJO A;  3GGZ A;  5HJH A;  4YXM A;  1J30 A;  1Z6O A;  4KXR B;  3WVU A;  1JKV A;  3NP0 X;  2PYB A;  1VJX A;  3OJ5 A;  3EZU A;  5I4J A;  4CVT A;  2JD6 0;  5D8R A;  1RCC A;  3H7G A;  1JKU A;  3DBY A;  3UNO A;  3PVR A;  3NOZ X;  2GYQ A;  4ZMC A;  4TO9 A;  3BVF A;  4M33 A;  2W0O A;  5D8Y A;  2C41 A;  3UOF A;  4U3G A;  2VZB A;  3AJQ A;  4ZL6 A;  3QVD A;  4E40 A;  3F33 A;  2IU2 A;  4IWJ A;  2XGW A;  3Q4Q A;  5JDO B;  4REU A;  2V15 A;  3E6S A;  3RAV A;  1MOJ A;  2CEI A;  5D8X A;  3W54 A;  3E1M A;  4ETR A;  3R2H A;  3D19 A;  4W4K B;  3PVY B;  4ZJK A;  2UX1 A;  2WLU A;  2BKC A;  2JD7 0;  4OYN A;  1LKP A;  5CMQ A;  5D8O A;  2V2M A;  1UMN A;  4KVR A;  4ZLW A;  3WVV A;  4P18 A;  5LG2 A;  1GWG A;  3PW8 C;  2FG4 A;  1F30 A;  2YW7 A;  3BVI A;  3ES3 A;  4DZ0 A;  1F33 A;  2FZF A;  3SID A;  3ISE A;  5ERJ A;  3OGH A;  4WJG 4;  3PW1 A;  2AR0 A;  4PGI A;  5E2D A;  1DVB A;  2V2S A;  2GYD A;  3C1Z A;  2WLA A;  2ZG8 X;  3O7R A;  4DYY A;  1YUZ A;  1JTS A;  2FHA A;  3RD0 A;  1TK6 A;  4MXP A;  3E1J A;  5K53 A;  3KHK A;  5CZU A;  4M32 A;  5LBH A;  4CVS A;  4CYA A;  3F37 A;  4CYB A;  1DPS A;  5GU3 X;  3BT5 A;  5GN8 A;  4YKH A;  3MPS A;  1VEI A;  2OKC A;  2JD8 0;  3AJP A;  3FSE A;  4TOH A;  1NFV A;  5JDO A;  1XZ3 A;  4TOA A;  4AM5 A;  4QUW A;  5GU0 X;  2V2R A;  4Y08 A;  4RC6 A;  3KDQ A;  1NNQ A;  5FEJ A;  3KA8 A;  1Z6O M;  3PVY A;  1H96 A;  4PG0 A;  4DYX A;  1LKO A;  2ZA8 A;  1N1Q A;  3KA9 A;  2QQY A;  4ITT A;  3QD8 A;  3PWQ A;  3Q4O A;  4IXK A;  3UOI A;  3VVA A;  3C1Y A;  5HU6 D;  2XJM A;  2CIH A;  1AEW A;  2CHI A;  2FL0 A;  3AF9 X;  1RCI A;  2QF9 A;  1MFR A; 
#chains in the Genus database with same CATH homology
 1DAT A;  2BW1 A;  3KA4 A;  5FFA A;  4ML5 A;  4ISM A;  2YJK A;  1SOF A;  5JAC A;  3F39 A;  4DAS A;  4CMY V;  1OTK A;  3AK9 A;  1JI5 A;  1O9R A;  2F7N A;  2BJY A;  2C2U A;  1S30 A;  3HL1 A;  1FHA A;  3FVB A;  4LPM A;  3E1N A;  5JKM A;  3F32 A;  2G38 B;  1IES A;  3E2C A;  3BVK A;  4LPN A;  4CVP A;  5JKM G;  3RE7 A;  4XKU A;  2N02 A;  3L0M A;  4XKS A;  5GU2 X;  2Y44 A;  5D8P A;  3WVW A;  4X0J A;  2XKQ A;  2YJJ A;  5C6F A;  3R2L A;  1SQ3 A;  3E1Q A;  3Q4R A;  5J93 A;  1EUM A;  2CF7 A;  5D8Q A;  3E1L A;  4RC5 A;  4TOE A;  5GOU A;  3KXU A;  3ERZ A;  2Z6M A;  3SE1 A;  3E1O A;  3SH6 A;  3UFB A;  1QYB A;  3R2M A;  4R42 A;  3HIU A;  1LKM A;  3IS8 A;  5IX6 A;  1VEL A;  1ZUJ A;  2Z5P A;  3AK8 A;  3TA8 A;  1IER A;  2ZA6 A;  4ITW A;  4MY7 A;  4YXJ A;  1VLG A;  2V2I A;  4ZKH A;  3GHQ A;  4LQN A;  2IB0 A;  2XJO A;  3E1P A;  4CMY A;  3PVR B;  3U90 A;  3JZA B;  3GE4 A;  3VNX A;  2VXX A;  4MN9 A;  5LS9 A;  3GVY A;  3PW8 A;  3GGY A;  3AJO A;  3BVL A;  4LQH A;  1RCE A;  2WWX B;  3FRS A;  4EVE A;  3F36 A;  2VXI A;  3F34 A;  2D5K A;  1TKP A;  1KRQ A;  2FKZ A;  2V2O A;  3N6O A;  4LPJ A;  3ISF A;  4E6K A;  2ZG9 X;  3NP2 X;  1NF4 A;  2X17 0;  2CN6 A;  4CY9 A;  1O9I A;  2CN7 A;  3A9Q A;  3F38 A;  3M6J A;  3AF8 X;  4MJY A;  2V8T A;  3VV9 A;  2V2J A;  3PW1 B;  1B71 A;  1YUX A;  4II4 B;  2HR5 A;  4AM2 A;  4MKU A;  5K52 A;  3QHC A;  4M34 A;  4YVZ A;  1RYT A;  2C2J A;  2ITB A;  3C23 A;  3RGD A;  1JI4 A;  3QZ3 A;  5ERK A;  2BK6 A;  2RBD A;  4EVC A;  2WTL A;  4PGK A;  3PVT B;  1Z4A A;  4MUD A;  4ZL5 A;  3AF7 X;  4EVB A;  4M35 A;  5GN8 B;  5FFC A;  4DE6 A;  5FFD A;  1QGH A;  4IWK A;  2ZA7 A;  5HJF A;  1L8H A;  3BVE A;  3FI6 A;  3JZ9 A;  4RC7 B;  5D8S A;  3C21 A;  2Z5Q A;  3KWO A;  4LQJ A;  4Z3B A;  4ZKW A;  4TOF A;  2CLU A;  3LKD A;  4DI0 A;  4TOG A;  2Y3Q A;  4RC6 B;  3PWF A;  4DYU A;  1VEQ A;  4DYZ A;  3IQ1 A;  3KA3 A;  1BCF A;  3QHB A;  4ERU A;  1ZS3 A;  2OC5 A;  5FFB A;  1UVH A;  4TOD A;  2ZUR X;  1JIG A;  1JRE A;  4ISP A;  5E1U A;  4XGS A;  3EZ0 A;  3PZA A;  4RC8 A;  3O7S A;  5AXS A;  3KX9 A;  1TKO A;  4LYU A;  3Q4N A;  2FFX J;  5FFE A;  3T9J A;  1RCD A;  5GU1 X;  2Z90 A;  2V8U A;  3A68 A;  4ZTT A;  2YW6 A;  2CWL A;  2CHP A;  4XKT A;  1YV1 A;  1JYB A;  3F35 A;  4II4 A;  3R2K A;  5J8W A;  1RCG A;  1LB3 A;  1NF6 A;  3SHX A;  3KA6 A;  1BG7 A;  2XJN A;  5J8S A;  4A25 A;  2GS4 A;  2OH3 A;  5CMR A;  4LQV A;  4KVQ A;  4TOB A;  1S3Q A;  3PWQ C;  4ZKX A;  4KVS A;  5LG8 A;  3PVT A;  4EVD A;  5J9V A;  2C6R A;  2V2N A;  1XZ1 A;  2HTN A;  3WNW A;  4TW3 A;  4LYX A;  3R2R A;  3QB9 A;  2MGY A;  2FJC A;  3R2O A;  3V3K B;  5HQO A;  3BKN A;  3E6R A;  2G4H A;  1HRS A;  3EGM A;  2CLB A;  2IY4 A;  1BFR A;  4RC7 A;  2C2F A;  2Z5R A;  3IS7 A;  1L8I A;  5JKL A;  3FRR A;  4TOC A;  4CVR A;  1S2Z A;  5JKL G;  4RC5 B;  3R2S A;  2FG8 A;  4W4L B;  4AM4 A;  3RBC A;  2V2L A;  2ZG7 X;  1JGC A;  1R03 A;  4Z5S A;  2V2P A;  4PG1 A;  1TJO A;  3GGZ A;  5HJH A;  4YXM A;  1J30 A;  1Z6O A;  4KXR B;  3WVU A;  1JKV A;  3NP0 X;  2PYB A;  1VJX A;  3OJ5 A;  3EZU A;  5I4J A;  4CVT A;  2JD6 0;  5D8R A;  1RCC A;  3H7G A;  1JKU A;  3DBY A;  3UNO A;  3PVR A;  3NOZ X;  2GYQ A;  4ZMC A;  4TO9 A;  3BVF A;  4M33 A;  2W0O A;  5D8Y A;  2C41 A;  3UOF A;  4U3G A;  2VZB A;  3AJQ A;  4ZL6 A;  3QVD A;  4E40 A;  3F33 A;  2IU2 A;  4IWJ A;  2XGW A;  3Q4Q A;  5JDO B;  4REU A;  2V15 A;  3E6S A;  3RAV A;  1MOJ A;  2CEI A;  5D8X A;  3W54 A;  3E1M A;  4ETR A;  3R2H A;  3D19 A;  4W4K B;  3PVY B;  4ZJK A;  2UX1 A;  2WLU A;  2BKC A;  2JD7 0;  4OYN A;  1LKP A;  5CMQ A;  5D8O A;  2V2M A;  1UMN A;  4KVR A;  4ZLW A;  3WVV A;  4P18 A;  5LG2 A;  1GWG A;  3PW8 C;  2FG4 A;  1F30 A;  2YW7 A;  3BVI A;  3ES3 A;  4DZ0 A;  1F33 A;  2FZF A;  3SID A;  3ISE A;  5ERJ A;  3OGH A;  4WJG 4;  3PW1 A;  2AR0 A;  4PGI A;  5E2D A;  1DVB A;  2V2S A;  2GYD A;  3C1Z A;  2WLA A;  2ZG8 X;  3O7R A;  4DYY A;  1YUZ A;  1JTS A;  2FHA A;  3RD0 A;  1TK6 A;  4MXP A;  3E1J A;  5K53 A;  3KHK A;  5CZU A;  4M32 A;  5LBH A;  4CVS A;  4CYA A;  3F37 A;  4CYB A;  1DPS A;  5GU3 X;  3BT5 A;  5GN8 A;  4YKH A;  3MPS A;  1VEI A;  2OKC A;  2JD8 0;  3AJP A;  3FSE A;  4TOH A;  1NFV A;  5JDO A;  1XZ3 A;  4TOA A;  4AM5 A;  4QUW A;  5GU0 X;  2V2R A;  4Y08 A;  4RC6 A;  3KDQ A;  1NNQ A;  5FEJ A;  3KA8 A;  1Z6O M;  3PVY A;  1H96 A;  4PG0 A;  4DYX A;  1LKO A;  2ZA8 A;  1N1Q A;  3KA9 A;  2QQY A;  4ITT A;  3QD8 A;  3PWQ A;  3Q4O A;  4IXK A;  3UOI A;  3VVA A;  3C1Y A;  5HU6 D;  2XJM A;  2CIH A;  1AEW A;  2CHI A;  2FL0 A;  3AF9 X;  1RCI A;  2QF9 A;  1MFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...