3T9JA

Crystal structure hp-nap from strain ys39 in apo form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
144
structure length
144
Chain Sequence
MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEGFADMFDDLAERIAQLGHHPLVTLSEALKLTRVKEETKTSFHSKDIFKEILEDYKHLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Neutrophil-activating protein
publication title A new crystal lattice structure of Helicobacter pylori neutrophil-activating protein (HP-NAP)
pubmed doi rcsb
source organism Helicobacter pylori
total genus 63
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3t9jA00
2X170 4CYAA 1JIGA 1BG7A 3AJPA 1QYBA 2Z5PA 2G4HA 1ZS3A 3IS8A 3SHXA 3AF8X 3WVWA 5FFCA 4XKTA 1JI5A 1XZ1A 1YV1A 1VLGA 1H96A 3F37A 4TOGA 3R2SA 1RYTA 1IERA 4ETRA 2C41A 4LPNA 1R03A 2YW7A 3F36A 3WNWA 1TJOA 2BK6A 5IX6A 3SIDA 2JD60 2CEIA 5C6FA 4CVSA 3R2OA 2FHAA 1RCEA 5J8SA 3RE7A 1HRSA 3PVYB 3PW8A 4QUWA 5LBHA 4ZTTA 3E1QA 2D5KA 1JI4A 3FSEA 4M33A 1JREA 5D8OA 5E1UA 1RCGA 2ZA8A 5GN8B 3WVVA 1N1QA 4LQHA 2FZFA 5GU3X 1DPSA 4R42A 3HIUA 1F33A 4ZKHA 1S3QA 3PVTA 3QVDA 4TW3A 3KA6A 4MN9A 4ITWA 5GU1X 4LQNA 4Y08A 1LB3A 2WLAA 2GYQA 4PGKA 2ZG8X 1RCCA 1J30A 3KA8A 2FL0A 4IWJA 3VNXA 4MY7A 1O9IA 4M32A 2FG4A 4CVPA 2CIHA 3BVFA 2FFXJ 4CYBA 2XGWA 4DASA 1BCFA 2YJKA 2HR5A 2XJOA 2WLUA 3UOFA 3F39A 5JKLA 3SE1A 1NNQA 4XKUA 2VXXA 5ERJA 4TO9A 1B71A 3R2LA 5FFDA 2C2UA 4M34A 3T9JA 1L8IA 4DYUA 3FVBA 5LG2A 3F38A 5GU2X 4ZL6A 2Y3QA 1RCIA 1TKOA 1TK6A 3Q4NA 5D8XA 2CHIA 4MKUA 4YKHA 4XKSA 1RCDA 3FI6A 4DE6A 4DYZA 4RC7B 4AM4A 3HL1A 4U3GA 2ZA7A 3PWQA 3E1MA 3ISFA 2F7NA 1FHAA 5GOUA 4KVQA 3KX9A 4E6KA 4EVCA 3ISEA 5CZUA 3E6SA 3R2KA 5D8YA 3EGMA 1LKMA 2PYBA 3RD0A 2YW6A 1Z6OA 3U90A 3PZAA 5HJHA 3BVIA 4M35A 4ZLWA 1LKPA 3F32A 2OC5A 2V2IA 3QZ3A 4TOAA 4ZJKA 3KXUA 2BKCA 4IWKA 3BT5A 4CVTA 3PVTB 3OJ5A 1YUXA 3A68A 3AF9X 3NOZX 4EVDA 4TOCA 3EZUA 3MPSA 4DI0A 3RGDA 3PW1B 4TOBA 4EVBA 2JD70 4Z5SA 3GE4A 1JTSA 2V2MA 2IB0A 4RC8A 1ZUJA 2GS4A 1IESA 4LPMA 1S2ZA 5HQOA 4OYNA 2BJYA 3QD8A 4MJYA 3GVYA 3KA4A 4PG1A 3PVYA 1L8HA 2FG8A 2CLBA 4PGIA 2IY4A 1S30A 5JKMG 2V2LA 4CVRA 3OGHA 4RC6B 1GWGA 2Z5RA 2V2OA 2V15A 1NFVA 3R2RA 3RAVA 5CMQA 2Z6MA 3AK8A 5D8PA 5ERKA 5GN8A 4AM2A 3F34A 4KVRA 4REUA 4CMYV 2V2JA 2W0OA 4LPJA 2V2PA 3TA8A 2C2FA 2CHPA 3R2MA 2XKQA 2HTNA 2QF9A 2V2RA 5FFEA 4RC5A 1DATA 3PVRA 5FFBA 1LKOA 3GHQA 3O7SA 2JD80 5J8WA 1VEQA 2FJCA 5FFAA 4LYUA 3Q4RA 2IU2A 3BVKA 3ES3A 3AJQA 3E2CA 2VZBA 1XZ3A 3ERZA 3E6RA 4TOHA 1Z4AA 1JYBA 4EVEA 5FEJA 3UOIA 3BKNA 4LQJA 4TODA 3EZ0A 3PW8C 1MOJA 2CN6A 1MFRA 3AK9A 4LQVA 4II4A 1Z6OM 5J93A 1YUZA 4ITTA 2Z5QA 4PG0A 3E1JA 4MUDA 4CMYA 3E1NA 3KWOA 1UVHA 1EUMA 5D8QA 4KVSA 3H7GA 4Z3BA 4ZKXA 1QGHA 4DYYA 4ZKWA 1SQ3A 1F30A 1VELA 3IQ1A 2FKZA 2WTLA 5E2DA 3BVLA 3NP2X 2GYDA 2BW1A 3Q4QA 1UMNA 3A9QA 4RC7A 4TOEA 4XGSA 2ZA6A 3AJOA 3O7RA 4ML5A 3UNOA 5JACA 2XJNA 4ERUA 1OTKA 3RBCA 3AF7X 2ZG7X 2UX1A 3KA9A 1O9RA 2ZG9X 2ITBA 1JKUA 5LG8A 5K52A 5GU0X 1BFRA 3R2HA 3F35A 4DYXA 5LS9A 4ISPA 4A25A 2RBDA 5I4JA 3IS7A 1VEIA 2ZURX 3WVUA 4RC5B 3PVRB 2CN7A 2OH3A 3KA3A 2C6RA 2CF7A 3E1OA 5JKLG 4LYXA 5D8SA 3PW1A 1SOFA 3BVEA 3QHCA 5AXSA 5J9VA 2CLUA 1NF4A 2VXIA 2Z90A 4P18A 2C2JA 2V2SA 4CY9A 3PWQC 5HJFA 2QQYA 5D8RA 5CMRA 4AM5A 2V2NA 5JKMA 1AEWA 1DVBA 1JKVA 3PWFA 1VJXA 3E1PA 1NF6A 3NP0X 3F33A 1JGCA 4ZMCA 4II4B 4RC6A 4IXKA 1KRQA 3SH6A 4ZL5A 4TOFA 3E1LA 4ISMA 2XJMA 3QB9A 5K53A 2YJJA 1TKPA 3Q4OA 3QHBA 4DZ0A
chains in the Genus database with same CATH superfamily
2X170 4CYAA 1JIGA 1BG7A 3AJPA 1QYBA 2Z5PA 2G4HA 4YXJA 1ZS3A 3IS8A 3SHXA 3AF8X 3WVWA 5FFCA 4XKTA 1JI5A 1XZ1A 1YV1A 1VLGA 1H96A 3F37A 4TOGA 3R2SA 2V8TA 1RYTA 1IERA 2V8UA 4ETRA 2C41A 4LPNA 1R03A 2YW7A 3F36A 3WNWA 1TJOA 2BK6A 5IX6A 3SIDA 2JD60 2CEIA 5C6FA 4CVSA 3R2OA 2FHAA 1RCEA 5J8SA 3JZ9A 4YVZA 3RE7A 1HRSA 3PVYB 3PW8A 4QUWA 5LBHA 4ZTTA 3E1QA 4WJG4 2D5KA 1JI4A 3FSEA 4M33A 1JREA 5D8OA 4YXMA 5E1UA 1RCGA 2ZA8A 5GN8B 3WVVA 1N1QA 4LQHA 2FZFA 5GU3X 3LKDA 1DPSA 4R42A 3HIUA 1F33A 4ZKHA 1S3QA 3PVTA 3QVDA 4TW3A 3KA6A 4MN9A 4ITWA 5GU1X 4LQNA 4Y08A 1LB3A 2WLAA 2GYQA 4PGKA 2ZG8X 1RCCA 1J30A 3KA8A 2FL0A 3GGZA 4IWJA 3VNXA 4MY7A 1O9IA 4M32A 2FG4A 4CVPA 2CIHA 3BVFA 2FFXJ 4CYBA 2XGWA 4DASA 1BCFA 2YJKA 2HR5A 2XJOA 3C21A 2WLUA 3UOFA 3F39A 5JKLA 3SE1A 1NNQA 4XKUA 2AR0A 2VXXA 5ERJA 4TO9A 1B71A 3FRSA 3R2LA 5FFDA 2C2UA 4M34A 3T9JA 1L8IA 4DYUA 3FVBA 5LG2A 3F38A 5GU2X 4ZL6A 2Y3QA 1RCIA 1TKOA 1TK6A 5HU6D 3Q4NA 3N6OA 5D8XA 2CHIA 4MKUA 4YKHA 4XKSA 1RCDA 3M6JA 3FI6A 4DE6A 4DYZA 4RC7B 4AM4A 3HL1A 4U3GA 2ZA7A 3PWQA 3E1MA 3ISFA 2CWLA 2F7NA 1FHAA 5GOUA 4KVQA 3KX9A 4E6KA 4EVCA 3ISEA 5CZUA 3E6SA 3R2KA 5D8YA 3EGMA 1LKMA 2PYBA 3RD0A 2OKCA 2YW6A 2MGYA 1Z6OA 3U90A 3PZAA 5HJHA 3BVIA 3L0MA 3UFBA 4M35A 4ZLWA 1LKPA 3F32A 2OC5A 2V2IA 3QZ3A 4TOAA 4ZJKA 3KXUA 2BKCA 4IWKA 3BT5A 4CVTA 3PVTB 3OJ5A 1YUXA 3A68A 3AF9X 3NOZX 4EVDA 4TOCA 3EZUA 3MPSA 4DI0A 3RGDA 3PW1B 4TOBA 4EVBA 2JD70 4Z5SA 3GE4A 1JTSA 2V2MA 2IB0A 4RC8A 3C23A 1ZUJA 2GS4A 1IESA 4LPMA 1S2ZA 5HQOA 2N02A 4OYNA 2BJYA 3QD8A 4MJYA 3GVYA 5JDOA 3KA4A 4PG1A 3PVYA 1L8HA 2FG8A 2CLBA 4PGIA 2IY4A 1S30A 5JKMG 2V2LA 4CVRA 3OGHA 4RC6B 1GWGA 2Z5RA 2V2OA 2V15A 1NFVA 2WWXB 2G38B 3R2RA 5CMQA 2Z6MA 3RAVA 3AK8A 5D8PA 5ERKA 5GN8A 4AM2A 3F34A 4KVRA 4REUA 4CMYV 2V2JA 2W0OA 4LPJA 2V2PA 3TA8A 2C2FA 2CHPA 3R2MA 2XKQA 2HTNA 2QF9A 2V2RA 5FFEA 3FRRA 4RC5A 1DATA 3PVRA 5FFBA 1LKOA 3GHQA 3KHKA 3O7SA 2JD80 5J8WA 1VEQA 2FJCA 5FFAA 4LYUA 3Q4RA 2IU2A 3BVKA 3ES3A 3AJQA 3E2CA 2VZBA 1XZ3A 3ERZA 3E6RA 4TOHA 1Z4AA 1JYBA 3JZAB 4KXRB 4EVEA 5FEJA 3UOIA 3BKNA 4LQJA 4TODA 3EZ0A 3PW8C 1MOJA 2CN6A 1MFRA 3AK9A 4LQVA 4II4A 1Z6OM 5J93A 3VVAA 1YUZA 4ITTA 2Z5QA 4PG0A 3E1JA 4MUDA 4CMYA 3E1NA 3KWOA 1UVHA 1EUMA 5D8QA 4KVSA 3H7GA 4Z3BA 4ZKXA 1QGHA 4DYYA 3GGYA 4ZKWA 1SQ3A 1F30A 1VELA 3IQ1A 2Y44A 2FKZA 2WTLA 5E2DA 3BVLA 3NP2X 2GYDA 2BW1A 3Q4QA 1UMNA 3C1YA 3A9QA 4RC7A 4TOEA 4XGSA 2ZA6A 3AJOA 3D19A 5JDOB 3O7RA 4ML5A 3UNOA 5JACA 2XJNA 4ERUA 1OTKA 3RBCA 3AF7X 2ZG7X 2UX1A 3KA9A 1O9RA 2ZG9X 3DBYA 2ITBA 1JKUA 5LG8A 5K52A 5GU0X 1BFRA 3R2HA 3C1ZA 3F35A 4DYXA 5LS9A 4ISPA 4A25A 4E40A 2RBDA 5I4JA 4X0JA 3IS7A 1VEIA 2ZURX 3WVUA 4RC5B 3PVRB 3VV9A 2CN7A 2OH3A 3KA3A 2C6RA 2CF7A 3E1OA 5JKLG 4LYXA 5D8SA 3PW1A 1SOFA 3BVEA 3QHCA 5AXSA 5J9VA 4W4LB 2CLUA 1NF4A 3W54A 2VXIA 3V3KB 2Z90A 4P18A 2C2JA 2V2SA 4CY9A 3PWQC 5HJFA 2QQYA 5D8RA 5CMRA 4AM5A 2V2NA 5JKMA 1AEWA 1DVBA 1JKVA 3PWFA 1VJXA 4W4KB 3E1PA 1NF6A 3NP0X 3F33A 1JGCA 4ZMCA 4II4B 4RC6A 4IXKA 1KRQA 3SH6A 4ZL5A 3KDQA 4TOFA 3E1LA 4ISMA 2XJMA 3QB9A 5K53A 2YJJA 1TKPA 4MXPA 3Q4OA 3QHBA 4DZ0A
chains in the Genus database with same CATH topology
2X170 4CYAA 1JIGA 1BG7A 3AJPA 1QYBA 2Z5PA 2G4HA 4YXJA 1ZS3A 3IS8A 3SHXA 3AF8X 3WVWA 5FFCA 4XKTA 1JI5A 1XZ1A 1YV1A 1VLGA 1H96A 3F37A 4TOGA 3R2SA 2V8TA 1RYTA 1IERA 2V8UA 4ETRA 2C41A 4LPNA 1R03A 2YW7A 3F36A 3WNWA 1TJOA 2BK6A 5IX6A 3SIDA 2JD60 2CEIA 5C6FA 4CVSA 3R2OA 2FHAA 1RCEA 5J8SA 3JZ9A 4YVZA 3RE7A 1HRSA 3PVYB 3PW8A 4QUWA 5LBHA 4ZTTA 3E1QA 4WJG4 2D5KA 1JI4A 3FSEA 4M33A 1JREA 5D8OA 4YXMA 5E1UA 1RCGA 2ZA8A 5GN8B 3WVVA 1N1QA 4LQHA 2FZFA 5GU3X 3LKDA 1DPSA 4R42A 3HIUA 1F33A 4ZKHA 1S3QA 3PVTA 3QVDA 4TW3A 3KA6A 4MN9A 4ITWA 5GU1X 4LQNA 4Y08A 1LB3A 2WLAA 2GYQA 4PGKA 2ZG8X 1RCCA 1J30A 3KA8A 2FL0A 3GGZA 4IWJA 3VNXA 4MY7A 1O9IA 4M32A 2FG4A 4CVPA 2CIHA 3BVFA 2FFXJ 4CYBA 2XGWA 4DASA 1BCFA 2YJKA 2HR5A 2XJOA 3C21A 2WLUA 3UOFA 3F39A 5JKLA 3SE1A 1NNQA 4XKUA 2AR0A 2VXXA 5ERJA 4TO9A 1B71A 3FRSA 3R2LA 5FFDA 2C2UA 4M34A 3T9JA 1L8IA 4DYUA 3FVBA 5LG2A 3F38A 5GU2X 4ZL6A 2Y3QA 1RCIA 1TKOA 1TK6A 5HU6D 3Q4NA 3N6OA 5D8XA 2CHIA 4MKUA 4YKHA 4XKSA 1RCDA 3M6JA 3FI6A 4DE6A 4DYZA 4RC7B 4AM4A 3HL1A 4U3GA 2ZA7A 3PWQA 3E1MA 3ISFA 2CWLA 2F7NA 1FHAA 5GOUA 4KVQA 3KX9A 4E6KA 4EVCA 3ISEA 5CZUA 3E6SA 3R2KA 5D8YA 3EGMA 1LKMA 2PYBA 3RD0A 2OKCA 2YW6A 2MGYA 1Z6OA 3U90A 3PZAA 5HJHA 3BVIA 3L0MA 3UFBA 4M35A 4ZLWA 1LKPA 3F32A 2OC5A 2V2IA 3QZ3A 4TOAA 4ZJKA 3KXUA 2BKCA 4IWKA 3BT5A 4CVTA 3PVTB 3OJ5A 1YUXA 3A68A 3AF9X 3NOZX 4EVDA 4TOCA 3EZUA 3MPSA 4DI0A 3RGDA 3PW1B 4TOBA 4EVBA 2JD70 4Z5SA 3GE4A 1JTSA 2V2MA 2IB0A 4RC8A 3C23A 1ZUJA 2GS4A 1IESA 4LPMA 1S2ZA 5HQOA 2N02A 4OYNA 2BJYA 3QD8A 4MJYA 3GVYA 5JDOA 3KA4A 4PG1A 3PVYA 1L8HA 2FG8A 2CLBA 4PGIA 2IY4A 1S30A 5JKMG 2V2LA 4CVRA 3OGHA 4RC6B 1GWGA 2Z5RA 2V2OA 2V15A 1NFVA 2WWXB 2G38B 3R2RA 5CMQA 2Z6MA 3RAVA 3AK8A 5D8PA 5ERKA 5GN8A 4AM2A 3F34A 4KVRA 4REUA 4CMYV 2V2JA 2W0OA 4LPJA 2V2PA 3TA8A 2C2FA 2CHPA 3R2MA 2XKQA 2HTNA 2QF9A 2V2RA 5FFEA 3FRRA 4RC5A 1DATA 3PVRA 5FFBA 1LKOA 3GHQA 3KHKA 3O7SA 2JD80 5J8WA 1VEQA 2FJCA 5FFAA 4LYUA 3Q4RA 2IU2A 3BVKA 3ES3A 3AJQA 3E2CA 2VZBA 1XZ3A 3ERZA 3E6RA 4TOHA 1Z4AA 1JYBA 3JZAB 4KXRB 4EVEA 5FEJA 3UOIA 3BKNA 4LQJA 4TODA 3EZ0A 3PW8C 1MOJA 2CN6A 1MFRA 3AK9A 4LQVA 4II4A 1Z6OM 5J93A 3VVAA 1YUZA 4ITTA 2Z5QA 4PG0A 3E1JA 4MUDA 4CMYA 3E1NA 3KWOA 1UVHA 1EUMA 5D8QA 4KVSA 3H7GA 4Z3BA 4ZKXA 1QGHA 4DYYA 3GGYA 4ZKWA 1SQ3A 1F30A 1VELA 3IQ1A 2Y44A 2FKZA 2WTLA 5E2DA 3BVLA 3NP2X 2GYDA 2BW1A 3Q4QA 1UMNA 3C1YA 3A9QA 4RC7A 4TOEA 4XGSA 2ZA6A 3AJOA 3D19A 5JDOB 3O7RA 4ML5A 3UNOA 5JACA 2XJNA 4ERUA 1OTKA 3RBCA 3AF7X 2ZG7X 2UX1A 3KA9A 1O9RA 2ZG9X 3DBYA 2ITBA 1JKUA 5LG8A 5K52A 5GU0X 1BFRA 3R2HA 3C1ZA 3F35A 4DYXA 5LS9A 4ISPA 4A25A 4E40A 2RBDA 5I4JA 4X0JA 3IS7A 1VEIA 2ZURX 3WVUA 4RC5B 3PVRB 3VV9A 2CN7A 2OH3A 3KA3A 2C6RA 2CF7A 3E1OA 5JKLG 4LYXA 5D8SA 3PW1A 1SOFA 3BVEA 3QHCA 5AXSA 5J9VA 4W4LB 2CLUA 1NF4A 3W54A 2VXIA 3V3KB 2Z90A 4P18A 2C2JA 2V2SA 4CY9A 3PWQC 5HJFA 2QQYA 5D8RA 5CMRA 4AM5A 2V2NA 5JKMA 1AEWA 1DVBA 1JKVA 3PWFA 1VJXA 4W4KB 3E1PA 1NF6A 3NP0X 3F33A 1JGCA 4ZMCA 4II4B 4RC6A 4IXKA 1KRQA 3SH6A 4ZL5A 3KDQA 4TOFA 3E1LA 4ISMA 2XJMA 3QB9A 5K53A 2YJJA 1TKPA 4MXPA 3Q4OA 3QHBA 4DZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X17 0;  4CYA A;  1JIG A;  1BG7 A;  3AJP A;  1QYB A;  2Z5P A;  2G4H A;  1ZS3 A;  3IS8 A;  3SHX A;  3AF8 X;  3WVW A;  5FFC A;  4XKT A;  1JI5 A;  1XZ1 A;  1YV1 A;  1VLG A;  1H96 A;  3F37 A;  4TOG A;  3R2S A;  1RYT A;  1IER A;  4ETR A;  2C41 A;  4LPN A;  1R03 A;  2YW7 A;  3F36 A;  3WNW A;  1TJO A;  2BK6 A;  5IX6 A;  3SID A;  2JD6 0;  2CEI A;  5C6F A;  4CVS A;  3R2O A;  2FHA A;  1RCE A;  5J8S A;  3RE7 A;  1HRS A;  3PVY B;  3PW8 A;  4QUW A;  5LBH A;  4ZTT A;  3E1Q A;  2D5K A;  1JI4 A;  3FSE A;  4M33 A;  1JRE A;  5D8O A;  5E1U A;  1RCG A;  2ZA8 A;  5GN8 B;  3WVV A;  1N1Q A;  4LQH A;  2FZF A;  5GU3 X;  1DPS A;  4R42 A;  3HIU A;  1F33 A;  4ZKH A;  1S3Q A;  3PVT A;  3QVD A;  4TW3 A;  3KA6 A;  4MN9 A;  4ITW A;  5GU1 X;  4LQN A;  4Y08 A;  1LB3 A;  2WLA A;  2GYQ A;  4PGK A;  2ZG8 X;  1RCC A;  1J30 A;  3KA8 A;  2FL0 A;  4IWJ A;  3VNX A;  4MY7 A;  1O9I A;  4M32 A;  2FG4 A;  4CVP A;  2CIH A;  3BVF A;  2FFX J;  4CYB A;  2XGW A;  4DAS A;  1BCF A;  2YJK A;  2HR5 A;  2XJO A;  2WLU A;  3UOF A;  3F39 A;  5JKL A;  3SE1 A;  1NNQ A;  4XKU A;  2VXX A;  5ERJ A;  4TO9 A;  1B71 A;  3R2L A;  5FFD A;  2C2U A;  4M34 A;  3T9J A;  1L8I A;  4DYU A;  3FVB A;  5LG2 A;  3F38 A;  5GU2 X;  4ZL6 A;  2Y3Q A;  1RCI A;  1TKO A;  1TK6 A;  3Q4N A;  5D8X A;  2CHI A;  4MKU A;  4YKH A;  4XKS A;  1RCD A;  3FI6 A;  4DE6 A;  4DYZ A;  4RC7 B;  4AM4 A;  3HL1 A;  4U3G A;  2ZA7 A;  3PWQ A;  3E1M A;  3ISF A;  2F7N A;  1FHA A;  5GOU A;  4KVQ A;  3KX9 A;  4E6K A;  4EVC A;  3ISE A;  5CZU A;  3E6S A;  3R2K A;  5D8Y A;  3EGM A;  1LKM A;  2PYB A;  3RD0 A;  2YW6 A;  1Z6O A;  3U90 A;  3PZA A;  5HJH A;  3BVI A;  4M35 A;  4ZLW A;  1LKP A;  3F32 A;  2OC5 A;  2V2I A;  3QZ3 A;  4TOA A;  4ZJK A;  3KXU A;  2BKC A;  4IWK A;  3BT5 A;  4CVT A;  3PVT B;  3OJ5 A;  1YUX A;  3A68 A;  3AF9 X;  3NOZ X;  4EVD A;  4TOC A;  3EZU A;  3MPS A;  4DI0 A;  3RGD A;  3PW1 B;  4TOB A;  4EVB A;  2JD7 0;  4Z5S A;  3GE4 A;  1JTS A;  2V2M A;  2IB0 A;  4RC8 A;  1ZUJ A;  2GS4 A;  1IES A;  4LPM A;  1S2Z A;  5HQO A;  4OYN A;  2BJY A;  3QD8 A;  4MJY A;  3GVY A;  3KA4 A;  4PG1 A;  3PVY A;  1L8H A;  2FG8 A;  2CLB A;  4PGI A;  2IY4 A;  1S30 A;  5JKM G;  2V2L A;  4CVR A;  3OGH A;  4RC6 B;  1GWG A;  2Z5R A;  2V2O A;  2V15 A;  1NFV A;  3R2R A;  3RAV A;  5CMQ A;  2Z6M A;  3AK8 A;  5D8P A;  5ERK A;  5GN8 A;  4AM2 A;  3F34 A;  4KVR A;  4REU A;  4CMY V;  2V2J A;  2W0O A;  4LPJ A;  2V2P A;  3TA8 A;  2C2F A;  2CHP A;  3R2M A;  2XKQ A;  2HTN A;  2QF9 A;  2V2R A;  5FFE A;  4RC5 A;  1DAT A;  3PVR A;  5FFB A;  1LKO A;  3GHQ A;  3O7S A;  2JD8 0;  5J8W A;  1VEQ A;  2FJC A;  5FFA A;  4LYU A;  3Q4R A;  2IU2 A;  3BVK A;  3ES3 A;  3AJQ A;  3E2C A;  2VZB A;  1XZ3 A;  3ERZ A;  3E6R A;  4TOH A;  1Z4A A;  1JYB A;  4EVE A;  5FEJ A;  3UOI A;  3BKN A;  4LQJ A;  4TOD A;  3EZ0 A;  3PW8 C;  1MOJ A;  2CN6 A;  1MFR A;  3AK9 A;  4LQV A;  4II4 A;  1Z6O M;  5J93 A;  1YUZ A;  4ITT A;  2Z5Q A;  4PG0 A;  3E1J A;  4MUD A;  4CMY A;  3E1N A;  3KWO A;  1UVH A;  1EUM A;  5D8Q A;  4KVS A;  3H7G A;  4Z3B A;  4ZKX A;  1QGH A;  4DYY A;  4ZKW A;  1SQ3 A;  1F30 A;  1VEL A;  3IQ1 A;  2FKZ A;  2WTL A;  5E2D A;  3BVL A;  3NP2 X;  2GYD A;  2BW1 A;  3Q4Q A;  1UMN A;  3A9Q A;  4RC7 A;  4TOE A;  4XGS A;  2ZA6 A;  3AJO A;  3O7R A;  4ML5 A;  3UNO A;  5JAC A;  2XJN A;  4ERU A;  1OTK A;  3RBC A;  3AF7 X;  2ZG7 X;  2UX1 A;  3KA9 A;  1O9R A;  2ZG9 X;  2ITB A;  1JKU A;  5LG8 A;  5K52 A;  5GU0 X;  1BFR A;  3R2H A;  3F35 A;  4DYX A;  5LS9 A;  4ISP A;  4A25 A;  2RBD A;  5I4J A;  3IS7 A;  1VEI A;  2ZUR X;  3WVU A;  4RC5 B;  3PVR B;  2CN7 A;  2OH3 A;  3KA3 A;  2C6R A;  2CF7 A;  3E1O A;  5JKL G;  4LYX A;  5D8S A;  3PW1 A;  1SOF A;  3BVE A;  3QHC A;  5AXS A;  5J9V A;  2CLU A;  1NF4 A;  2VXI A;  2Z90 A;  4P18 A;  2C2J A;  2V2S A;  4CY9 A;  3PWQ C;  5HJF A;  2QQY A;  5D8R A;  5CMR A;  4AM5 A;  2V2N A;  5JKM A;  1AEW A;  1DVB A;  1JKV A;  3PWF A;  1VJX A;  3E1P A;  1NF6 A;  3NP0 X;  3F33 A;  1JGC A;  4ZMC A;  4II4 B;  4RC6 A;  4IXK A;  1KRQ A;  3SH6 A;  4ZL5 A;  4TOF A;  3E1L A;  4ISM A;  2XJM A;  3QB9 A;  5K53 A;  2YJJ A;  1TKP A;  3Q4O A;  3QHB A;  4DZ0 A; 
#chains in the Genus database with same CATH topology
 2X17 0;  4CYA A;  1JIG A;  1BG7 A;  3AJP A;  1QYB A;  2Z5P A;  2G4H A;  4YXJ A;  1ZS3 A;  3IS8 A;  3SHX A;  3AF8 X;  3WVW A;  5FFC A;  4XKT A;  1JI5 A;  1XZ1 A;  1YV1 A;  1VLG A;  1H96 A;  3F37 A;  4TOG A;  3R2S A;  2V8T A;  1RYT A;  1IER A;  2V8U A;  4ETR A;  2C41 A;  4LPN A;  1R03 A;  2YW7 A;  3F36 A;  3WNW A;  1TJO A;  2BK6 A;  5IX6 A;  3SID A;  2JD6 0;  2CEI A;  5C6F A;  4CVS A;  3R2O A;  2FHA A;  1RCE A;  5J8S A;  3JZ9 A;  4YVZ A;  3RE7 A;  1HRS A;  3PVY B;  3PW8 A;  4QUW A;  5LBH A;  4ZTT A;  3E1Q A;  4WJG 4;  2D5K A;  1JI4 A;  3FSE A;  4M33 A;  1JRE A;  5D8O A;  4YXM A;  5E1U A;  1RCG A;  2ZA8 A;  5GN8 B;  3WVV A;  1N1Q A;  4LQH A;  2FZF A;  5GU3 X;  3LKD A;  1DPS A;  4R42 A;  3HIU A;  1F33 A;  4ZKH A;  1S3Q A;  3PVT A;  3QVD A;  4TW3 A;  3KA6 A;  4MN9 A;  4ITW A;  5GU1 X;  4LQN A;  4Y08 A;  1LB3 A;  2WLA A;  2GYQ A;  4PGK A;  2ZG8 X;  1RCC A;  1J30 A;  3KA8 A;  2FL0 A;  3GGZ A;  4IWJ A;  3VNX A;  4MY7 A;  1O9I A;  4M32 A;  2FG4 A;  4CVP A;  2CIH A;  3BVF A;  2FFX J;  4CYB A;  2XGW A;  4DAS A;  1BCF A;  2YJK A;  2HR5 A;  2XJO A;  3C21 A;  2WLU A;  3UOF A;  3F39 A;  5JKL A;  3SE1 A;  1NNQ A;  4XKU A;  2AR0 A;  2VXX A;  5ERJ A;  4TO9 A;  1B71 A;  3FRS A;  3R2L A;  5FFD A;  2C2U A;  4M34 A;  3T9J A;  1L8I A;  4DYU A;  3FVB A;  5LG2 A;  3F38 A;  5GU2 X;  4ZL6 A;  2Y3Q A;  1RCI A;  1TKO A;  1TK6 A;  5HU6 D;  3Q4N A;  3N6O A;  5D8X A;  2CHI A;  4MKU A;  4YKH A;  4XKS A;  1RCD A;  3M6J A;  3FI6 A;  4DE6 A;  4DYZ A;  4RC7 B;  4AM4 A;  3HL1 A;  4U3G A;  2ZA7 A;  3PWQ A;  3E1M A;  3ISF A;  2CWL A;  2F7N A;  1FHA A;  5GOU A;  4KVQ A;  3KX9 A;  4E6K A;  4EVC A;  3ISE A;  5CZU A;  3E6S A;  3R2K A;  5D8Y A;  3EGM A;  1LKM A;  2PYB A;  3RD0 A;  2OKC A;  2YW6 A;  2MGY A;  1Z6O A;  3U90 A;  3PZA A;  5HJH A;  3BVI A;  3L0M A;  3UFB A;  4M35 A;  4ZLW A;  1LKP A;  3F32 A;  2OC5 A;  2V2I A;  3QZ3 A;  4TOA A;  4ZJK A;  3KXU A;  2BKC A;  4IWK A;  3BT5 A;  4CVT A;  3PVT B;  3OJ5 A;  1YUX A;  3A68 A;  3AF9 X;  3NOZ X;  4EVD A;  4TOC A;  3EZU A;  3MPS A;  4DI0 A;  3RGD A;  3PW1 B;  4TOB A;  4EVB A;  2JD7 0;  4Z5S A;  3GE4 A;  1JTS A;  2V2M A;  2IB0 A;  4RC8 A;  3C23 A;  1ZUJ A;  2GS4 A;  1IES A;  4LPM A;  1S2Z A;  5HQO A;  2N02 A;  4OYN A;  2BJY A;  3QD8 A;  4MJY A;  3GVY A;  5JDO A;  3KA4 A;  4PG1 A;  3PVY A;  1L8H A;  2FG8 A;  2CLB A;  4PGI A;  2IY4 A;  1S30 A;  5JKM G;  2V2L A;  4CVR A;  3OGH A;  4RC6 B;  1GWG A;  2Z5R A;  2V2O A;  2V15 A;  1NFV A;  2WWX B;  2G38 B;  3R2R A;  5CMQ A;  2Z6M A;  3RAV A;  3AK8 A;  5D8P A;  5ERK A;  5GN8 A;  4AM2 A;  3F34 A;  4KVR A;  4REU A;  4CMY V;  2V2J A;  2W0O A;  4LPJ A;  2V2P A;  3TA8 A;  2C2F A;  2CHP A;  3R2M A;  2XKQ A;  2HTN A;  2QF9 A;  2V2R A;  5FFE A;  3FRR A;  4RC5 A;  1DAT A;  3PVR A;  5FFB A;  1LKO A;  3GHQ A;  3KHK A;  3O7S A;  2JD8 0;  5J8W A;  1VEQ A;  2FJC A;  5FFA A;  4LYU A;  3Q4R A;  2IU2 A;  3BVK A;  3ES3 A;  3AJQ A;  3E2C A;  2VZB A;  1XZ3 A;  3ERZ A;  3E6R A;  4TOH A;  1Z4A A;  1JYB A;  3JZA B;  4KXR B;  4EVE A;  5FEJ A;  3UOI A;  3BKN A;  4LQJ A;  4TOD A;  3EZ0 A;  3PW8 C;  1MOJ A;  2CN6 A;  1MFR A;  3AK9 A;  4LQV A;  4II4 A;  1Z6O M;  5J93 A;  3VVA A;  1YUZ A;  4ITT A;  2Z5Q A;  4PG0 A;  3E1J A;  4MUD A;  4CMY A;  3E1N A;  3KWO A;  1UVH A;  1EUM A;  5D8Q A;  4KVS A;  3H7G A;  4Z3B A;  4ZKX A;  1QGH A;  4DYY A;  3GGY A;  4ZKW A;  1SQ3 A;  1F30 A;  1VEL A;  3IQ1 A;  2Y44 A;  2FKZ A;  2WTL A;  5E2D A;  3BVL A;  3NP2 X;  2GYD A;  2BW1 A;  3Q4Q A;  1UMN A;  3C1Y A;  3A9Q A;  4RC7 A;  4TOE A;  4XGS A;  2ZA6 A;  3AJO A;  3D19 A;  5JDO B;  3O7R A;  4ML5 A;  3UNO A;  5JAC A;  2XJN A;  4ERU A;  1OTK A;  3RBC A;  3AF7 X;  2ZG7 X;  2UX1 A;  3KA9 A;  1O9R A;  2ZG9 X;  3DBY A;  2ITB A;  1JKU A;  5LG8 A;  5K52 A;  5GU0 X;  1BFR A;  3R2H A;  3C1Z A;  3F35 A;  4DYX A;  5LS9 A;  4ISP A;  4A25 A;  4E40 A;  2RBD A;  5I4J A;  4X0J A;  3IS7 A;  1VEI A;  2ZUR X;  3WVU A;  4RC5 B;  3PVR B;  3VV9 A;  2CN7 A;  2OH3 A;  3KA3 A;  2C6R A;  2CF7 A;  3E1O A;  5JKL G;  4LYX A;  5D8S A;  3PW1 A;  1SOF A;  3BVE A;  3QHC A;  5AXS A;  5J9V A;  4W4L B;  2CLU A;  1NF4 A;  3W54 A;  2VXI A;  3V3K B;  2Z90 A;  4P18 A;  2C2J A;  2V2S A;  4CY9 A;  3PWQ C;  5HJF A;  2QQY A;  5D8R A;  5CMR A;  4AM5 A;  2V2N A;  5JKM A;  1AEW A;  1DVB A;  1JKV A;  3PWF A;  1VJX A;  4W4K B;  3E1P A;  1NF6 A;  3NP0 X;  3F33 A;  1JGC A;  4ZMC A;  4II4 B;  4RC6 A;  4IXK A;  1KRQ A;  3SH6 A;  4ZL5 A;  3KDQ A;  4TOF A;  3E1L A;  4ISM A;  2XJM A;  3QB9 A;  5K53 A;  2YJJ A;  1TKP A;  4MXP A;  3Q4O A;  3QHB A;  4DZ0 A; 
#chains in the Genus database with same CATH homology
 2X17 0;  4CYA A;  1JIG A;  1BG7 A;  3AJP A;  1QYB A;  2Z5P A;  2G4H A;  4YXJ A;  1ZS3 A;  3IS8 A;  3SHX A;  3AF8 X;  3WVW A;  5FFC A;  4XKT A;  1JI5 A;  1XZ1 A;  1YV1 A;  1VLG A;  1H96 A;  3F37 A;  4TOG A;  3R2S A;  2V8T A;  1RYT A;  1IER A;  2V8U A;  4ETR A;  2C41 A;  4LPN A;  1R03 A;  2YW7 A;  3F36 A;  3WNW A;  1TJO A;  2BK6 A;  5IX6 A;  3SID A;  2JD6 0;  2CEI A;  5C6F A;  4CVS A;  3R2O A;  2FHA A;  1RCE A;  5J8S A;  3JZ9 A;  4YVZ A;  3RE7 A;  1HRS A;  3PVY B;  3PW8 A;  4QUW A;  5LBH A;  4ZTT A;  3E1Q A;  4WJG 4;  2D5K A;  1JI4 A;  3FSE A;  4M33 A;  1JRE A;  5D8O A;  4YXM A;  5E1U A;  1RCG A;  2ZA8 A;  5GN8 B;  3WVV A;  1N1Q A;  4LQH A;  2FZF A;  5GU3 X;  3LKD A;  1DPS A;  4R42 A;  3HIU A;  1F33 A;  4ZKH A;  1S3Q A;  3PVT A;  3QVD A;  4TW3 A;  3KA6 A;  4MN9 A;  4ITW A;  5GU1 X;  4LQN A;  4Y08 A;  1LB3 A;  2WLA A;  2GYQ A;  4PGK A;  2ZG8 X;  1RCC A;  1J30 A;  3KA8 A;  2FL0 A;  3GGZ A;  4IWJ A;  3VNX A;  4MY7 A;  1O9I A;  4M32 A;  2FG4 A;  4CVP A;  2CIH A;  3BVF A;  2FFX J;  4CYB A;  2XGW A;  4DAS A;  1BCF A;  2YJK A;  2HR5 A;  2XJO A;  3C21 A;  2WLU A;  3UOF A;  3F39 A;  5JKL A;  3SE1 A;  1NNQ A;  4XKU A;  2AR0 A;  2VXX A;  5ERJ A;  4TO9 A;  1B71 A;  3FRS A;  3R2L A;  5FFD A;  2C2U A;  4M34 A;  3T9J A;  1L8I A;  4DYU A;  3FVB A;  5LG2 A;  3F38 A;  5GU2 X;  4ZL6 A;  2Y3Q A;  1RCI A;  1TKO A;  1TK6 A;  5HU6 D;  3Q4N A;  3N6O A;  5D8X A;  2CHI A;  4MKU A;  4YKH A;  4XKS A;  1RCD A;  3M6J A;  3FI6 A;  4DE6 A;  4DYZ A;  4RC7 B;  4AM4 A;  3HL1 A;  4U3G A;  2ZA7 A;  3PWQ A;  3E1M A;  3ISF A;  2CWL A;  2F7N A;  1FHA A;  5GOU A;  4KVQ A;  3KX9 A;  4E6K A;  4EVC A;  3ISE A;  5CZU A;  3E6S A;  3R2K A;  5D8Y A;  3EGM A;  1LKM A;  2PYB A;  3RD0 A;  2OKC A;  2YW6 A;  2MGY A;  1Z6O A;  3U90 A;  3PZA A;  5HJH A;  3BVI A;  3L0M A;  3UFB A;  4M35 A;  4ZLW A;  1LKP A;  3F32 A;  2OC5 A;  2V2I A;  3QZ3 A;  4TOA A;  4ZJK A;  3KXU A;  2BKC A;  4IWK A;  3BT5 A;  4CVT A;  3PVT B;  3OJ5 A;  1YUX A;  3A68 A;  3AF9 X;  3NOZ X;  4EVD A;  4TOC A;  3EZU A;  3MPS A;  4DI0 A;  3RGD A;  3PW1 B;  4TOB A;  4EVB A;  2JD7 0;  4Z5S A;  3GE4 A;  1JTS A;  2V2M A;  2IB0 A;  4RC8 A;  3C23 A;  1ZUJ A;  2GS4 A;  1IES A;  4LPM A;  1S2Z A;  5HQO A;  2N02 A;  4OYN A;  2BJY A;  3QD8 A;  4MJY A;  3GVY A;  5JDO A;  3KA4 A;  4PG1 A;  3PVY A;  1L8H A;  2FG8 A;  2CLB A;  4PGI A;  2IY4 A;  1S30 A;  5JKM G;  2V2L A;  4CVR A;  3OGH A;  4RC6 B;  1GWG A;  2Z5R A;  2V2O A;  2V15 A;  1NFV A;  2WWX B;  2G38 B;  3R2R A;  5CMQ A;  2Z6M A;  3RAV A;  3AK8 A;  5D8P A;  5ERK A;  5GN8 A;  4AM2 A;  3F34 A;  4KVR A;  4REU A;  4CMY V;  2V2J A;  2W0O A;  4LPJ A;  2V2P A;  3TA8 A;  2C2F A;  2CHP A;  3R2M A;  2XKQ A;  2HTN A;  2QF9 A;  2V2R A;  5FFE A;  3FRR A;  4RC5 A;  1DAT A;  3PVR A;  5FFB A;  1LKO A;  3GHQ A;  3KHK A;  3O7S A;  2JD8 0;  5J8W A;  1VEQ A;  2FJC A;  5FFA A;  4LYU A;  3Q4R A;  2IU2 A;  3BVK A;  3ES3 A;  3AJQ A;  3E2C A;  2VZB A;  1XZ3 A;  3ERZ A;  3E6R A;  4TOH A;  1Z4A A;  1JYB A;  3JZA B;  4KXR B;  4EVE A;  5FEJ A;  3UOI A;  3BKN A;  4LQJ A;  4TOD A;  3EZ0 A;  3PW8 C;  1MOJ A;  2CN6 A;  1MFR A;  3AK9 A;  4LQV A;  4II4 A;  1Z6O M;  5J93 A;  3VVA A;  1YUZ A;  4ITT A;  2Z5Q A;  4PG0 A;  3E1J A;  4MUD A;  4CMY A;  3E1N A;  3KWO A;  1UVH A;  1EUM A;  5D8Q A;  4KVS A;  3H7G A;  4Z3B A;  4ZKX A;  1QGH A;  4DYY A;  3GGY A;  4ZKW A;  1SQ3 A;  1F30 A;  1VEL A;  3IQ1 A;  2Y44 A;  2FKZ A;  2WTL A;  5E2D A;  3BVL A;  3NP2 X;  2GYD A;  2BW1 A;  3Q4Q A;  1UMN A;  3C1Y A;  3A9Q A;  4RC7 A;  4TOE A;  4XGS A;  2ZA6 A;  3AJO A;  3D19 A;  5JDO B;  3O7R A;  4ML5 A;  3UNO A;  5JAC A;  2XJN A;  4ERU A;  1OTK A;  3RBC A;  3AF7 X;  2ZG7 X;  2UX1 A;  3KA9 A;  1O9R A;  2ZG9 X;  3DBY A;  2ITB A;  1JKU A;  5LG8 A;  5K52 A;  5GU0 X;  1BFR A;  3R2H A;  3C1Z A;  3F35 A;  4DYX A;  5LS9 A;  4ISP A;  4A25 A;  4E40 A;  2RBD A;  5I4J A;  4X0J A;  3IS7 A;  1VEI A;  2ZUR X;  3WVU A;  4RC5 B;  3PVR B;  3VV9 A;  2CN7 A;  2OH3 A;  3KA3 A;  2C6R A;  2CF7 A;  3E1O A;  5JKL G;  4LYX A;  5D8S A;  3PW1 A;  1SOF A;  3BVE A;  3QHC A;  5AXS A;  5J9V A;  4W4L B;  2CLU A;  1NF4 A;  3W54 A;  2VXI A;  3V3K B;  2Z90 A;  4P18 A;  2C2J A;  2V2S A;  4CY9 A;  3PWQ C;  5HJF A;  2QQY A;  5D8R A;  5CMR A;  4AM5 A;  2V2N A;  5JKM A;  1AEW A;  1DVB A;  1JKV A;  3PWF A;  1VJX A;  4W4K B;  3E1P A;  1NF6 A;  3NP0 X;  3F33 A;  1JGC A;  4ZMC A;  4II4 B;  4RC6 A;  4IXK A;  1KRQ A;  3SH6 A;  4ZL5 A;  3KDQ A;  4TOF A;  3E1L A;  4ISM A;  2XJM A;  3QB9 A;  5K53 A;  2YJJ A;  1TKP A;  4MXP A;  3Q4O A;  3QHB A;  4DZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...