4EVEA

Crystal structure hp-nap from strain ys29 in apo form
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
144
structure length
144
Chain Sequence
MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKHLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Neutrophil-activating protein
publication title Crystal structure of Helicobacter pylori neutrophil-activating protein with a di-nuclear ferroxidase center in a zinc or cadmium-bound form
pubmed doi rcsb
source organism Helicobacter pylori
total genus 64
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4eveA00
4AM5A 1DPSA 3BVFA 3RD0A 5JKLG 2C41A 2IB0A 2C2FA 2C2UA 2IY4A 3SH6A 5D8XA 1Z4AA 3R2MA 1JGCA 4LPMA 2V15A 2YJJA 4LQHA 4ML5A 4ITWA 4RC5A 4ERUA 3PW1B 3ISEA 4MN9A 1IESA 2ZURX 5FFAA 2QF9A 1JI5A 2V2SA 3PVTA 3QHCA 2CHIA 4AM2A 1QYBA 4KVSA 2CN6A 2VZBA 3KXUA 2RBDA 3R2OA 2OC5A 2F7NA 4DYUA 1TKOA 2FL0A 4DE6A 3UOFA 1NNQA 1RYTA 1MFRA 4MJYA 5HJHA 4EVEA 2V2JA 5I4JA 5K53A 2HTNA 1F30A 3Q4OA 4PGIA 4CY9A 1DATA 4LYXA 4ZKHA 4RC7B 3Q4QA 5CZUA 2UX1A 2ZA7A 4M33A 1UMNA 4TOGA 1EUMA 5AXSA 3E1OA 1VEIA 2YW7A 5IX6A 4ISMA 4M32A 2CF7A 2CLBA 4IWJA 4EVDA 2CEIA 2Z90A 2FZFA 1J30A 1XZ3A 3T9JA 3SE1A 3PW8A 3F34A 3Q4NA 3IS8A 1HRSA 2FG8A 4RC7A 1B71A 5GU0X 3QVDA 1SOFA 4P18A 4E6KA 5C6FA 2G4HA 4TOHA 3GE4A 3E1QA 2FJCA 3SHXA 3AJQA 3OGHA 3AF7X 3WVUA 3FVBA 3R2LA 1JREA 3PVYA 3EGMA 5GN8A 2ZG8X 2FHAA 4REUA 2OH3A 4RC8A 4TODA 3IS7A 3A9QA 3KWOA 3F36A 3A68A 3NP0X 1NFVA 2YJKA 2WLUA 5LS9A 2Z5RA 3O7SA 1ZUJA 4XKSA 4LQVA 1DVBA 2JD80 2V2MA 1NF4A 2JD70 2D5KA 5GU2X 5GU1X 3BVKA 5FFEA 1JKUA 2BW1A 2ITBA 5K52A 5ERJA 2V2IA 1IERA 3RBCA 5D8RA 2CN7A 4YKHA 4Y08A 3AK9A 1RCIA 2VXIA 3RE7A 3AK8A 4XKTA 5J8WA 4TOFA 1R03A 1OTKA 1YUXA 5ERKA 5D8QA 3R2SA 2V2RA 2YW6A 1VEQA 3BT5A 3BVIA 3E6RA 1YUZA 2BK6A 3PWQA 2ZG7X 3F38A 3TA8A 5JACA 5JKMA 3PW1A 4TOBA 1SQ3A 3H7GA 3PZAA 4XGSA 2V2PA 1JYBA 3AJOA 1N1QA 1JI4A 2CLUA 3F39A 3QD8A 3MPSA 5FFDA 5J8SA 2FFXJ 5D8OA 2BKCA 4TOCA 3QB9A 4DYXA 5JKLA 3QZ3A 2Z5QA 3PWQC 4CVSA 2C6RA 4RC6B 3AF9X 4QUWA 2XKQA 4TO9A 2C2JA 1NF6A 1TKPA 3FSEA 4ITTA 4DASA 3QHBA 3PVRB 3KA3A 3NOZX 3SIDA 2CHPA 4ZKWA 4LPNA 3VNXA 3GHQA 4ZMCA 4U3GA 5FFBA 1MOJA 4IXKA 5LG8A 4MY7A 1RCGA 4ZL5A 3WNWA 4ETRA 3Q4RA 2Y3QA 2CIHA 1S30A 1AEWA 4ZLWA 1LB3A 1TJOA 4A25A 1RCEA 2XJOA 5FEJA 3WVWA 4KVRA 3ERZA 4EVBA 3ISFA 2V2NA 5D8YA 1BFRA 4LPJA 1YV1A 1BCFA 1VELA 3KA4A 1GWGA 2XGWA 3E1PA 3BVLA 3NP2X 3E1JA 4IWKA 4RC5B 4TOEA 5FFCA 3E1NA 2FKZA 4LYUA 3KA8A 2V2LA 3PWFA 1S3QA 1UVHA 3PVTB 2X170 5J93A 1F33A 2FG4A 2Z5PA 2VXXA 3OJ5A 3BVEA 3RGDA 4LQJA 3AF8X 1O9IA 5HJFA 2GYDA 4AM4A 4PGKA 3R2RA 3E6SA 4ZTTA 3UNOA 2WTLA 1LKMA 5LG2A 4PG0A 2W0OA 1ZS3A 3E2CA 3R2HA 4DI0A 3O7RA 3HL1A 4TOAA 5E2DA 4CMYV 5D8SA 1RCCA 5CMRA 1JKVA 4CVPA 4PG1A 3U90A 4DYYA 1Z6OA 2QQYA 3KA9A 5LBHA 3AJPA 3WVVA 1L8IA 2PYBA 4KVQA 1KRQA 4Z5SA 4EVCA 2XJNA 4II4B 1L8HA 4ZL6A 3F35A 4Z3BA 4R42A 1VJXA 4CVTA 2JD60 5CMQA 3E1LA 2ZG9X 3F37A 2V2OA 1TK6A 1Z6OM 3HIUA 4CMYA 3KX9A 2BJYA 5D8PA 4DZ0A 5GOUA 3PVYB 5GN8B 3ES3A 2ZA8A 3IQ1A 5GU3X 5J9VA 1XZ1A 1S2ZA 4II4A 4DYZA 3FI6A 1BG7A 3F32A 1H96A 3BKNA 4ZKXA 3GVYA 1JIGA 4CYBA 1LKPA 3EZUA 4OYNA 2Z6MA 1JTSA 4M35A 2WLAA 3RAVA 4LQNA 5E1UA 4MKUA 3UOIA 1O9RA 2XJMA 4MUDA 4RC6A 3EZ0A 4ISPA 3E1MA 5HQOA 4CVRA 5JKMG 3KA6A 1FHAA 3PVRA 2GS4A 2HR5A 2IU2A 4M34A 2GYQA 4CYAA 1QGHA 4ZJKA 2ZA6A 4TW3A 1RCDA 3PW8C 3R2KA 1LKOA 3F33A 4XKUA 1VLGA
chains in the Genus database with same CATH superfamily
4X0JA 4AM5A 1DPSA 3BVFA 3RD0A 5JKLG 3KDQA 2C41A 2IB0A 2C2FA 2C2UA 2IY4A 3DBYA 3SH6A 5D8XA 1Z4AA 3R2MA 1JGCA 4LPMA 2V15A 2YJJA 4LQHA 4ML5A 3KHKA 4ITWA 4RC5A 4ERUA 3PW1B 3ISEA 4MN9A 1IESA 2ZURX 5FFAA 2QF9A 1JI5A 2V2SA 3PVTA 3QHCA 2CHIA 4AM2A 3D19A 1QYBA 4KVSA 2CN6A 3GGYA 2VZBA 4YXMA 3KXUA 2RBDA 3R2OA 2OC5A 2F7NA 4DYUA 1TKOA 2FL0A 3N6OA 4DE6A 4W4KB 3UOFA 1NNQA 1RYTA 1MFRA 4MJYA 5HJHA 4EVEA 2V2JA 5I4JA 5K53A 2HTNA 1F30A 3Q4OA 4PGIA 4CY9A 1DATA 4LYXA 4ZKHA 4RC7B 3Q4QA 5CZUA 2UX1A 2ZA7A 4M33A 1UMNA 4TOGA 1EUMA 5JDOB 5AXSA 3E1OA 1VEIA 2YW7A 5IX6A 4ISMA 4M32A 2CF7A 4WJG4 2CLBA 4IWJA 4W4LB 4EVDA 2CEIA 2Z90A 2FZFA 1J30A 1XZ3A 3T9JA 3SE1A 3PW8A 3F34A 3Q4NA 3IS8A 1HRSA 2FG8A 4RC7A 1B71A 5GU0X 3QVDA 1SOFA 4P18A 4E6KA 5C6FA 2G4HA 4TOHA 3GE4A 3E1QA 2FJCA 3SHXA 3AJQA 3OGHA 3AF7X 3WVUA 3FVBA 3R2LA 1JREA 3PVYA 3EGMA 5GN8A 2ZG8X 2FHAA 4REUA 2AR0A 2OH3A 4RC8A 3IS7A 4TODA 3A9QA 3KWOA 3F36A 3A68A 3FRSA 3NP0X 1NFVA 2YJKA 2WLUA 5LS9A 2Z5RA 3O7SA 1ZUJA 4XKSA 4LQVA 1DVBA 2JD80 3GGZA 2V2MA 1NF4A 2JD70 2D5KA 5GU2X 5GU1X 3BVKA 5FFEA 1JKUA 2BW1A 2ITBA 5K52A 5ERJA 2V2IA 1IERA 3RBCA 5D8RA 2CN7A 4YKHA 4Y08A 3AK9A 1RCIA 2VXIA 3RE7A 3JZAB 3AK8A 4XKTA 5J8WA 4TOFA 1R03A 3FRRA 1OTKA 1YUXA 5ERKA 5HU6D 5D8QA 3R2SA 2V2RA 3VV9A 2YW6A 1VEQA 3BT5A 3BVIA 3E6RA 1YUZA 2BK6A 3PWQA 2ZG7X 3F38A 3TA8A 2G38B 5JACA 5JKMA 3PW1A 4TOBA 1SQ3A 3H7GA 3PZAA 4XGSA 2V2PA 1JYBA 3AJOA 1N1QA 1JI4A 2CLUA 3W54A 3F39A 3QD8A 3MPSA 5FFDA 5J8SA 2FFXJ 5D8OA 2BKCA 4TOCA 3QB9A 4DYXA 5JKLA 3QZ3A 3C1ZA 4KXRB 2Z5QA 3PWQC 4CVSA 2C6RA 4RC6B 3AF9X 4QUWA 2XKQA 4TO9A 2C2JA 1NF6A 4E40A 1TKPA 3FSEA 4ITTA 4DASA 3QHBA 3PVRB 3KA3A 3NOZX 3SIDA 5JDOA 2CHPA 4ZKWA 4LPNA 3VNXA 3GHQA 4ZMCA 4U3GA 3C23A 3C21A 5FFBA 1MOJA 4IXKA 5LG8A 3L0MA 4MY7A 1RCGA 2V8UA 4ZL5A 3WNWA 4ETRA 3Q4RA 2Y3QA 2CIHA 1S30A 1AEWA 4ZLWA 1LB3A 1TJOA 4A25A 1RCEA 2XJOA 5FEJA 3WVWA 4KVRA 4YVZA 3ERZA 4EVBA 3ISFA 2V2NA 5D8YA 1BFRA 4LPJA 1YV1A 1BCFA 1VELA 3KA4A 1GWGA 2XGWA 3E1PA 3BVLA 3NP2X 3E1JA 4IWKA 4RC5B 4TOEA 2N02A 5FFCA 3E1NA 2FKZA 4LYUA 3KA8A 2Y44A 2V2LA 3PWFA 1S3QA 1UVHA 3PVTB 2X170 5J93A 1F33A 2FG4A 2Z5PA 2VXXA 3OJ5A 3BVEA 3RGDA 2MGYA 4LQJA 3AF8X 1O9IA 5HJFA 2GYDA 4AM4A 4PGKA 3R2RA 3E6SA 4ZTTA 3UNOA 2WTLA 1LKMA 5LG2A 4PG0A 2W0OA 1ZS3A 3E2CA 3R2HA 4DI0A 3O7RA 3HL1A 4TOAA 5E2DA 4CMYV 5D8SA 1RCCA 5CMRA 1JKVA 4CVPA 4PG1A 3U90A 4DYYA 1Z6OA 2QQYA 3KA9A 5LBHA 3AJPA 3M6JA 2OKCA 3WVVA 1L8IA 2PYBA 4KVQA 4YXJA 2CWLA 1KRQA 4Z5SA 4EVCA 2XJNA 4II4B 1L8HA 4ZL6A 3F35A 4Z3BA 4R42A 1VJXA 4CVTA 2JD60 5CMQA 3E1LA 2ZG9X 3F37A 2V2OA 1TK6A 1Z6OM 3HIUA 4CMYA 3KX9A 2BJYA 5D8PA 3V3KB 4DZ0A 5GOUA 3PVYB 5GN8B 3ES3A 2ZA8A 3IQ1A 5GU3X 5J9VA 3JZ9A 1XZ1A 1S2ZA 4II4A 4DYZA 3FI6A 1BG7A 3F32A 1H96A 3BKNA 4ZKXA 3GVYA 1JIGA 4CYBA 1LKPA 3EZUA 3C1YA 4OYNA 2Z6MA 1JTSA 4M35A 2WLAA 3RAVA 4LQNA 5E1UA 4MKUA 3UOIA 1O9RA 2XJMA 4MUDA 4RC6A 3UFBA 3EZ0A 4ISPA 4MXPA 3E1MA 5HQOA 4CVRA 5JKMG 3KA6A 1FHAA 3PVRA 2GS4A 2HR5A 2IU2A 2V8TA 4M34A 2GYQA 4CYAA 1QGHA 4ZJKA 2ZA6A 4TW3A 1RCDA 3PW8C 3LKDA 3R2KA 1LKOA 3F33A 2WWXB 3VVAA 4XKUA 1VLGA
chains in the Genus database with same CATH topology
4X0JA 4AM5A 1DPSA 3BVFA 3RD0A 5JKLG 3KDQA 2C41A 2IB0A 2C2FA 2C2UA 2IY4A 3DBYA 3SH6A 5D8XA 1Z4AA 3R2MA 1JGCA 4LPMA 2V15A 2YJJA 4LQHA 4ML5A 3KHKA 4ITWA 4RC5A 4ERUA 3PW1B 3ISEA 4MN9A 1IESA 2ZURX 5FFAA 2QF9A 1JI5A 2V2SA 3PVTA 3QHCA 2CHIA 4AM2A 3D19A 1QYBA 4KVSA 2CN6A 3GGYA 2VZBA 4YXMA 3KXUA 2RBDA 3R2OA 2OC5A 2F7NA 4DYUA 1TKOA 2FL0A 3N6OA 4DE6A 4W4KB 3UOFA 1NNQA 1RYTA 1MFRA 4MJYA 5HJHA 4EVEA 2V2JA 5I4JA 5K53A 2HTNA 1F30A 3Q4OA 4PGIA 4CY9A 1DATA 4LYXA 4ZKHA 4RC7B 3Q4QA 5CZUA 2UX1A 2ZA7A 4M33A 1UMNA 4TOGA 1EUMA 5JDOB 5AXSA 3E1OA 1VEIA 2YW7A 5IX6A 4ISMA 4M32A 2CF7A 4WJG4 2CLBA 4IWJA 4W4LB 4EVDA 2CEIA 2Z90A 2FZFA 1J30A 1XZ3A 3T9JA 3SE1A 3PW8A 3F34A 3Q4NA 3IS8A 1HRSA 2FG8A 4RC7A 1B71A 5GU0X 3QVDA 1SOFA 4P18A 4E6KA 5C6FA 2G4HA 4TOHA 3GE4A 3E1QA 2FJCA 3SHXA 3AJQA 3OGHA 3AF7X 3WVUA 3FVBA 3R2LA 1JREA 3PVYA 3EGMA 5GN8A 2ZG8X 2FHAA 4REUA 2AR0A 2OH3A 4RC8A 3IS7A 4TODA 3A9QA 3KWOA 3F36A 3A68A 3FRSA 3NP0X 1NFVA 2YJKA 2WLUA 5LS9A 2Z5RA 3O7SA 1ZUJA 4XKSA 4LQVA 1DVBA 2JD80 3GGZA 2V2MA 1NF4A 2JD70 2D5KA 5GU2X 5GU1X 3BVKA 5FFEA 1JKUA 2BW1A 2ITBA 5K52A 5ERJA 2V2IA 1IERA 3RBCA 5D8RA 2CN7A 4YKHA 4Y08A 3AK9A 1RCIA 2VXIA 3RE7A 3JZAB 3AK8A 4XKTA 5J8WA 4TOFA 1R03A 3FRRA 1OTKA 1YUXA 5ERKA 5HU6D 5D8QA 3R2SA 2V2RA 3VV9A 2YW6A 1VEQA 3BT5A 3BVIA 3E6RA 1YUZA 2BK6A 3PWQA 2ZG7X 3F38A 3TA8A 2G38B 5JACA 5JKMA 3PW1A 4TOBA 1SQ3A 3H7GA 3PZAA 4XGSA 2V2PA 1JYBA 3AJOA 1N1QA 1JI4A 2CLUA 3W54A 3F39A 3QD8A 3MPSA 5FFDA 5J8SA 2FFXJ 5D8OA 2BKCA 4TOCA 3QB9A 4DYXA 5JKLA 3QZ3A 3C1ZA 4KXRB 2Z5QA 3PWQC 4CVSA 2C6RA 4RC6B 3AF9X 4QUWA 2XKQA 4TO9A 2C2JA 1NF6A 4E40A 1TKPA 3FSEA 4ITTA 4DASA 3QHBA 3PVRB 3KA3A 3NOZX 3SIDA 5JDOA 2CHPA 4ZKWA 4LPNA 3VNXA 3GHQA 4ZMCA 4U3GA 3C23A 3C21A 5FFBA 1MOJA 4IXKA 5LG8A 3L0MA 4MY7A 1RCGA 2V8UA 4ZL5A 3WNWA 4ETRA 3Q4RA 2Y3QA 2CIHA 1S30A 1AEWA 4ZLWA 1LB3A 1TJOA 4A25A 1RCEA 2XJOA 5FEJA 3WVWA 4KVRA 4YVZA 3ERZA 4EVBA 3ISFA 2V2NA 5D8YA 1BFRA 4LPJA 1YV1A 1BCFA 1VELA 3KA4A 1GWGA 2XGWA 3E1PA 3BVLA 3NP2X 3E1JA 4IWKA 4RC5B 4TOEA 2N02A 5FFCA 3E1NA 2FKZA 4LYUA 3KA8A 2Y44A 2V2LA 3PWFA 1S3QA 1UVHA 3PVTB 2X170 5J93A 1F33A 2FG4A 2Z5PA 2VXXA 3OJ5A 3BVEA 3RGDA 2MGYA 4LQJA 3AF8X 1O9IA 5HJFA 2GYDA 4AM4A 4PGKA 3R2RA 3E6SA 4ZTTA 3UNOA 2WTLA 1LKMA 5LG2A 4PG0A 2W0OA 1ZS3A 3E2CA 3R2HA 4DI0A 3O7RA 3HL1A 4TOAA 5E2DA 4CMYV 5D8SA 1RCCA 5CMRA 1JKVA 4CVPA 4PG1A 3U90A 4DYYA 1Z6OA 2QQYA 3KA9A 5LBHA 3AJPA 3M6JA 2OKCA 3WVVA 1L8IA 2PYBA 4KVQA 4YXJA 2CWLA 1KRQA 4Z5SA 4EVCA 2XJNA 4II4B 1L8HA 4ZL6A 3F35A 4Z3BA 4R42A 1VJXA 4CVTA 2JD60 5CMQA 3E1LA 2ZG9X 3F37A 2V2OA 1TK6A 1Z6OM 3HIUA 4CMYA 3KX9A 2BJYA 5D8PA 3V3KB 4DZ0A 5GOUA 3PVYB 5GN8B 3ES3A 2ZA8A 3IQ1A 5GU3X 5J9VA 3JZ9A 1XZ1A 1S2ZA 4II4A 4DYZA 3FI6A 1BG7A 3F32A 1H96A 3BKNA 4ZKXA 3GVYA 1JIGA 4CYBA 1LKPA 3EZUA 3C1YA 4OYNA 2Z6MA 1JTSA 4M35A 2WLAA 3RAVA 4LQNA 5E1UA 4MKUA 3UOIA 1O9RA 2XJMA 4MUDA 4RC6A 3UFBA 3EZ0A 4ISPA 4MXPA 3E1MA 5HQOA 4CVRA 5JKMG 3KA6A 1FHAA 3PVRA 2GS4A 2HR5A 2IU2A 2V8TA 4M34A 2GYQA 4CYAA 1QGHA 4ZJKA 2ZA6A 4TW3A 1RCDA 3PW8C 3LKDA 3R2KA 1LKOA 3F33A 2WWXB 3VVAA 4XKUA 1VLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AM5 A;  1DPS A;  3BVF A;  3RD0 A;  5JKL G;  2C41 A;  2IB0 A;  2C2F A;  2C2U A;  2IY4 A;  3SH6 A;  5D8X A;  1Z4A A;  3R2M A;  1JGC A;  4LPM A;  2V15 A;  2YJJ A;  4LQH A;  4ML5 A;  4ITW A;  4RC5 A;  4ERU A;  3PW1 B;  3ISE A;  4MN9 A;  1IES A;  2ZUR X;  5FFA A;  2QF9 A;  1JI5 A;  2V2S A;  3PVT A;  3QHC A;  2CHI A;  4AM2 A;  1QYB A;  4KVS A;  2CN6 A;  2VZB A;  3KXU A;  2RBD A;  3R2O A;  2OC5 A;  2F7N A;  4DYU A;  1TKO A;  2FL0 A;  4DE6 A;  3UOF A;  1NNQ A;  1RYT A;  1MFR A;  4MJY A;  5HJH A;  4EVE A;  2V2J A;  5I4J A;  5K53 A;  2HTN A;  1F30 A;  3Q4O A;  4PGI A;  4CY9 A;  1DAT A;  4LYX A;  4ZKH A;  4RC7 B;  3Q4Q A;  5CZU A;  2UX1 A;  2ZA7 A;  4M33 A;  1UMN A;  4TOG A;  1EUM A;  5AXS A;  3E1O A;  1VEI A;  2YW7 A;  5IX6 A;  4ISM A;  4M32 A;  2CF7 A;  2CLB A;  4IWJ A;  4EVD A;  2CEI A;  2Z90 A;  2FZF A;  1J30 A;  1XZ3 A;  3T9J A;  3SE1 A;  3PW8 A;  3F34 A;  3Q4N A;  3IS8 A;  1HRS A;  2FG8 A;  4RC7 A;  1B71 A;  5GU0 X;  3QVD A;  1SOF A;  4P18 A;  4E6K A;  5C6F A;  2G4H A;  4TOH A;  3GE4 A;  3E1Q A;  2FJC A;  3SHX A;  3AJQ A;  3OGH A;  3AF7 X;  3WVU A;  3FVB A;  3R2L A;  1JRE A;  3PVY A;  3EGM A;  5GN8 A;  2ZG8 X;  2FHA A;  4REU A;  2OH3 A;  4RC8 A;  4TOD A;  3IS7 A;  3A9Q A;  3KWO A;  3F36 A;  3A68 A;  3NP0 X;  1NFV A;  2YJK A;  2WLU A;  5LS9 A;  2Z5R A;  3O7S A;  1ZUJ A;  4XKS A;  4LQV A;  1DVB A;  2JD8 0;  2V2M A;  1NF4 A;  2JD7 0;  2D5K A;  5GU2 X;  5GU1 X;  3BVK A;  5FFE A;  1JKU A;  2BW1 A;  2ITB A;  5K52 A;  5ERJ A;  2V2I A;  1IER A;  3RBC A;  5D8R A;  2CN7 A;  4YKH A;  4Y08 A;  3AK9 A;  1RCI A;  2VXI A;  3RE7 A;  3AK8 A;  4XKT A;  5J8W A;  4TOF A;  1R03 A;  1OTK A;  1YUX A;  5ERK A;  5D8Q A;  3R2S A;  2V2R A;  2YW6 A;  1VEQ A;  3BT5 A;  3BVI A;  3E6R A;  1YUZ A;  2BK6 A;  3PWQ A;  2ZG7 X;  3F38 A;  3TA8 A;  5JAC A;  5JKM A;  3PW1 A;  4TOB A;  1SQ3 A;  3H7G A;  3PZA A;  4XGS A;  2V2P A;  1JYB A;  3AJO A;  1N1Q A;  1JI4 A;  2CLU A;  3F39 A;  3QD8 A;  3MPS A;  5FFD A;  5J8S A;  2FFX J;  5D8O A;  2BKC A;  4TOC A;  3QB9 A;  4DYX A;  5JKL A;  3QZ3 A;  2Z5Q A;  3PWQ C;  4CVS A;  2C6R A;  4RC6 B;  3AF9 X;  4QUW A;  2XKQ A;  4TO9 A;  2C2J A;  1NF6 A;  1TKP A;  3FSE A;  4ITT A;  4DAS A;  3QHB A;  3PVR B;  3KA3 A;  3NOZ X;  3SID A;  2CHP A;  4ZKW A;  4LPN A;  3VNX A;  3GHQ A;  4ZMC A;  4U3G A;  5FFB A;  1MOJ A;  4IXK A;  5LG8 A;  4MY7 A;  1RCG A;  4ZL5 A;  3WNW A;  4ETR A;  3Q4R A;  2Y3Q A;  2CIH A;  1S30 A;  1AEW A;  4ZLW A;  1LB3 A;  1TJO A;  4A25 A;  1RCE A;  2XJO A;  5FEJ A;  3WVW A;  4KVR A;  3ERZ A;  4EVB A;  3ISF A;  2V2N A;  5D8Y A;  1BFR A;  4LPJ A;  1YV1 A;  1BCF A;  1VEL A;  3KA4 A;  1GWG A;  2XGW A;  3E1P A;  3BVL A;  3NP2 X;  3E1J A;  4IWK A;  4RC5 B;  4TOE A;  5FFC A;  3E1N A;  2FKZ A;  4LYU A;  3KA8 A;  2V2L A;  3PWF A;  1S3Q A;  1UVH A;  3PVT B;  2X17 0;  5J93 A;  1F33 A;  2FG4 A;  2Z5P A;  2VXX A;  3OJ5 A;  3BVE A;  3RGD A;  4LQJ A;  3AF8 X;  1O9I A;  5HJF A;  2GYD A;  4AM4 A;  4PGK A;  3R2R A;  3E6S A;  4ZTT A;  3UNO A;  2WTL A;  1LKM A;  5LG2 A;  4PG0 A;  2W0O A;  1ZS3 A;  3E2C A;  3R2H A;  4DI0 A;  3O7R A;  3HL1 A;  4TOA A;  5E2D A;  4CMY V;  5D8S A;  1RCC A;  5CMR A;  1JKV A;  4CVP A;  4PG1 A;  3U90 A;  4DYY A;  1Z6O A;  2QQY A;  3KA9 A;  5LBH A;  3AJP A;  3WVV A;  1L8I A;  2PYB A;  4KVQ A;  1KRQ A;  4Z5S A;  4EVC A;  2XJN A;  4II4 B;  1L8H A;  4ZL6 A;  3F35 A;  4Z3B A;  4R42 A;  1VJX A;  4CVT A;  2JD6 0;  5CMQ A;  3E1L A;  2ZG9 X;  3F37 A;  2V2O A;  1TK6 A;  1Z6O M;  3HIU A;  4CMY A;  3KX9 A;  2BJY A;  5D8P A;  4DZ0 A;  5GOU A;  3PVY B;  5GN8 B;  3ES3 A;  2ZA8 A;  3IQ1 A;  5GU3 X;  5J9V A;  1XZ1 A;  1S2Z A;  4II4 A;  4DYZ A;  3FI6 A;  1BG7 A;  3F32 A;  1H96 A;  3BKN A;  4ZKX A;  3GVY A;  1JIG A;  4CYB A;  1LKP A;  3EZU A;  4OYN A;  2Z6M A;  1JTS A;  4M35 A;  2WLA A;  3RAV A;  4LQN A;  5E1U A;  4MKU A;  3UOI A;  1O9R A;  2XJM A;  4MUD A;  4RC6 A;  3EZ0 A;  4ISP A;  3E1M A;  5HQO A;  4CVR A;  5JKM G;  3KA6 A;  1FHA A;  3PVR A;  2GS4 A;  2HR5 A;  2IU2 A;  4M34 A;  2GYQ A;  4CYA A;  1QGH A;  4ZJK A;  2ZA6 A;  4TW3 A;  1RCD A;  3PW8 C;  3R2K A;  1LKO A;  3F33 A;  4XKU A;  1VLG A; 
#chains in the Genus database with same CATH topology
 4X0J A;  4AM5 A;  1DPS A;  3BVF A;  3RD0 A;  5JKL G;  3KDQ A;  2C41 A;  2IB0 A;  2C2F A;  2C2U A;  2IY4 A;  3DBY A;  3SH6 A;  5D8X A;  1Z4A A;  3R2M A;  1JGC A;  4LPM A;  2V15 A;  2YJJ A;  4LQH A;  4ML5 A;  3KHK A;  4ITW A;  4RC5 A;  4ERU A;  3PW1 B;  3ISE A;  4MN9 A;  1IES A;  2ZUR X;  5FFA A;  2QF9 A;  1JI5 A;  2V2S A;  3PVT A;  3QHC A;  2CHI A;  4AM2 A;  3D19 A;  1QYB A;  4KVS A;  2CN6 A;  3GGY A;  2VZB A;  4YXM A;  3KXU A;  2RBD A;  3R2O A;  2OC5 A;  2F7N A;  4DYU A;  1TKO A;  2FL0 A;  3N6O A;  4DE6 A;  4W4K B;  3UOF A;  1NNQ A;  1RYT A;  1MFR A;  4MJY A;  5HJH A;  4EVE A;  2V2J A;  5I4J A;  5K53 A;  2HTN A;  1F30 A;  3Q4O A;  4PGI A;  4CY9 A;  1DAT A;  4LYX A;  4ZKH A;  4RC7 B;  3Q4Q A;  5CZU A;  2UX1 A;  2ZA7 A;  4M33 A;  1UMN A;  4TOG A;  1EUM A;  5JDO B;  5AXS A;  3E1O A;  1VEI A;  2YW7 A;  5IX6 A;  4ISM A;  4M32 A;  2CF7 A;  4WJG 4;  2CLB A;  4IWJ A;  4W4L B;  4EVD A;  2CEI A;  2Z90 A;  2FZF A;  1J30 A;  1XZ3 A;  3T9J A;  3SE1 A;  3PW8 A;  3F34 A;  3Q4N A;  3IS8 A;  1HRS A;  2FG8 A;  4RC7 A;  1B71 A;  5GU0 X;  3QVD A;  1SOF A;  4P18 A;  4E6K A;  5C6F A;  2G4H A;  4TOH A;  3GE4 A;  3E1Q A;  2FJC A;  3SHX A;  3AJQ A;  3OGH A;  3AF7 X;  3WVU A;  3FVB A;  3R2L A;  1JRE A;  3PVY A;  3EGM A;  5GN8 A;  2ZG8 X;  2FHA A;  4REU A;  2AR0 A;  2OH3 A;  4RC8 A;  3IS7 A;  4TOD A;  3A9Q A;  3KWO A;  3F36 A;  3A68 A;  3FRS A;  3NP0 X;  1NFV A;  2YJK A;  2WLU A;  5LS9 A;  2Z5R A;  3O7S A;  1ZUJ A;  4XKS A;  4LQV A;  1DVB A;  2JD8 0;  3GGZ A;  2V2M A;  1NF4 A;  2JD7 0;  2D5K A;  5GU2 X;  5GU1 X;  3BVK A;  5FFE A;  1JKU A;  2BW1 A;  2ITB A;  5K52 A;  5ERJ A;  2V2I A;  1IER A;  3RBC A;  5D8R A;  2CN7 A;  4YKH A;  4Y08 A;  3AK9 A;  1RCI A;  2VXI A;  3RE7 A;  3JZA B;  3AK8 A;  4XKT A;  5J8W A;  4TOF A;  1R03 A;  3FRR A;  1OTK A;  1YUX A;  5ERK A;  5HU6 D;  5D8Q A;  3R2S A;  2V2R A;  3VV9 A;  2YW6 A;  1VEQ A;  3BT5 A;  3BVI A;  3E6R A;  1YUZ A;  2BK6 A;  3PWQ A;  2ZG7 X;  3F38 A;  3TA8 A;  2G38 B;  5JAC A;  5JKM A;  3PW1 A;  4TOB A;  1SQ3 A;  3H7G A;  3PZA A;  4XGS A;  2V2P A;  1JYB A;  3AJO A;  1N1Q A;  1JI4 A;  2CLU A;  3W54 A;  3F39 A;  3QD8 A;  3MPS A;  5FFD A;  5J8S A;  2FFX J;  5D8O A;  2BKC A;  4TOC A;  3QB9 A;  4DYX A;  5JKL A;  3QZ3 A;  3C1Z A;  4KXR B;  2Z5Q A;  3PWQ C;  4CVS A;  2C6R A;  4RC6 B;  3AF9 X;  4QUW A;  2XKQ A;  4TO9 A;  2C2J A;  1NF6 A;  4E40 A;  1TKP A;  3FSE A;  4ITT A;  4DAS A;  3QHB A;  3PVR B;  3KA3 A;  3NOZ X;  3SID A;  5JDO A;  2CHP A;  4ZKW A;  4LPN A;  3VNX A;  3GHQ A;  4ZMC A;  4U3G A;  3C23 A;  3C21 A;  5FFB A;  1MOJ A;  4IXK A;  5LG8 A;  3L0M A;  4MY7 A;  1RCG A;  2V8U A;  4ZL5 A;  3WNW A;  4ETR A;  3Q4R A;  2Y3Q A;  2CIH A;  1S30 A;  1AEW A;  4ZLW A;  1LB3 A;  1TJO A;  4A25 A;  1RCE A;  2XJO A;  5FEJ A;  3WVW A;  4KVR A;  4YVZ A;  3ERZ A;  4EVB A;  3ISF A;  2V2N A;  5D8Y A;  1BFR A;  4LPJ A;  1YV1 A;  1BCF A;  1VEL A;  3KA4 A;  1GWG A;  2XGW A;  3E1P A;  3BVL A;  3NP2 X;  3E1J A;  4IWK A;  4RC5 B;  4TOE A;  2N02 A;  5FFC A;  3E1N A;  2FKZ A;  4LYU A;  3KA8 A;  2Y44 A;  2V2L A;  3PWF A;  1S3Q A;  1UVH A;  3PVT B;  2X17 0;  5J93 A;  1F33 A;  2FG4 A;  2Z5P A;  2VXX A;  3OJ5 A;  3BVE A;  3RGD A;  2MGY A;  4LQJ A;  3AF8 X;  1O9I A;  5HJF A;  2GYD A;  4AM4 A;  4PGK A;  3R2R A;  3E6S A;  4ZTT A;  3UNO A;  2WTL A;  1LKM A;  5LG2 A;  4PG0 A;  2W0O A;  1ZS3 A;  3E2C A;  3R2H A;  4DI0 A;  3O7R A;  3HL1 A;  4TOA A;  5E2D A;  4CMY V;  5D8S A;  1RCC A;  5CMR A;  1JKV A;  4CVP A;  4PG1 A;  3U90 A;  4DYY A;  1Z6O A;  2QQY A;  3KA9 A;  5LBH A;  3AJP A;  3M6J A;  2OKC A;  3WVV A;  1L8I A;  2PYB A;  4KVQ A;  4YXJ A;  2CWL A;  1KRQ A;  4Z5S A;  4EVC A;  2XJN A;  4II4 B;  1L8H A;  4ZL6 A;  3F35 A;  4Z3B A;  4R42 A;  1VJX A;  4CVT A;  2JD6 0;  5CMQ A;  3E1L A;  2ZG9 X;  3F37 A;  2V2O A;  1TK6 A;  1Z6O M;  3HIU A;  4CMY A;  3KX9 A;  2BJY A;  5D8P A;  3V3K B;  4DZ0 A;  5GOU A;  3PVY B;  5GN8 B;  3ES3 A;  2ZA8 A;  3IQ1 A;  5GU3 X;  5J9V A;  3JZ9 A;  1XZ1 A;  1S2Z A;  4II4 A;  4DYZ A;  3FI6 A;  1BG7 A;  3F32 A;  1H96 A;  3BKN A;  4ZKX A;  3GVY A;  1JIG A;  4CYB A;  1LKP A;  3EZU A;  3C1Y A;  4OYN A;  2Z6M A;  1JTS A;  4M35 A;  2WLA A;  3RAV A;  4LQN A;  5E1U A;  4MKU A;  3UOI A;  1O9R A;  2XJM A;  4MUD A;  4RC6 A;  3UFB A;  3EZ0 A;  4ISP A;  4MXP A;  3E1M A;  5HQO A;  4CVR A;  5JKM G;  3KA6 A;  1FHA A;  3PVR A;  2GS4 A;  2HR5 A;  2IU2 A;  2V8T A;  4M34 A;  2GYQ A;  4CYA A;  1QGH A;  4ZJK A;  2ZA6 A;  4TW3 A;  1RCD A;  3PW8 C;  3LKD A;  3R2K A;  1LKO A;  3F33 A;  2WWX B;  3VVA A;  4XKU A;  1VLG A; 
#chains in the Genus database with same CATH homology
 4X0J A;  4AM5 A;  1DPS A;  3BVF A;  3RD0 A;  5JKL G;  3KDQ A;  2C41 A;  2IB0 A;  2C2F A;  2C2U A;  2IY4 A;  3DBY A;  3SH6 A;  5D8X A;  1Z4A A;  3R2M A;  1JGC A;  4LPM A;  2V15 A;  2YJJ A;  4LQH A;  4ML5 A;  3KHK A;  4ITW A;  4RC5 A;  4ERU A;  3PW1 B;  3ISE A;  4MN9 A;  1IES A;  2ZUR X;  5FFA A;  2QF9 A;  1JI5 A;  2V2S A;  3PVT A;  3QHC A;  2CHI A;  4AM2 A;  3D19 A;  1QYB A;  4KVS A;  2CN6 A;  3GGY A;  2VZB A;  4YXM A;  3KXU A;  2RBD A;  3R2O A;  2OC5 A;  2F7N A;  4DYU A;  1TKO A;  2FL0 A;  3N6O A;  4DE6 A;  4W4K B;  3UOF A;  1NNQ A;  1RYT A;  1MFR A;  4MJY A;  5HJH A;  4EVE A;  2V2J A;  5I4J A;  5K53 A;  2HTN A;  1F30 A;  3Q4O A;  4PGI A;  4CY9 A;  1DAT A;  4LYX A;  4ZKH A;  4RC7 B;  3Q4Q A;  5CZU A;  2UX1 A;  2ZA7 A;  4M33 A;  1UMN A;  4TOG A;  1EUM A;  5JDO B;  5AXS A;  3E1O A;  1VEI A;  2YW7 A;  5IX6 A;  4ISM A;  4M32 A;  2CF7 A;  4WJG 4;  2CLB A;  4IWJ A;  4W4L B;  4EVD A;  2CEI A;  2Z90 A;  2FZF A;  1J30 A;  1XZ3 A;  3T9J A;  3SE1 A;  3PW8 A;  3F34 A;  3Q4N A;  3IS8 A;  1HRS A;  2FG8 A;  4RC7 A;  1B71 A;  5GU0 X;  3QVD A;  1SOF A;  4P18 A;  4E6K A;  5C6F A;  2G4H A;  4TOH A;  3GE4 A;  3E1Q A;  2FJC A;  3SHX A;  3AJQ A;  3OGH A;  3AF7 X;  3WVU A;  3FVB A;  3R2L A;  1JRE A;  3PVY A;  3EGM A;  5GN8 A;  2ZG8 X;  2FHA A;  4REU A;  2AR0 A;  2OH3 A;  4RC8 A;  3IS7 A;  4TOD A;  3A9Q A;  3KWO A;  3F36 A;  3A68 A;  3FRS A;  3NP0 X;  1NFV A;  2YJK A;  2WLU A;  5LS9 A;  2Z5R A;  3O7S A;  1ZUJ A;  4XKS A;  4LQV A;  1DVB A;  2JD8 0;  3GGZ A;  2V2M A;  1NF4 A;  2JD7 0;  2D5K A;  5GU2 X;  5GU1 X;  3BVK A;  5FFE A;  1JKU A;  2BW1 A;  2ITB A;  5K52 A;  5ERJ A;  2V2I A;  1IER A;  3RBC A;  5D8R A;  2CN7 A;  4YKH A;  4Y08 A;  3AK9 A;  1RCI A;  2VXI A;  3RE7 A;  3JZA B;  3AK8 A;  4XKT A;  5J8W A;  4TOF A;  1R03 A;  3FRR A;  1OTK A;  1YUX A;  5ERK A;  5HU6 D;  5D8Q A;  3R2S A;  2V2R A;  3VV9 A;  2YW6 A;  1VEQ A;  3BT5 A;  3BVI A;  3E6R A;  1YUZ A;  2BK6 A;  3PWQ A;  2ZG7 X;  3F38 A;  3TA8 A;  2G38 B;  5JAC A;  5JKM A;  3PW1 A;  4TOB A;  1SQ3 A;  3H7G A;  3PZA A;  4XGS A;  2V2P A;  1JYB A;  3AJO A;  1N1Q A;  1JI4 A;  2CLU A;  3W54 A;  3F39 A;  3QD8 A;  3MPS A;  5FFD A;  5J8S A;  2FFX J;  5D8O A;  2BKC A;  4TOC A;  3QB9 A;  4DYX A;  5JKL A;  3QZ3 A;  3C1Z A;  4KXR B;  2Z5Q A;  3PWQ C;  4CVS A;  2C6R A;  4RC6 B;  3AF9 X;  4QUW A;  2XKQ A;  4TO9 A;  2C2J A;  1NF6 A;  4E40 A;  1TKP A;  3FSE A;  4ITT A;  4DAS A;  3QHB A;  3PVR B;  3KA3 A;  3NOZ X;  3SID A;  5JDO A;  2CHP A;  4ZKW A;  4LPN A;  3VNX A;  3GHQ A;  4ZMC A;  4U3G A;  3C23 A;  3C21 A;  5FFB A;  1MOJ A;  4IXK A;  5LG8 A;  3L0M A;  4MY7 A;  1RCG A;  2V8U A;  4ZL5 A;  3WNW A;  4ETR A;  3Q4R A;  2Y3Q A;  2CIH A;  1S30 A;  1AEW A;  4ZLW A;  1LB3 A;  1TJO A;  4A25 A;  1RCE A;  2XJO A;  5FEJ A;  3WVW A;  4KVR A;  4YVZ A;  3ERZ A;  4EVB A;  3ISF A;  2V2N A;  5D8Y A;  1BFR A;  4LPJ A;  1YV1 A;  1BCF A;  1VEL A;  3KA4 A;  1GWG A;  2XGW A;  3E1P A;  3BVL A;  3NP2 X;  3E1J A;  4IWK A;  4RC5 B;  4TOE A;  2N02 A;  5FFC A;  3E1N A;  2FKZ A;  4LYU A;  3KA8 A;  2Y44 A;  2V2L A;  3PWF A;  1S3Q A;  1UVH A;  3PVT B;  2X17 0;  5J93 A;  1F33 A;  2FG4 A;  2Z5P A;  2VXX A;  3OJ5 A;  3BVE A;  3RGD A;  2MGY A;  4LQJ A;  3AF8 X;  1O9I A;  5HJF A;  2GYD A;  4AM4 A;  4PGK A;  3R2R A;  3E6S A;  4ZTT A;  3UNO A;  2WTL A;  1LKM A;  5LG2 A;  4PG0 A;  2W0O A;  1ZS3 A;  3E2C A;  3R2H A;  4DI0 A;  3O7R A;  3HL1 A;  4TOA A;  5E2D A;  4CMY V;  5D8S A;  1RCC A;  5CMR A;  1JKV A;  4CVP A;  4PG1 A;  3U90 A;  4DYY A;  1Z6O A;  2QQY A;  3KA9 A;  5LBH A;  3AJP A;  3M6J A;  2OKC A;  3WVV A;  1L8I A;  2PYB A;  4KVQ A;  4YXJ A;  2CWL A;  1KRQ A;  4Z5S A;  4EVC A;  2XJN A;  4II4 B;  1L8H A;  4ZL6 A;  3F35 A;  4Z3B A;  4R42 A;  1VJX A;  4CVT A;  2JD6 0;  5CMQ A;  3E1L A;  2ZG9 X;  3F37 A;  2V2O A;  1TK6 A;  1Z6O M;  3HIU A;  4CMY A;  3KX9 A;  2BJY A;  5D8P A;  3V3K B;  4DZ0 A;  5GOU A;  3PVY B;  5GN8 B;  3ES3 A;  2ZA8 A;  3IQ1 A;  5GU3 X;  5J9V A;  3JZ9 A;  1XZ1 A;  1S2Z A;  4II4 A;  4DYZ A;  3FI6 A;  1BG7 A;  3F32 A;  1H96 A;  3BKN A;  4ZKX A;  3GVY A;  1JIG A;  4CYB A;  1LKP A;  3EZU A;  3C1Y A;  4OYN A;  2Z6M A;  1JTS A;  4M35 A;  2WLA A;  3RAV A;  4LQN A;  5E1U A;  4MKU A;  3UOI A;  1O9R A;  2XJM A;  4MUD A;  4RC6 A;  3UFB A;  3EZ0 A;  4ISP A;  4MXP A;  3E1M A;  5HQO A;  4CVR A;  5JKM G;  3KA6 A;  1FHA A;  3PVR A;  2GS4 A;  2HR5 A;  2IU2 A;  2V8T A;  4M34 A;  2GYQ A;  4CYA A;  1QGH A;  4ZJK A;  2ZA6 A;  4TW3 A;  1RCD A;  3PW8 C;  3LKD A;  3R2K A;  1LKO A;  3F33 A;  2WWX B;  3VVA A;  4XKU A;  1VLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...