3PW1B

The phenylacetyl-coa monooxygenase paaac subcomplex with phenylacetyl-coa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
237
structure length
237
Chain Sequence
SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Phenylacetic acid degradation protein paaA
publication title Structural and Functional Studies of the Escherichia coli Phenylacetyl-CoA Monooxygenase Complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 102
structure length 237
sequence length 237
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pw1B00
1S2ZA 4DI0A 2WLUA 3PWQC 4AM2A 3BVEA 4LQJA 3E1PA 4DASA 2FL0A 1ZUJA 3R2RA 4CYBA 1VEQA 2ZA6A 3E1LA 5HJFA 3E1JA 3BVIA 5HJHA 1F30A 1IERA 2BK6A 3QD8A 4TOHA 4TOEA 2UX1A 4Z5SA 3OGHA 2WTLA 2ZG8X 3WVVA 3AF8X 1TKOA 3ISFA 4KVRA 1JTSA 5GN8A 2V2NA 5D8XA 5D8YA 3RGDA 3PZAA 5FFCA 4DYYA 1YV1A 2ZA7A 3QHCA 5D8OA 3Q4RA 4ISPA 3PWFA 3IS8A 5JACA 3NP2X 1L8IA 2QF9A 3EZUA 3BVKA 2BW1A 5D8PA 3A9QA 3A68A 5J8SA 3AJQA 1RCDA 5IX6A 1XZ1A 5J8WA 4YKHA 3F38A 4ISMA 3Q4QA 2RBDA 2W0OA 3AJOA 5LG8A 5GU0X 1Z4AA 2ZG7X 2PYBA 4E6KA 5ERJA 2IB0A 4MKUA 3R2KA 1VEIA 3UOFA 4DYZA 2V2JA 4KVSA 1O9IA 4M35A 1F33A 3E2CA 3FSEA 3FVBA 1NFVA 3AF9X 2YJKA 2FFXJ 1JYBA 3VNXA 3E6RA 4LYXA 3F35A 1RCIA 1DPSA 4QUWA 2X170 3AF7X 2V2SA 4A25A 4EVCA 4ZKWA 2GS4A 2Z6MA 4DE6A 2CF7A 4DYXA 2FJCA 3AJPA 3U90A 3HL1A 3R2SA 2VXXA 4M32A 4OYNA 3E1QA 3E1MA 1Z6OA 3BT5A 3R2MA 2XJNA 1BCFA 1HRSA 4TOFA 4LQHA 3EZ0A 2FKZA 3ERZA 1RCGA 1LKPA 3F33A 4LYUA 5FEJA 1BFRA 3KA9A 2V2MA 3UOIA 3GE4A 4ZL5A 5JKMA 1QGHA 4M33A 1AEWA 3ES3A 4ITWA 3E1NA 1H96A 1R03A 2FG8A 4ML5A 4ETRA 5J9VA 2VZBA 2CN6A 4MUDA 5LG2A 1GWGA 1RCEA 5CMRA 5JKLG 3BKNA 4CVSA 2YJJA 5FFBA 4CMYV 3KWOA 2XJOA 4EVEA 4KVQA 2F7NA 5I4JA 1LB3A 2C2JA 3NOZX 4LPNA 3PVTB 3KXUA 2V2RA 1S3QA 3KA3A 4RC5B 2JD60 4MN9A 4ZLWA 4PGKA 3EGMA 3KX9A 5D8RA 4XKUA 3F39A 4U3GA 1VLGA 4TW3A 3E6SA 5FFDA 4ZJKA 4Z3BA 2V2IA 1IESA 2XGWA 5CZUA 4MY7A 1FHAA 5HQOA 2C2FA 3SHXA 1JKUA 1YUZA 5CMQA 1MFRA 3SIDA 5ERKA 3MPSA 2XKQA 1TK6A 3QZ3A 2ZA8A 4DZ0A 2ZG9X 1UVHA 4TO9A 4IWJA 1MOJA 4TOBA 3KA8A 1SOFA 3Q4OA 1TKPA 5C6FA 2QQYA 2FHAA 4PGIA 4RC7B 4LPJA 2Z5PA 2GYQA 4ZMCA 2YW6A 3PW8A 1EUMA 1ZS3A 3GHQA 2HR5A 5E1UA 3PVRB 2JD70 2FG4A 4MJYA 3HIUA 3PVTA 5GU3X 1Z6OM 2V2OA 4DYUA 2CLBA 5FFEA 2V2PA 2FZFA 1XZ3A 4RC5A 2C2UA 2OC5A 4PG1A 5GU1X 3R2OA 4XKTA 3F36A 3PW8C 3BVLA 4CVTA 2CHPA 1LKMA 2IU2A 2BJYA 1TJOA 2Z5QA 2GYDA 1JI5A 3IS7A 4EVBA 1YUXA 3NP0X 3RE7A 5J93A 4CVPA 4M34A 2YW7A 5GOUA 4TOAA 3Q4NA 2V2LA 5LS9A 3RBCA 1JGCA 4PG0A 4AM4A 2HTNA 2V15A 3GVYA 1L8HA 1LKOA 4REUA 3KA6A 4CY9A 2ZURX 3WVUA 1JKVA 3RD0A 2CN7A 3E1OA 4RC7A 2Z90A 3ISEA 3PVRA 4CMYA 3UNOA 2CLUA 4II4B 5K52A 3F34A 3PW1B 1OTKA 5E2DA 3AK9A 1NF4A 2Y3QA 5GU2X 4LPMA 3RAVA 3O7SA 3WVWA 3F37A 1NNQA 1KRQA 1JIGA 3FI6A 4RC6B 3BVFA 2IY4A 2WLAA 1RCCA 2ITBA 1S30A 2D5KA 1NF6A 3PVYB 1J30A 4ERUA 1BG7A 4IXKA 4TODA 4LQVA 1VJXA 4XKSA 3O7RA 3TA8A 4ZKXA 4AM5A 5JKLA 4ZKHA 1VELA 5D8SA 1B71A 4TOGA 3T9JA 1DVBA 4LQNA 2JD80 4ZTTA 2CIHA 4ZL6A 2C6RA 3KA4A 4Y08A 1N1QA 2Z5RA 3R2HA 5FFAA 5D8QA 5K53A 4II4A 3QHBA 3WNWA 1JREA 5JKMG 5LBHA 3H7GA 3PW1A 1UMNA 3IQ1A 4CVRA 2XJMA 2G4HA 2BKCA 5AXSA 1O9RA 2CHIA 3QVDA 1SQ3A 4RC8A 1QYBA 3QB9A 4RC6A 3PWQA 3R2LA 4P18A 5GN8B 1DATA 2VXIA 3OJ5A 2C41A 3F32A 4R42A 3PVYA 1JI4A 2OH3A 3SE1A 4ITTA 3SH6A 4IWKA 4XGSA 3AK8A 2CEIA 4TOCA 1RYTA 4CYAA 4EVDA
chains in the Genus database with same CATH superfamily
1S2ZA 2AR0A 4DI0A 2WLUA 3PWQC 4AM2A 3BVEA 4LQJA 3E1PA 4W4LB 4DASA 2FL0A 1ZUJA 3R2RA 4CYBA 1VEQA 2ZA6A 3E1LA 5HJFA 3E1JA 3BVIA 5HJHA 1F30A 1IERA 2BK6A 3QD8A 4TOHA 3L0MA 4TOEA 2UX1A 4Z5SA 3OGHA 2WTLA 2ZG8X 3WVVA 3AF8X 1TKOA 3ISFA 3VVAA 4KVRA 1JTSA 5GN8A 2V2NA 5D8XA 5D8YA 3RGDA 3PZAA 5FFCA 4DYYA 1YV1A 2ZA7A 3QHCA 5D8OA 3Q4RA 4ISPA 3PWFA 3IS8A 3KDQA 5JACA 3NP2X 1L8IA 2QF9A 3EZUA 3BVKA 2BW1A 5D8PA 2V8UA 3A9QA 3A68A 5J8SA 3AJQA 1RCDA 5IX6A 1XZ1A 5J8WA 4YKHA 3F38A 4ISMA 3Q4QA 2RBDA 2W0OA 3AJOA 5LG8A 5GU0X 1Z4AA 2ZG7X 2PYBA 4E6KA 5ERJA 2IB0A 4MKUA 3R2KA 1VEIA 3UOFA 4DYZA 2V2JA 4KVSA 1O9IA 4M35A 1F33A 3E2CA 3FSEA 3FVBA 1NFVA 4YVZA 3AF9X 2YJKA 2FFXJ 5JDOB 1JYBA 3VNXA 3E6RA 4LYXA 3F35A 1RCIA 1DPSA 4QUWA 3VV9A 2X170 3AF7X 2V2SA 3JZ9A 4A25A 4EVCA 4ZKWA 2GS4A 2Z6MA 4DE6A 2CF7A 2V8TA 4DYXA 2FJCA 3AJPA 3U90A 3HL1A 3R2SA 2VXXA 4M32A 4OYNA 3E1QA 3E1MA 1Z6OA 3BT5A 2N02A 4WJG4 3R2MA 2XJNA 1BCFA 1HRSA 4TOFA 4LQHA 4W4KB 3EZ0A 2FKZA 3ERZA 1RCGA 1LKPA 3F33A 4LYUA 5FEJA 1BFRA 3KA9A 2V2MA 3UOIA 3GE4A 3D19A 4ZL5A 4MXPA 5JKMA 1QGHA 4M33A 1AEWA 3ES3A 4ITWA 3E1NA 1H96A 3C23A 1R03A 2FG8A 4ML5A 4ETRA 5J9VA 2VZBA 2CN6A 4MUDA 5JDOA 5LG2A 1GWGA 1RCEA 3N6OA 5CMRA 5JKLG 3BKNA 4CVSA 2YJJA 5FFBA 4CMYV 3KWOA 2XJOA 4EVEA 4KVQA 2F7NA 5I4JA 3C1YA 1LB3A 2C2JA 3NOZX 4LPNA 3PVTB 3KXUA 2V2RA 1S3QA 3KA3A 3M6JA 4RC5B 2JD60 4MN9A 4ZLWA 3JZAB 4PGKA 3EGMA 3KX9A 5D8RA 4XKUA 3F39A 4U3GA 1VLGA 4TW3A 3E6SA 5FFDA 4ZJKA 4YXJA 4Z3BA 2V2IA 1IESA 2XGWA 5CZUA 4MY7A 1FHAA 5HQOA 2C2FA 3SHXA 1JKUA 1YUZA 5CMQA 1MFRA 3SIDA 5ERKA 3FRSA 3MPSA 2XKQA 1TK6A 3QZ3A 2ZA8A 3FRRA 2ZG9X 4DZ0A 4X0JA 1UVHA 4TO9A 4IWJA 1MOJA 4TOBA 3KA8A 1SOFA 3Q4OA 1TKPA 5C6FA 2OKCA 2QQYA 2FHAA 4PGIA 4RC7B 4LPJA 4KXRB 2Z5PA 2GYQA 4ZMCA 2YW6A 3PW8A 1EUMA 1ZS3A 3GHQA 2HR5A 5E1UA 3PVRB 2JD70 2FG4A 4MJYA 3HIUA 3PVTA 5GU3X 1Z6OM 2V2OA 4DYUA 3LKDA 2CLBA 5FFEA 2V2PA 2FZFA 1XZ3A 4RC5A 2C2UA 2OC5A 4PG1A 5GU1X 3R2OA 4XKTA 3F36A 2MGYA 3BVLA 3PW8C 4CVTA 2CHPA 1LKMA 2IU2A 2BJYA 1TJOA 2Z5QA 2GYDA 1JI5A 3IS7A 4EVBA 1YUXA 3NP0X 2G38B 3RE7A 5J93A 4CVPA 4M34A 2YW7A 5GOUA 4TOAA 3Q4NA 2V2LA 5LS9A 3RBCA 1JGCA 4PG0A 4AM4A 2HTNA 2V15A 3GVYA 3DBYA 1L8HA 1LKOA 4REUA 3KA6A 4CY9A 3W54A 2ZURX 3WVUA 1JKVA 3RD0A 2CN7A 3E1OA 4RC7A 2Z90A 3ISEA 3PVRA 4CMYA 3UNOA 2CLUA 4II4B 5K52A 3F34A 3PW1B 1OTKA 5E2DA 3AK9A 1NF4A 2Y3QA 5GU2X 4LPMA 3RAVA 3O7SA 3WVWA 3F37A 1NNQA 1KRQA 1JIGA 3FI6A 4RC6B 3BVFA 2IY4A 2WLAA 1RCCA 2ITBA 1S30A 2D5KA 4E40A 1NF6A 3PVYB 1J30A 4ERUA 1BG7A 4IXKA 4TODA 4LQVA 1VJXA 4XKSA 3O7RA 2WWXB 3TA8A 3UFBA 4ZKXA 4AM5A 5JKLA 4ZKHA 1VELA 5D8SA 4YXMA 1B71A 4TOGA 3T9JA 1DVBA 4LQNA 3C1ZA 3V3KB 2JD80 4ZTTA 2CIHA 4ZL6A 2C6RA 3KA4A 4Y08A 1N1QA 2Z5RA 3R2HA 5FFAA 5D8QA 3KHKA 5K53A 4II4A 3QHBA 2Y44A 3WNWA 1JREA 5JKMG 5LBHA 3H7GA 3PW1A 1UMNA 3GGYA 3IQ1A 4CVRA 2XJMA 2G4HA 2BKCA 3C21A 5AXSA 1O9RA 2CHIA 3QVDA 1SQ3A 4RC8A 1QYBA 3QB9A 4RC6A 3PWQA 3R2LA 4P18A 5GN8B 1DATA 2VXIA 3OJ5A 2C41A 3GGZA 3F32A 4R42A 3PVYA 1JI4A 2OH3A 3SE1A 4ITTA 3SH6A 4IWKA 2CWLA 4XGSA 3AK8A 2CEIA 4TOCA 1RYTA 4CYAA 4EVDA 5HU6D
chains in the Genus database with same CATH topology
1S2ZA 2AR0A 4DI0A 2WLUA 3PWQC 4AM2A 3BVEA 4LQJA 3E1PA 4W4LB 4DASA 2FL0A 1ZUJA 3R2RA 4CYBA 1VEQA 2ZA6A 3E1LA 5HJFA 3E1JA 3BVIA 5HJHA 1F30A 1IERA 2BK6A 3QD8A 4TOHA 3L0MA 4TOEA 2UX1A 4Z5SA 3OGHA 2WTLA 2ZG8X 3WVVA 3AF8X 1TKOA 3ISFA 3VVAA 4KVRA 1JTSA 5GN8A 2V2NA 5D8XA 5D8YA 3RGDA 3PZAA 5FFCA 4DYYA 1YV1A 2ZA7A 3QHCA 5D8OA 3Q4RA 4ISPA 3PWFA 3IS8A 3KDQA 5JACA 3NP2X 1L8IA 2QF9A 3EZUA 3BVKA 2BW1A 5D8PA 2V8UA 3A9QA 3A68A 5J8SA 3AJQA 1RCDA 5IX6A 1XZ1A 5J8WA 4YKHA 3F38A 4ISMA 3Q4QA 2RBDA 2W0OA 3AJOA 5LG8A 5GU0X 1Z4AA 2ZG7X 2PYBA 4E6KA 5ERJA 2IB0A 4MKUA 3R2KA 1VEIA 3UOFA 4DYZA 2V2JA 4KVSA 1O9IA 4M35A 1F33A 3E2CA 3FSEA 3FVBA 1NFVA 4YVZA 3AF9X 2YJKA 2FFXJ 5JDOB 1JYBA 3VNXA 3E6RA 4LYXA 3F35A 1RCIA 1DPSA 4QUWA 3VV9A 2X170 3AF7X 2V2SA 3JZ9A 4A25A 4EVCA 4ZKWA 2GS4A 2Z6MA 4DE6A 2CF7A 2V8TA 4DYXA 2FJCA 3AJPA 3U90A 3HL1A 3R2SA 2VXXA 4M32A 4OYNA 3E1QA 3E1MA 1Z6OA 3BT5A 2N02A 4WJG4 3R2MA 2XJNA 1BCFA 1HRSA 4TOFA 4LQHA 4W4KB 3EZ0A 2FKZA 3ERZA 1RCGA 1LKPA 3F33A 4LYUA 5FEJA 1BFRA 3KA9A 2V2MA 3UOIA 3GE4A 3D19A 4ZL5A 4MXPA 5JKMA 1QGHA 4M33A 1AEWA 3ES3A 4ITWA 3E1NA 1H96A 3C23A 1R03A 2FG8A 4ML5A 4ETRA 5J9VA 2VZBA 2CN6A 4MUDA 5JDOA 5LG2A 1GWGA 1RCEA 3N6OA 5CMRA 5JKLG 3BKNA 4CVSA 2YJJA 5FFBA 4CMYV 3KWOA 2XJOA 4EVEA 4KVQA 2F7NA 5I4JA 3C1YA 1LB3A 2C2JA 3NOZX 4LPNA 3PVTB 3KXUA 2V2RA 1S3QA 3KA3A 3M6JA 4RC5B 2JD60 4MN9A 4ZLWA 3JZAB 4PGKA 3EGMA 3KX9A 5D8RA 4XKUA 3F39A 4U3GA 1VLGA 4TW3A 3E6SA 5FFDA 4ZJKA 4YXJA 4Z3BA 2V2IA 1IESA 2XGWA 5CZUA 4MY7A 1FHAA 5HQOA 2C2FA 3SHXA 1JKUA 1YUZA 5CMQA 1MFRA 3SIDA 5ERKA 3FRSA 3MPSA 2XKQA 1TK6A 3QZ3A 2ZA8A 3FRRA 2ZG9X 4DZ0A 4X0JA 1UVHA 4TO9A 4IWJA 1MOJA 4TOBA 3KA8A 1SOFA 3Q4OA 1TKPA 5C6FA 2OKCA 2QQYA 2FHAA 4PGIA 4RC7B 4LPJA 4KXRB 2Z5PA 2GYQA 4ZMCA 2YW6A 3PW8A 1EUMA 1ZS3A 3GHQA 2HR5A 5E1UA 3PVRB 2JD70 2FG4A 4MJYA 3HIUA 3PVTA 5GU3X 1Z6OM 2V2OA 4DYUA 3LKDA 2CLBA 5FFEA 2V2PA 2FZFA 1XZ3A 4RC5A 2C2UA 2OC5A 4PG1A 5GU1X 3R2OA 4XKTA 3F36A 2MGYA 3BVLA 3PW8C 4CVTA 2CHPA 1LKMA 2IU2A 2BJYA 1TJOA 2Z5QA 2GYDA 1JI5A 3IS7A 4EVBA 1YUXA 3NP0X 2G38B 3RE7A 5J93A 4CVPA 4M34A 2YW7A 5GOUA 4TOAA 3Q4NA 2V2LA 5LS9A 3RBCA 1JGCA 4PG0A 4AM4A 2HTNA 2V15A 3GVYA 3DBYA 1L8HA 1LKOA 4REUA 3KA6A 4CY9A 3W54A 2ZURX 3WVUA 1JKVA 3RD0A 2CN7A 3E1OA 4RC7A 2Z90A 3ISEA 3PVRA 4CMYA 3UNOA 2CLUA 4II4B 5K52A 3F34A 3PW1B 1OTKA 5E2DA 3AK9A 1NF4A 2Y3QA 5GU2X 4LPMA 3RAVA 3O7SA 3WVWA 3F37A 1NNQA 1KRQA 1JIGA 3FI6A 4RC6B 3BVFA 2IY4A 2WLAA 1RCCA 2ITBA 1S30A 2D5KA 4E40A 1NF6A 3PVYB 1J30A 4ERUA 1BG7A 4IXKA 4TODA 4LQVA 1VJXA 4XKSA 3O7RA 2WWXB 3TA8A 3UFBA 4ZKXA 4AM5A 5JKLA 4ZKHA 1VELA 5D8SA 4YXMA 1B71A 4TOGA 3T9JA 1DVBA 4LQNA 3C1ZA 3V3KB 2JD80 4ZTTA 2CIHA 4ZL6A 2C6RA 3KA4A 4Y08A 1N1QA 2Z5RA 3R2HA 5FFAA 5D8QA 3KHKA 5K53A 4II4A 3QHBA 2Y44A 3WNWA 1JREA 5JKMG 5LBHA 3H7GA 3PW1A 1UMNA 3GGYA 3IQ1A 4CVRA 2XJMA 2G4HA 2BKCA 3C21A 5AXSA 1O9RA 2CHIA 3QVDA 1SQ3A 4RC8A 1QYBA 3QB9A 4RC6A 3PWQA 3R2LA 4P18A 5GN8B 1DATA 2VXIA 3OJ5A 2C41A 3GGZA 3F32A 4R42A 3PVYA 1JI4A 2OH3A 3SE1A 4ITTA 3SH6A 4IWKA 2CWLA 4XGSA 3AK8A 2CEIA 4TOCA 1RYTA 4CYAA 4EVDA 5HU6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S2Z A;  4DI0 A;  2WLU A;  3PWQ C;  4AM2 A;  3BVE A;  4LQJ A;  3E1P A;  4DAS A;  2FL0 A;  1ZUJ A;  3R2R A;  4CYB A;  1VEQ A;  2ZA6 A;  3E1L A;  5HJF A;  3E1J A;  3BVI A;  5HJH A;  1F30 A;  1IER A;  2BK6 A;  3QD8 A;  4TOH A;  4TOE A;  2UX1 A;  4Z5S A;  3OGH A;  2WTL A;  2ZG8 X;  3WVV A;  3AF8 X;  1TKO A;  3ISF A;  4KVR A;  1JTS A;  5GN8 A;  2V2N A;  5D8X A;  5D8Y A;  3RGD A;  3PZA A;  5FFC A;  4DYY A;  1YV1 A;  2ZA7 A;  3QHC A;  5D8O A;  3Q4R A;  4ISP A;  3PWF A;  3IS8 A;  5JAC A;  3NP2 X;  1L8I A;  2QF9 A;  3EZU A;  3BVK A;  2BW1 A;  5D8P A;  3A9Q A;  3A68 A;  5J8S A;  3AJQ A;  1RCD A;  5IX6 A;  1XZ1 A;  5J8W A;  4YKH A;  3F38 A;  4ISM A;  3Q4Q A;  2RBD A;  2W0O A;  3AJO A;  5LG8 A;  5GU0 X;  1Z4A A;  2ZG7 X;  2PYB A;  4E6K A;  5ERJ A;  2IB0 A;  4MKU A;  3R2K A;  1VEI A;  3UOF A;  4DYZ A;  2V2J A;  4KVS A;  1O9I A;  4M35 A;  1F33 A;  3E2C A;  3FSE A;  3FVB A;  1NFV A;  3AF9 X;  2YJK A;  2FFX J;  1JYB A;  3VNX A;  3E6R A;  4LYX A;  3F35 A;  1RCI A;  1DPS A;  4QUW A;  2X17 0;  3AF7 X;  2V2S A;  4A25 A;  4EVC A;  4ZKW A;  2GS4 A;  2Z6M A;  4DE6 A;  2CF7 A;  4DYX A;  2FJC A;  3AJP A;  3U90 A;  3HL1 A;  3R2S A;  2VXX A;  4M32 A;  4OYN A;  3E1Q A;  3E1M A;  1Z6O A;  3BT5 A;  3R2M A;  2XJN A;  1BCF A;  1HRS A;  4TOF A;  4LQH A;  3EZ0 A;  2FKZ A;  3ERZ A;  1RCG A;  1LKP A;  3F33 A;  4LYU A;  5FEJ A;  1BFR A;  3KA9 A;  2V2M A;  3UOI A;  3GE4 A;  4ZL5 A;  5JKM A;  1QGH A;  4M33 A;  1AEW A;  3ES3 A;  4ITW A;  3E1N A;  1H96 A;  1R03 A;  2FG8 A;  4ML5 A;  4ETR A;  5J9V A;  2VZB A;  2CN6 A;  4MUD A;  5LG2 A;  1GWG A;  1RCE A;  5CMR A;  5JKL G;  3BKN A;  4CVS A;  2YJJ A;  5FFB A;  4CMY V;  3KWO A;  2XJO A;  4EVE A;  4KVQ A;  2F7N A;  5I4J A;  1LB3 A;  2C2J A;  3NOZ X;  4LPN A;  3PVT B;  3KXU A;  2V2R A;  1S3Q A;  3KA3 A;  4RC5 B;  2JD6 0;  4MN9 A;  4ZLW A;  4PGK A;  3EGM A;  3KX9 A;  5D8R A;  4XKU A;  3F39 A;  4U3G A;  1VLG A;  4TW3 A;  3E6S A;  5FFD A;  4ZJK A;  4Z3B A;  2V2I A;  1IES A;  2XGW A;  5CZU A;  4MY7 A;  1FHA A;  5HQO A;  2C2F A;  3SHX A;  1JKU A;  1YUZ A;  5CMQ A;  1MFR A;  3SID A;  5ERK A;  3MPS A;  2XKQ A;  1TK6 A;  3QZ3 A;  2ZA8 A;  4DZ0 A;  2ZG9 X;  1UVH A;  4TO9 A;  4IWJ A;  1MOJ A;  4TOB A;  3KA8 A;  1SOF A;  3Q4O A;  1TKP A;  5C6F A;  2QQY A;  2FHA A;  4PGI A;  4RC7 B;  4LPJ A;  2Z5P A;  2GYQ A;  4ZMC A;  2YW6 A;  3PW8 A;  1EUM A;  1ZS3 A;  3GHQ A;  2HR5 A;  5E1U A;  3PVR B;  2JD7 0;  2FG4 A;  4MJY A;  3HIU A;  3PVT A;  5GU3 X;  1Z6O M;  2V2O A;  4DYU A;  2CLB A;  5FFE A;  2V2P A;  2FZF A;  1XZ3 A;  4RC5 A;  2C2U A;  2OC5 A;  4PG1 A;  5GU1 X;  3R2O A;  4XKT A;  3F36 A;  3PW8 C;  3BVL A;  4CVT A;  2CHP A;  1LKM A;  2IU2 A;  2BJY A;  1TJO A;  2Z5Q A;  2GYD A;  1JI5 A;  3IS7 A;  4EVB A;  1YUX A;  3NP0 X;  3RE7 A;  5J93 A;  4CVP A;  4M34 A;  2YW7 A;  5GOU A;  4TOA A;  3Q4N A;  2V2L A;  5LS9 A;  3RBC A;  1JGC A;  4PG0 A;  4AM4 A;  2HTN A;  2V15 A;  3GVY A;  1L8H A;  1LKO A;  4REU A;  3KA6 A;  4CY9 A;  2ZUR X;  3WVU A;  1JKV A;  3RD0 A;  2CN7 A;  3E1O A;  4RC7 A;  2Z90 A;  3ISE A;  3PVR A;  4CMY A;  3UNO A;  2CLU A;  4II4 B;  5K52 A;  3F34 A;  3PW1 B;  1OTK A;  5E2D A;  3AK9 A;  1NF4 A;  2Y3Q A;  5GU2 X;  4LPM A;  3RAV A;  3O7S A;  3WVW A;  3F37 A;  1NNQ A;  1KRQ A;  1JIG A;  3FI6 A;  4RC6 B;  3BVF A;  2IY4 A;  2WLA A;  1RCC A;  2ITB A;  1S30 A;  2D5K A;  1NF6 A;  3PVY B;  1J30 A;  4ERU A;  1BG7 A;  4IXK A;  4TOD A;  4LQV A;  1VJX A;  4XKS A;  3O7R A;  3TA8 A;  4ZKX A;  4AM5 A;  5JKL A;  4ZKH A;  1VEL A;  5D8S A;  1B71 A;  4TOG A;  3T9J A;  1DVB A;  4LQN A;  2JD8 0;  4ZTT A;  2CIH A;  4ZL6 A;  2C6R A;  3KA4 A;  4Y08 A;  1N1Q A;  2Z5R A;  3R2H A;  5FFA A;  5D8Q A;  5K53 A;  4II4 A;  3QHB A;  3WNW A;  1JRE A;  5JKM G;  5LBH A;  3H7G A;  3PW1 A;  1UMN A;  3IQ1 A;  4CVR A;  2XJM A;  2G4H A;  2BKC A;  5AXS A;  1O9R A;  2CHI A;  3QVD A;  1SQ3 A;  4RC8 A;  1QYB A;  3QB9 A;  4RC6 A;  3PWQ A;  3R2L A;  4P18 A;  5GN8 B;  1DAT A;  2VXI A;  3OJ5 A;  2C41 A;  3F32 A;  4R42 A;  3PVY A;  1JI4 A;  2OH3 A;  3SE1 A;  4ITT A;  3SH6 A;  4IWK A;  4XGS A;  3AK8 A;  2CEI A;  4TOC A;  1RYT A;  4CYA A;  4EVD A; 
#chains in the Genus database with same CATH topology
 1S2Z A;  2AR0 A;  4DI0 A;  2WLU A;  3PWQ C;  4AM2 A;  3BVE A;  4LQJ A;  3E1P A;  4W4L B;  4DAS A;  2FL0 A;  1ZUJ A;  3R2R A;  4CYB A;  1VEQ A;  2ZA6 A;  3E1L A;  5HJF A;  3E1J A;  3BVI A;  5HJH A;  1F30 A;  1IER A;  2BK6 A;  3QD8 A;  4TOH A;  3L0M A;  4TOE A;  2UX1 A;  4Z5S A;  3OGH A;  2WTL A;  2ZG8 X;  3WVV A;  3AF8 X;  1TKO A;  3ISF A;  3VVA A;  4KVR A;  1JTS A;  5GN8 A;  2V2N A;  5D8X A;  5D8Y A;  3RGD A;  3PZA A;  5FFC A;  4DYY A;  1YV1 A;  2ZA7 A;  3QHC A;  5D8O A;  3Q4R A;  4ISP A;  3PWF A;  3IS8 A;  3KDQ A;  5JAC A;  3NP2 X;  1L8I A;  2QF9 A;  3EZU A;  3BVK A;  2BW1 A;  5D8P A;  2V8U A;  3A9Q A;  3A68 A;  5J8S A;  3AJQ A;  1RCD A;  5IX6 A;  1XZ1 A;  5J8W A;  4YKH A;  3F38 A;  4ISM A;  3Q4Q A;  2RBD A;  2W0O A;  3AJO A;  5LG8 A;  5GU0 X;  1Z4A A;  2ZG7 X;  2PYB A;  4E6K A;  5ERJ A;  2IB0 A;  4MKU A;  3R2K A;  1VEI A;  3UOF A;  4DYZ A;  2V2J A;  4KVS A;  1O9I A;  4M35 A;  1F33 A;  3E2C A;  3FSE A;  3FVB A;  1NFV A;  4YVZ A;  3AF9 X;  2YJK A;  2FFX J;  5JDO B;  1JYB A;  3VNX A;  3E6R A;  4LYX A;  3F35 A;  1RCI A;  1DPS A;  4QUW A;  3VV9 A;  2X17 0;  3AF7 X;  2V2S A;  3JZ9 A;  4A25 A;  4EVC A;  4ZKW A;  2GS4 A;  2Z6M A;  4DE6 A;  2CF7 A;  2V8T A;  4DYX A;  2FJC A;  3AJP A;  3U90 A;  3HL1 A;  3R2S A;  2VXX A;  4M32 A;  4OYN A;  3E1Q A;  3E1M A;  1Z6O A;  3BT5 A;  2N02 A;  4WJG 4;  3R2M A;  2XJN A;  1BCF A;  1HRS A;  4TOF A;  4LQH A;  4W4K B;  3EZ0 A;  2FKZ A;  3ERZ A;  1RCG A;  1LKP A;  3F33 A;  4LYU A;  5FEJ A;  1BFR A;  3KA9 A;  2V2M A;  3UOI A;  3GE4 A;  3D19 A;  4ZL5 A;  4MXP A;  5JKM A;  1QGH A;  4M33 A;  1AEW A;  3ES3 A;  4ITW A;  3E1N A;  1H96 A;  3C23 A;  1R03 A;  2FG8 A;  4ML5 A;  4ETR A;  5J9V A;  2VZB A;  2CN6 A;  4MUD A;  5JDO A;  5LG2 A;  1GWG A;  1RCE A;  3N6O A;  5CMR A;  5JKL G;  3BKN A;  4CVS A;  2YJJ A;  5FFB A;  4CMY V;  3KWO A;  2XJO A;  4EVE A;  4KVQ A;  2F7N A;  5I4J A;  3C1Y A;  1LB3 A;  2C2J A;  3NOZ X;  4LPN A;  3PVT B;  3KXU A;  2V2R A;  1S3Q A;  3KA3 A;  3M6J A;  4RC5 B;  2JD6 0;  4MN9 A;  4ZLW A;  3JZA B;  4PGK A;  3EGM A;  3KX9 A;  5D8R A;  4XKU A;  3F39 A;  4U3G A;  1VLG A;  4TW3 A;  3E6S A;  5FFD A;  4ZJK A;  4YXJ A;  4Z3B A;  2V2I A;  1IES A;  2XGW A;  5CZU A;  4MY7 A;  1FHA A;  5HQO A;  2C2F A;  3SHX A;  1JKU A;  1YUZ A;  5CMQ A;  1MFR A;  3SID A;  5ERK A;  3FRS A;  3MPS A;  2XKQ A;  1TK6 A;  3QZ3 A;  2ZA8 A;  3FRR A;  2ZG9 X;  4DZ0 A;  4X0J A;  1UVH A;  4TO9 A;  4IWJ A;  1MOJ A;  4TOB A;  3KA8 A;  1SOF A;  3Q4O A;  1TKP A;  5C6F A;  2OKC A;  2QQY A;  2FHA A;  4PGI A;  4RC7 B;  4LPJ A;  4KXR B;  2Z5P A;  2GYQ A;  4ZMC A;  2YW6 A;  3PW8 A;  1EUM A;  1ZS3 A;  3GHQ A;  2HR5 A;  5E1U A;  3PVR B;  2JD7 0;  2FG4 A;  4MJY A;  3HIU A;  3PVT A;  5GU3 X;  1Z6O M;  2V2O A;  4DYU A;  3LKD A;  2CLB A;  5FFE A;  2V2P A;  2FZF A;  1XZ3 A;  4RC5 A;  2C2U A;  2OC5 A;  4PG1 A;  5GU1 X;  3R2O A;  4XKT A;  3F36 A;  2MGY A;  3BVL A;  3PW8 C;  4CVT A;  2CHP A;  1LKM A;  2IU2 A;  2BJY A;  1TJO A;  2Z5Q A;  2GYD A;  1JI5 A;  3IS7 A;  4EVB A;  1YUX A;  3NP0 X;  2G38 B;  3RE7 A;  5J93 A;  4CVP A;  4M34 A;  2YW7 A;  5GOU A;  4TOA A;  3Q4N A;  2V2L A;  5LS9 A;  3RBC A;  1JGC A;  4PG0 A;  4AM4 A;  2HTN A;  2V15 A;  3GVY A;  3DBY A;  1L8H A;  1LKO A;  4REU A;  3KA6 A;  4CY9 A;  3W54 A;  2ZUR X;  3WVU A;  1JKV A;  3RD0 A;  2CN7 A;  3E1O A;  4RC7 A;  2Z90 A;  3ISE A;  3PVR A;  4CMY A;  3UNO A;  2CLU A;  4II4 B;  5K52 A;  3F34 A;  3PW1 B;  1OTK A;  5E2D A;  3AK9 A;  1NF4 A;  2Y3Q A;  5GU2 X;  4LPM A;  3RAV A;  3O7S A;  3WVW A;  3F37 A;  1NNQ A;  1KRQ A;  1JIG A;  3FI6 A;  4RC6 B;  3BVF A;  2IY4 A;  2WLA A;  1RCC A;  2ITB A;  1S30 A;  2D5K A;  4E40 A;  1NF6 A;  3PVY B;  1J30 A;  4ERU A;  1BG7 A;  4IXK A;  4TOD A;  4LQV A;  1VJX A;  4XKS A;  3O7R A;  2WWX B;  3TA8 A;  3UFB A;  4ZKX A;  4AM5 A;  5JKL A;  4ZKH A;  1VEL A;  5D8S A;  4YXM A;  1B71 A;  4TOG A;  3T9J A;  1DVB A;  4LQN A;  3C1Z A;  3V3K B;  2JD8 0;  4ZTT A;  2CIH A;  4ZL6 A;  2C6R A;  3KA4 A;  4Y08 A;  1N1Q A;  2Z5R A;  3R2H A;  5FFA A;  5D8Q A;  3KHK A;  5K53 A;  4II4 A;  3QHB A;  2Y44 A;  3WNW A;  1JRE A;  5JKM G;  5LBH A;  3H7G A;  3PW1 A;  1UMN A;  3GGY A;  3IQ1 A;  4CVR A;  2XJM A;  2G4H A;  2BKC A;  3C21 A;  5AXS A;  1O9R A;  2CHI A;  3QVD A;  1SQ3 A;  4RC8 A;  1QYB A;  3QB9 A;  4RC6 A;  3PWQ A;  3R2L A;  4P18 A;  5GN8 B;  1DAT A;  2VXI A;  3OJ5 A;  2C41 A;  3GGZ A;  3F32 A;  4R42 A;  3PVY A;  1JI4 A;  2OH3 A;  3SE1 A;  4ITT A;  3SH6 A;  4IWK A;  2CWL A;  4XGS A;  3AK8 A;  2CEI A;  4TOC A;  1RYT A;  4CYA A;  4EVD A;  5HU6 D; 
#chains in the Genus database with same CATH homology
 1S2Z A;  2AR0 A;  4DI0 A;  2WLU A;  3PWQ C;  4AM2 A;  3BVE A;  4LQJ A;  3E1P A;  4W4L B;  4DAS A;  2FL0 A;  1ZUJ A;  3R2R A;  4CYB A;  1VEQ A;  2ZA6 A;  3E1L A;  5HJF A;  3E1J A;  3BVI A;  5HJH A;  1F30 A;  1IER A;  2BK6 A;  3QD8 A;  4TOH A;  3L0M A;  4TOE A;  2UX1 A;  4Z5S A;  3OGH A;  2WTL A;  2ZG8 X;  3WVV A;  3AF8 X;  1TKO A;  3ISF A;  3VVA A;  4KVR A;  1JTS A;  5GN8 A;  2V2N A;  5D8X A;  5D8Y A;  3RGD A;  3PZA A;  5FFC A;  4DYY A;  1YV1 A;  2ZA7 A;  3QHC A;  5D8O A;  3Q4R A;  4ISP A;  3PWF A;  3IS8 A;  3KDQ A;  5JAC A;  3NP2 X;  1L8I A;  2QF9 A;  3EZU A;  3BVK A;  2BW1 A;  5D8P A;  2V8U A;  3A9Q A;  3A68 A;  5J8S A;  3AJQ A;  1RCD A;  5IX6 A;  1XZ1 A;  5J8W A;  4YKH A;  3F38 A;  4ISM A;  3Q4Q A;  2RBD A;  2W0O A;  3AJO A;  5LG8 A;  5GU0 X;  1Z4A A;  2ZG7 X;  2PYB A;  4E6K A;  5ERJ A;  2IB0 A;  4MKU A;  3R2K A;  1VEI A;  3UOF A;  4DYZ A;  2V2J A;  4KVS A;  1O9I A;  4M35 A;  1F33 A;  3E2C A;  3FSE A;  3FVB A;  1NFV A;  4YVZ A;  3AF9 X;  2YJK A;  2FFX J;  5JDO B;  1JYB A;  3VNX A;  3E6R A;  4LYX A;  3F35 A;  1RCI A;  1DPS A;  4QUW A;  3VV9 A;  2X17 0;  3AF7 X;  2V2S A;  3JZ9 A;  4A25 A;  4EVC A;  4ZKW A;  2GS4 A;  2Z6M A;  4DE6 A;  2CF7 A;  2V8T A;  4DYX A;  2FJC A;  3AJP A;  3U90 A;  3HL1 A;  3R2S A;  2VXX A;  4M32 A;  4OYN A;  3E1Q A;  3E1M A;  1Z6O A;  3BT5 A;  2N02 A;  4WJG 4;  3R2M A;  2XJN A;  1BCF A;  1HRS A;  4TOF A;  4LQH A;  4W4K B;  3EZ0 A;  2FKZ A;  3ERZ A;  1RCG A;  1LKP A;  3F33 A;  4LYU A;  5FEJ A;  1BFR A;  3KA9 A;  2V2M A;  3UOI A;  3GE4 A;  3D19 A;  4ZL5 A;  4MXP A;  5JKM A;  1QGH A;  4M33 A;  1AEW A;  3ES3 A;  4ITW A;  3E1N A;  1H96 A;  3C23 A;  1R03 A;  2FG8 A;  4ML5 A;  4ETR A;  5J9V A;  2VZB A;  2CN6 A;  4MUD A;  5JDO A;  5LG2 A;  1GWG A;  1RCE A;  3N6O A;  5CMR A;  5JKL G;  3BKN A;  4CVS A;  2YJJ A;  5FFB A;  4CMY V;  3KWO A;  2XJO A;  4EVE A;  4KVQ A;  2F7N A;  5I4J A;  3C1Y A;  1LB3 A;  2C2J A;  3NOZ X;  4LPN A;  3PVT B;  3KXU A;  2V2R A;  1S3Q A;  3KA3 A;  3M6J A;  4RC5 B;  2JD6 0;  4MN9 A;  4ZLW A;  3JZA B;  4PGK A;  3EGM A;  3KX9 A;  5D8R A;  4XKU A;  3F39 A;  4U3G A;  1VLG A;  4TW3 A;  3E6S A;  5FFD A;  4ZJK A;  4YXJ A;  4Z3B A;  2V2I A;  1IES A;  2XGW A;  5CZU A;  4MY7 A;  1FHA A;  5HQO A;  2C2F A;  3SHX A;  1JKU A;  1YUZ A;  5CMQ A;  1MFR A;  3SID A;  5ERK A;  3FRS A;  3MPS A;  2XKQ A;  1TK6 A;  3QZ3 A;  2ZA8 A;  3FRR A;  2ZG9 X;  4DZ0 A;  4X0J A;  1UVH A;  4TO9 A;  4IWJ A;  1MOJ A;  4TOB A;  3KA8 A;  1SOF A;  3Q4O A;  1TKP A;  5C6F A;  2OKC A;  2QQY A;  2FHA A;  4PGI A;  4RC7 B;  4LPJ A;  4KXR B;  2Z5P A;  2GYQ A;  4ZMC A;  2YW6 A;  3PW8 A;  1EUM A;  1ZS3 A;  3GHQ A;  2HR5 A;  5E1U A;  3PVR B;  2JD7 0;  2FG4 A;  4MJY A;  3HIU A;  3PVT A;  5GU3 X;  1Z6O M;  2V2O A;  4DYU A;  3LKD A;  2CLB A;  5FFE A;  2V2P A;  2FZF A;  1XZ3 A;  4RC5 A;  2C2U A;  2OC5 A;  4PG1 A;  5GU1 X;  3R2O A;  4XKT A;  3F36 A;  2MGY A;  3BVL A;  3PW8 C;  4CVT A;  2CHP A;  1LKM A;  2IU2 A;  2BJY A;  1TJO A;  2Z5Q A;  2GYD A;  1JI5 A;  3IS7 A;  4EVB A;  1YUX A;  3NP0 X;  2G38 B;  3RE7 A;  5J93 A;  4CVP A;  4M34 A;  2YW7 A;  5GOU A;  4TOA A;  3Q4N A;  2V2L A;  5LS9 A;  3RBC A;  1JGC A;  4PG0 A;  4AM4 A;  2HTN A;  2V15 A;  3GVY A;  3DBY A;  1L8H A;  1LKO A;  4REU A;  3KA6 A;  4CY9 A;  3W54 A;  2ZUR X;  3WVU A;  1JKV A;  3RD0 A;  2CN7 A;  3E1O A;  4RC7 A;  2Z90 A;  3ISE A;  3PVR A;  4CMY A;  3UNO A;  2CLU A;  4II4 B;  5K52 A;  3F34 A;  3PW1 B;  1OTK A;  5E2D A;  3AK9 A;  1NF4 A;  2Y3Q A;  5GU2 X;  4LPM A;  3RAV A;  3O7S A;  3WVW A;  3F37 A;  1NNQ A;  1KRQ A;  1JIG A;  3FI6 A;  4RC6 B;  3BVF A;  2IY4 A;  2WLA A;  1RCC A;  2ITB A;  1S30 A;  2D5K A;  4E40 A;  1NF6 A;  3PVY B;  1J30 A;  4ERU A;  1BG7 A;  4IXK A;  4TOD A;  4LQV A;  1VJX A;  4XKS A;  3O7R A;  2WWX B;  3TA8 A;  3UFB A;  4ZKX A;  4AM5 A;  5JKL A;  4ZKH A;  1VEL A;  5D8S A;  4YXM A;  1B71 A;  4TOG A;  3T9J A;  1DVB A;  4LQN A;  3C1Z A;  3V3K B;  2JD8 0;  4ZTT A;  2CIH A;  4ZL6 A;  2C6R A;  3KA4 A;  4Y08 A;  1N1Q A;  2Z5R A;  3R2H A;  5FFA A;  5D8Q A;  3KHK A;  5K53 A;  4II4 A;  3QHB A;  2Y44 A;  3WNW A;  1JRE A;  5JKM G;  5LBH A;  3H7G A;  3PW1 A;  1UMN A;  3GGY A;  3IQ1 A;  4CVR A;  2XJM A;  2G4H A;  2BKC A;  3C21 A;  5AXS A;  1O9R A;  2CHI A;  3QVD A;  1SQ3 A;  4RC8 A;  1QYB A;  3QB9 A;  4RC6 A;  3PWQ A;  3R2L A;  4P18 A;  5GN8 B;  1DAT A;  2VXI A;  3OJ5 A;  2C41 A;  3GGZ A;  3F32 A;  4R42 A;  3PVY A;  1JI4 A;  2OH3 A;  3SE1 A;  4ITT A;  3SH6 A;  4IWK A;  2CWL A;  4XGS A;  3AK8 A;  2CEI A;  4TOC A;  1RYT A;  4CYA A;  4EVD A;  5HU6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...