4R42A

Crystal structure of katb, a manganese catalase from anabaena pcc7120
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
225
structure length
219
Chain Sequence
b'MVFHKKEPIHVVNIGEANPRFAQLLLEQFGGATGELSAALQYWVQSFHVENAGIKDMLQDIAIEEFSHLEMVGKLIEAHTKNVDQTEAYKSTLFAVRGMGPHFLDSQGNAWTASYLNEGGDVVRDLRANIAAEAGARQTYEELIKLSPDEGTKQTLVHLLTREISHTQMFMKALDSLGKLTDPFFGNVQPDETVALYYNLSSERGPWNSEPAFKYVANP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alr3090 protein
publication title KatB, a cyanobacterial Mn-catalase with unique active site configuration: Implications for enzyme function.
pubmed doi rcsb
source organism Nostoc sp. pcc 7120
molecule tags Oxidoreductase
total genus 80
structure length 219
sequence length 225
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05067 Mn_catalase Manganese containing catalase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4r42A01
1QGHA 4MJYA 4KVRA 5C6FA 3BVIA 4ZL6A 1RYTA 3RBCA 3F39A 2FZFA 2FFXJ 5IX6A 2RBDA 3SE1A 3SHXA 4TOEA 2UX1A 3PW1A 5ERKA 4DYZA 1JKVA 2V2SA 3GE4A 5HQOA 4MKUA 3BVFA 1AEWA 1RCIA 3E1JA 3TA8A 3BVEA 4M32A 4IWKA 3E6RA 4MN9A 4PGKA 1DATA 3E1MA 3WVUA 4ZMCA 3SH6A 3WVWA 3ISEA 1JREA 5LBHA 4TO9A 2YJJA 2WLUA 4LQNA 1IERA 1RCEA 3PWQC 4ML5A 5JKMA 4CYAA 2ZG7X 1NNQA 4ZKWA 2C6RA 4LYXA 3PVYB 1UMNA 1JI5A 5LG8A 3UOIA 1EUMA 3IQ1A 4TOAA 2Y3QA 2GYQA 2BJYA 2FL0A 3ES3A 4RC5B 4U3GA 4CYBA 2JD80 2IB0A 4RC7B 5LS9A 2V15A 3FI6A 3R2HA 5LG2A 5GU0X 4LQVA 4DYXA 4II4B 4R42A 1S3QA 5GU2X 5HJFA 3EZUA 2CLUA 1H96A 5GOUA 2VXXA 1JGCA 1JKUA 2FG4A 1VEIA 4EVDA 2HR5A 4AM4A 3F38A 5HJHA 1JYBA 2Z5RA 5K53A 3QHCA 3E1NA 2QF9A 4OYNA 2V2NA 4RC6A 2CN7A 1ZS3A 2CF7A 3QD8A 5J8WA 3PW1B 3RGDA 5K52A 1YV1A 5JKMG 4ZKHA 5CMRA 3IS8A 4TOFA 1BG7A 2V2IA 3GHQA 3R2KA 2OH3A 2XJMA 5D8QA 1ZUJA 4ISMA 5GU1X 2CN6A 4Z5SA 3AF8X 3F33A 5D8YA 1FHAA 1Z6OM 5JACA 1TK6A 4TOBA 3VNXA 2WTLA 1RCCA 2C41A 3FVBA 5FEJA 2YW7A 4DASA 1TKPA 4RC8A 5GN8A 3KWOA 4ZJKA 1MFRA 1MOJA 3QHBA 2IY4A 1F33A 1BFRA 2CHPA 3FSEA 4AM5A 4CVPA 4ISPA 3KA4A 2CHIA 5FFEA 2V2PA 1JI4A 1O9IA 4MY7A 4XKUA 3QVDA 3H7GA 3ISFA 3EGMA 4TODA 4KVQA 2PYBA 3NOZX 5D8XA 5AXSA 3KXUA 2CLBA 3HIUA 4CMYA 2GYDA 2XKQA 3Q4OA 1XZ3A 3Q4QA 5GU3X 5E2DA 1S2ZA 1TKOA 2C2FA 4ZTTA 3KA8A 1VEQA 2V2RA 4LPJA 3PVTB 2CEIA 4M33A 1B71A 2FG8A 2YW6A 4ETRA 3UNOA 1YUZA 5JKLA 2V2MA 3PZAA 4XKTA 3WVVA 1S30A 2X170 2ZA7A 3PVYA 5J8SA 2Z5QA 3NP0X 4PG0A 4DYYA 4RC6B 3KA9A 3AJPA 4LPMA 3KA6A 5FFBA 4PG1A 1F30A 3E1LA 2JD60 1Z6OA 4IWJA 4YKHA 3BT5A 3PVRA 2Z90A 5FFCA 2G4HA 4LQJA 1KRQA 2V2LA 3GVYA 4ZLWA 1O9RA 4M34A 2V2OA 2OC5A 2YJKA 4KVSA 4DE6A 4DZ0A 2F7NA 2Z5PA 4Y08A 1OTKA 3AJOA 2QQYA 3R2SA 5GN8B 3QB9A 4CVRA 3F34A 2Z6MA 1LKMA 4QUWA 2FKZA 1VLGA 3R2RA 5D8PA 5CZUA 2ZG9X 1JIGA 1RCDA 3O7RA 3PW8A 3A68A 2BK6A 4ZKXA 4ITWA 4REUA 3F35A 4LQHA 4EVCA 1QYBA 3AF7X 5CMQA 5JKLG 1YUXA 2C2JA 3UOFA 4TOGA 5FFAA 3QZ3A 2ITBA 1L8HA 1R03A 3WNWA 5D8SA 3AJQA 1NFVA 1N1QA 4P18A 2WLAA 3IS7A 3F36A 3F37A 1J30A 2IU2A 4DI0A 4LYUA 1UVHA 4EVEA 3MPSA 2FJCA 2CIHA 3E1QA 5FFDA 4CVTA 1BCFA 4ZL5A 2GS4A 3AK9A 4PGIA 4XKSA 3KX9A 3RD0A 3OGHA 4EVBA 2ZURX 5J93A 3F32A 4ERUA 1SOFA 3Q4RA 4IXKA 4CVSA 3AF9X 3AK8A 3ERZA 4LPNA 4Z3BA 1XZ1A 1IESA 2XGWA 2JD70 3PWFA 3O7SA 2ZA8A 1DVBA 3E1PA 3E2CA 1LB3A 3U90A 1GWGA 3BVLA 4ITTA 3EZ0A 4MUDA 1L8IA 1RCGA 2D5KA 3Q4NA 4TOHA 3PVRB 3HL1A 1HRSA 4XGSA 2ZA6A 3E6SA 3BVKA 3R2LA 3R2MA 4A25A 1LKOA 1Z4AA 3PWQA 4RC5A 5J9VA 1NF6A 2HTNA 3E1OA 4RC7A 2XJNA 2FHAA 2XJOA 3PVTA 5D8RA 5I4JA 1DPSA 2BKCA 4II4A 4AM2A 2V2JA 1VELA 4TOCA 3A9QA 4M35A 4DYUA 4CMYV 2VZBA 3PW8C 3RAVA 1JTSA 3SIDA 1NF4A 3KA3A 5E1UA 2C2UA 3T9JA 4TW3A 1LKPA 2VXIA 2BW1A 3OJ5A 1TJOA 5D8OA 1VJXA 1SQ3A 3RE7A 2ZG8X 3BKNA 4E6KA 4CY9A 2W0OA 3NP2X 5ERJA 3R2OA
chains in the Genus database with same CATH superfamily
1QGHA 4MJYA 4KVRA 5C6FA 2AR0A 3BVIA 4ZL6A 1RYTA 3RBCA 3F39A 2FZFA 4W4LB 2FFXJ 5IX6A 2RBDA 3SE1A 3SHXA 4TOEA 2UX1A 3PW1A 5ERKA 4DYZA 1JKVA 2V2SA 3GE4A 5HQOA 4MKUA 3BVFA 5JDOB 1AEWA 3JZ9A 1RCIA 3E1JA 3TA8A 3BVEA 4M32A 4IWKA 3E6RA 4MN9A 4PGKA 4W4KB 1DATA 3E1MA 3WVUA 4ZMCA 3SH6A 3WVWA 3ISEA 1JREA 5LBHA 4TO9A 2YJJA 2WLUA 4LQNA 1IERA 1RCEA 3PWQC 4ML5A 5JKMA 4CYAA 2ZG7X 1NNQA 4ZKWA 2C6RA 4LYXA 3PVYB 1UMNA 1JI5A 5LG8A 3UOIA 1EUMA 3IQ1A 4TOAA 2Y3QA 2GYQA 2BJYA 2FL0A 3ES3A 4RC5B 4U3GA 4CYBA 2V8UA 2JD80 2IB0A 4RC7B 3GGYA 5LS9A 2V15A 3FI6A 3R2HA 5LG2A 5GU0X 4LQVA 4DYXA 5HU6D 4II4B 4R42A 3GGZA 1S3QA 2WWXB 5GU2X 5HJFA 3EZUA 2CLUA 2Y44A 1H96A 5GOUA 2VXXA 3L0MA 1JGCA 3KHKA 1JKUA 4KXRB 2FG4A 1VEIA 4EVDA 2HR5A 4AM4A 3F38A 5HJHA 1JYBA 2Z5RA 5K53A 3QHCA 3E1NA 2QF9A 4OYNA 2V2NA 4RC6A 2CN7A 1ZS3A 2CF7A 3QD8A 5J8WA 3PW1B 3RGDA 5K52A 1YV1A 5JKMG 4ZKHA 5CMRA 3IS8A 4TOFA 1BG7A 2V2IA 3GHQA 3R2KA 2OH3A 2XJMA 5D8QA 1ZUJA 4ISMA 5GU1X 2CN6A 4Z5SA 3AF8X 3F33A 5D8YA 1FHAA 1Z6OM 5JACA 1TK6A 4TOBA 3VNXA 2WTLA 1RCCA 2C41A 3FVBA 5FEJA 2YW7A 4DASA 1TKPA 4RC8A 5GN8A 3KWOA 4ZJKA 1MFRA 1MOJA 3QHBA 2IY4A 1F33A 4E40A 1BFRA 2CHPA 3FSEA 4AM5A 3C1YA 4ISPA 3KA4A 4CVPA 2CHIA 5FFEA 3VV9A 4YXMA 2V2PA 1JI4A 1O9IA 4MY7A 4XKUA 3QVDA 3H7GA 3ISFA 3EGMA 4TODA 4KVQA 2PYBA 3NOZX 5D8XA 2CWLA 5AXSA 3KXUA 2CLBA 3HIUA 4CMYA 3VVAA 2GYDA 2XKQA 3Q4OA 1XZ3A 3Q4QA 5GU3X 5E2DA 1S2ZA 3DBYA 1TKOA 2C2FA 4ZTTA 3KA8A 3C23A 1VEQA 2V2RA 4LPJA 3PVTB 2CEIA 4M33A 1B71A 2FG8A 2YW6A 3C1ZA 4ETRA 3UNOA 1YUZA 5JKLA 2V2MA 3PZAA 2OKCA 4XKTA 3WVVA 1S30A 2MGYA 2X170 2ZA7A 3PVYA 5J8SA 3D19A 2Z5QA 3NP0X 4PG0A 3UFBA 4DYYA 4RC6B 3KA9A 3AJPA 4LPMA 3KA6A 5FFBA 4PG1A 1F30A 3E1LA 2JD60 4WJG4 1Z6OA 3LKDA 4IWJA 4YKHA 3BT5A 3PVRA 2Z90A 5FFCA 2G4HA 4LQJA 1KRQA 2V2LA 3GVYA 4ZLWA 1O9RA 3N6OA 4M34A 2V2OA 4YVZA 2OC5A 2YJKA 3KDQA 4KVSA 4DE6A 4DZ0A 2F7NA 2Z5PA 4Y08A 2V8TA 1OTKA 3AJOA 2QQYA 3R2SA 5GN8B 3QB9A 4CVRA 3F34A 2Z6MA 1LKMA 4QUWA 3FRSA 2FKZA 1VLGA 3R2RA 5D8PA 5CZUA 2ZG9X 1JIGA 1RCDA 3FRRA 3O7RA 3PW8A 3A68A 2BK6A 4ZKXA 4ITWA 4REUA 3F35A 4LQHA 4EVCA 1QYBA 3AF7X 5CMQA 5JKLG 1YUXA 2C2JA 3UOFA 4TOGA 5FFAA 3QZ3A 2ITBA 1L8HA 1R03A 3WNWA 5D8SA 3AJQA 1NFVA 1N1QA 4P18A 2WLAA 3IS7A 3F36A 3F37A 1J30A 2IU2A 4DI0A 4LYUA 5JDOA 1UVHA 4EVEA 3MPSA 2FJCA 2CIHA 3E1QA 5FFDA 4CVTA 1BCFA 4ZL5A 2GS4A 3AK9A 4PGIA 4XKSA 3KX9A 2G38B 3RD0A 3OGHA 4EVBA 2ZURX 5J93A 3F32A 4ERUA 1SOFA 3Q4RA 4YXJA 4IXKA 4CVSA 3AF9X 3AK8A 3ERZA 4LPNA 4Z3BA 1XZ1A 1IESA 3C21A 2XGWA 2JD70 3PWFA 3O7SA 2ZA8A 1DVBA 3E1PA 3E2CA 1LB3A 3W54A 3JZAB 3U90A 1GWGA 3BVLA 4ITTA 3EZ0A 4MUDA 1L8IA 1RCGA 2D5KA 3Q4NA 4TOHA 3V3KB 3PVRB 3HL1A 1HRSA 4XGSA 2ZA6A 3E6SA 3BVKA 3R2LA 3R2MA 4A25A 1LKOA 1Z4AA 4MXPA 3PWQA 4RC5A 3M6JA 5J9VA 1NF6A 2HTNA 3E1OA 4RC7A 2XJNA 2FHAA 4X0JA 2XJOA 2N02A 3PVTA 5D8RA 5I4JA 1DPSA 2BKCA 4II4A 4AM2A 2V2JA 1VELA 4TOCA 3A9QA 4M35A 4DYUA 4CMYV 2VZBA 3PW8C 3RAVA 1JTSA 3SIDA 1NF4A 3KA3A 5E1UA 2C2UA 3T9JA 4TW3A 1LKPA 2VXIA 2BW1A 3OJ5A 1TJOA 5D8OA 1VJXA 1SQ3A 3RE7A 2ZG8X 3BKNA 4E6KA 4CY9A 2W0OA 3NP2X 5ERJA 3R2OA
chains in the Genus database with same CATH topology
1QGHA 4MJYA 4KVRA 5C6FA 2AR0A 3BVIA 4ZL6A 1RYTA 3RBCA 3F39A 2FZFA 4W4LB 2FFXJ 5IX6A 2RBDA 3SE1A 3SHXA 4TOEA 2UX1A 3PW1A 5ERKA 4DYZA 1JKVA 2V2SA 3GE4A 5HQOA 4MKUA 3BVFA 5JDOB 1AEWA 3JZ9A 1RCIA 3E1JA 3TA8A 3BVEA 4M32A 4IWKA 3E6RA 4MN9A 4PGKA 4W4KB 1DATA 3E1MA 3WVUA 4ZMCA 3SH6A 3WVWA 3ISEA 1JREA 5LBHA 4TO9A 2YJJA 2WLUA 4LQNA 1IERA 1RCEA 3PWQC 4ML5A 5JKMA 4CYAA 2ZG7X 1NNQA 4ZKWA 2C6RA 4LYXA 3PVYB 1UMNA 1JI5A 5LG8A 3UOIA 1EUMA 3IQ1A 4TOAA 2Y3QA 2GYQA 2BJYA 2FL0A 3ES3A 4RC5B 4U3GA 4CYBA 2V8UA 2JD80 2IB0A 4RC7B 3GGYA 5LS9A 2V15A 3FI6A 3R2HA 5LG2A 5GU0X 4LQVA 4DYXA 5HU6D 4II4B 4R42A 3GGZA 1S3QA 2WWXB 5GU2X 5HJFA 3EZUA 2CLUA 2Y44A 1H96A 5GOUA 2VXXA 3L0MA 1JGCA 3KHKA 1JKUA 4KXRB 2FG4A 1VEIA 4EVDA 2HR5A 4AM4A 3F38A 5HJHA 1JYBA 2Z5RA 5K53A 3QHCA 3E1NA 2QF9A 4OYNA 2V2NA 4RC6A 2CN7A 1ZS3A 2CF7A 3QD8A 5J8WA 3PW1B 3RGDA 5K52A 1YV1A 5JKMG 4ZKHA 5CMRA 3IS8A 4TOFA 1BG7A 2V2IA 3GHQA 3R2KA 2OH3A 2XJMA 5D8QA 1ZUJA 4ISMA 5GU1X 2CN6A 4Z5SA 3AF8X 3F33A 5D8YA 1FHAA 1Z6OM 5JACA 1TK6A 4TOBA 3VNXA 2WTLA 1RCCA 2C41A 3FVBA 5FEJA 2YW7A 4DASA 1TKPA 4RC8A 5GN8A 3KWOA 4ZJKA 1MFRA 1MOJA 3QHBA 2IY4A 1F33A 4E40A 1BFRA 2CHPA 3FSEA 4AM5A 3C1YA 4ISPA 3KA4A 4CVPA 2CHIA 5FFEA 3VV9A 4YXMA 2V2PA 1JI4A 1O9IA 4MY7A 4XKUA 3QVDA 3H7GA 3ISFA 3EGMA 4TODA 4KVQA 2PYBA 3NOZX 5D8XA 2CWLA 5AXSA 3KXUA 2CLBA 3HIUA 4CMYA 3VVAA 2GYDA 2XKQA 3Q4OA 1XZ3A 3Q4QA 5GU3X 5E2DA 1S2ZA 3DBYA 1TKOA 2C2FA 4ZTTA 3KA8A 3C23A 1VEQA 2V2RA 4LPJA 3PVTB 2CEIA 4M33A 1B71A 2FG8A 2YW6A 3C1ZA 4ETRA 3UNOA 1YUZA 5JKLA 2V2MA 3PZAA 2OKCA 4XKTA 3WVVA 1S30A 2MGYA 2X170 2ZA7A 3PVYA 5J8SA 3D19A 2Z5QA 3NP0X 4PG0A 3UFBA 4DYYA 4RC6B 3KA9A 3AJPA 4LPMA 3KA6A 5FFBA 4PG1A 1F30A 3E1LA 2JD60 4WJG4 1Z6OA 3LKDA 4IWJA 4YKHA 3BT5A 3PVRA 2Z90A 5FFCA 2G4HA 4LQJA 1KRQA 2V2LA 3GVYA 4ZLWA 1O9RA 3N6OA 4M34A 2V2OA 4YVZA 2OC5A 2YJKA 3KDQA 4KVSA 4DE6A 4DZ0A 2F7NA 2Z5PA 4Y08A 2V8TA 1OTKA 3AJOA 2QQYA 3R2SA 5GN8B 3QB9A 4CVRA 3F34A 2Z6MA 1LKMA 4QUWA 3FRSA 2FKZA 1VLGA 3R2RA 5D8PA 5CZUA 2ZG9X 1JIGA 1RCDA 3FRRA 3O7RA 3PW8A 3A68A 2BK6A 4ZKXA 4ITWA 4REUA 3F35A 4LQHA 4EVCA 1QYBA 3AF7X 5CMQA 5JKLG 1YUXA 2C2JA 3UOFA 4TOGA 5FFAA 3QZ3A 2ITBA 1L8HA 1R03A 3WNWA 5D8SA 3AJQA 1NFVA 1N1QA 4P18A 2WLAA 3IS7A 3F36A 3F37A 1J30A 2IU2A 4DI0A 4LYUA 5JDOA 1UVHA 4EVEA 3MPSA 2FJCA 2CIHA 3E1QA 5FFDA 4CVTA 1BCFA 4ZL5A 2GS4A 3AK9A 4PGIA 4XKSA 3KX9A 2G38B 3RD0A 3OGHA 4EVBA 2ZURX 5J93A 3F32A 4ERUA 1SOFA 3Q4RA 4YXJA 4IXKA 4CVSA 3AF9X 3AK8A 3ERZA 4LPNA 4Z3BA 1XZ1A 1IESA 3C21A 2XGWA 2JD70 3PWFA 3O7SA 2ZA8A 1DVBA 3E1PA 3E2CA 1LB3A 3W54A 3JZAB 3U90A 1GWGA 3BVLA 4ITTA 3EZ0A 4MUDA 1L8IA 1RCGA 2D5KA 3Q4NA 4TOHA 3V3KB 3PVRB 3HL1A 1HRSA 4XGSA 2ZA6A 3E6SA 3BVKA 3R2LA 3R2MA 4A25A 1LKOA 1Z4AA 4MXPA 3PWQA 4RC5A 3M6JA 5J9VA 1NF6A 2HTNA 3E1OA 4RC7A 2XJNA 2FHAA 4X0JA 2XJOA 2N02A 3PVTA 5D8RA 5I4JA 1DPSA 2BKCA 4II4A 4AM2A 2V2JA 1VELA 4TOCA 3A9QA 4M35A 4DYUA 4CMYV 2VZBA 3PW8C 3RAVA 1JTSA 3SIDA 1NF4A 3KA3A 5E1UA 2C2UA 3T9JA 4TW3A 1LKPA 2VXIA 2BW1A 3OJ5A 1TJOA 5D8OA 1VJXA 1SQ3A 3RE7A 2ZG8X 3BKNA 4E6KA 4CY9A 2W0OA 3NP2X 5ERJA 3R2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QGH A;  4MJY A;  4KVR A;  5C6F A;  3BVI A;  4ZL6 A;  1RYT A;  3RBC A;  3F39 A;  2FZF A;  2FFX J;  5IX6 A;  2RBD A;  3SE1 A;  3SHX A;  4TOE A;  2UX1 A;  3PW1 A;  5ERK A;  4DYZ A;  1JKV A;  2V2S A;  3GE4 A;  5HQO A;  4MKU A;  3BVF A;  1AEW A;  1RCI A;  3E1J A;  3TA8 A;  3BVE A;  4M32 A;  4IWK A;  3E6R A;  4MN9 A;  4PGK A;  1DAT A;  3E1M A;  3WVU A;  4ZMC A;  3SH6 A;  3WVW A;  3ISE A;  1JRE A;  5LBH A;  4TO9 A;  2YJJ A;  2WLU A;  4LQN A;  1IER A;  1RCE A;  3PWQ C;  4ML5 A;  5JKM A;  4CYA A;  2ZG7 X;  1NNQ A;  4ZKW A;  2C6R A;  4LYX A;  3PVY B;  1UMN A;  1JI5 A;  5LG8 A;  3UOI A;  1EUM A;  3IQ1 A;  4TOA A;  2Y3Q A;  2GYQ A;  2BJY A;  2FL0 A;  3ES3 A;  4RC5 B;  4U3G A;  4CYB A;  2JD8 0;  2IB0 A;  4RC7 B;  5LS9 A;  2V15 A;  3FI6 A;  3R2H A;  5LG2 A;  5GU0 X;  4LQV A;  4DYX A;  4II4 B;  4R42 A;  1S3Q A;  5GU2 X;  5HJF A;  3EZU A;  2CLU A;  1H96 A;  5GOU A;  2VXX A;  1JGC A;  1JKU A;  2FG4 A;  1VEI A;  4EVD A;  2HR5 A;  4AM4 A;  3F38 A;  5HJH A;  1JYB A;  2Z5R A;  5K53 A;  3QHC A;  3E1N A;  2QF9 A;  4OYN A;  2V2N A;  4RC6 A;  2CN7 A;  1ZS3 A;  2CF7 A;  3QD8 A;  5J8W A;  3PW1 B;  3RGD A;  5K52 A;  1YV1 A;  5JKM G;  4ZKH A;  5CMR A;  3IS8 A;  4TOF A;  1BG7 A;  2V2I A;  3GHQ A;  3R2K A;  2OH3 A;  2XJM A;  5D8Q A;  1ZUJ A;  4ISM A;  5GU1 X;  2CN6 A;  4Z5S A;  3AF8 X;  3F33 A;  5D8Y A;  1FHA A;  1Z6O M;  5JAC A;  1TK6 A;  4TOB A;  3VNX A;  2WTL A;  1RCC A;  2C41 A;  3FVB A;  5FEJ A;  2YW7 A;  4DAS A;  1TKP A;  4RC8 A;  5GN8 A;  3KWO A;  4ZJK A;  1MFR A;  1MOJ A;  3QHB A;  2IY4 A;  1F33 A;  1BFR A;  2CHP A;  3FSE A;  4AM5 A;  4CVP A;  4ISP A;  3KA4 A;  2CHI A;  5FFE A;  2V2P A;  1JI4 A;  1O9I A;  4MY7 A;  4XKU A;  3QVD A;  3H7G A;  3ISF A;  3EGM A;  4TOD A;  4KVQ A;  2PYB A;  3NOZ X;  5D8X A;  5AXS A;  3KXU A;  2CLB A;  3HIU A;  4CMY A;  2GYD A;  2XKQ A;  3Q4O A;  1XZ3 A;  3Q4Q A;  5GU3 X;  5E2D A;  1S2Z A;  1TKO A;  2C2F A;  4ZTT A;  3KA8 A;  1VEQ A;  2V2R A;  4LPJ A;  3PVT B;  2CEI A;  4M33 A;  1B71 A;  2FG8 A;  2YW6 A;  4ETR A;  3UNO A;  1YUZ A;  5JKL A;  2V2M A;  3PZA A;  4XKT A;  3WVV A;  1S30 A;  2X17 0;  2ZA7 A;  3PVY A;  5J8S A;  2Z5Q A;  3NP0 X;  4PG0 A;  4DYY A;  4RC6 B;  3KA9 A;  3AJP A;  4LPM A;  3KA6 A;  5FFB A;  4PG1 A;  1F30 A;  3E1L A;  2JD6 0;  1Z6O A;  4IWJ A;  4YKH A;  3BT5 A;  3PVR A;  2Z90 A;  5FFC A;  2G4H A;  4LQJ A;  1KRQ A;  2V2L A;  3GVY A;  4ZLW A;  1O9R A;  4M34 A;  2V2O A;  2OC5 A;  2YJK A;  4KVS A;  4DE6 A;  4DZ0 A;  2F7N A;  2Z5P A;  4Y08 A;  1OTK A;  3AJO A;  2QQY A;  3R2S A;  5GN8 B;  3QB9 A;  4CVR A;  3F34 A;  2Z6M A;  1LKM A;  4QUW A;  2FKZ A;  1VLG A;  3R2R A;  5D8P A;  5CZU A;  2ZG9 X;  1JIG A;  1RCD A;  3O7R A;  3PW8 A;  3A68 A;  2BK6 A;  4ZKX A;  4ITW A;  4REU A;  3F35 A;  4LQH A;  4EVC A;  1QYB A;  3AF7 X;  5CMQ A;  5JKL G;  1YUX A;  2C2J A;  3UOF A;  4TOG A;  5FFA A;  3QZ3 A;  2ITB A;  1L8H A;  1R03 A;  3WNW A;  5D8S A;  3AJQ A;  1NFV A;  1N1Q A;  4P18 A;  2WLA A;  3IS7 A;  3F36 A;  3F37 A;  1J30 A;  2IU2 A;  4DI0 A;  4LYU A;  1UVH A;  4EVE A;  3MPS A;  2FJC A;  2CIH A;  3E1Q A;  5FFD A;  4CVT A;  1BCF A;  4ZL5 A;  2GS4 A;  3AK9 A;  4PGI A;  4XKS A;  3KX9 A;  3RD0 A;  3OGH A;  4EVB A;  2ZUR X;  5J93 A;  3F32 A;  4ERU A;  1SOF A;  3Q4R A;  4IXK A;  4CVS A;  3AF9 X;  3AK8 A;  3ERZ A;  4LPN A;  4Z3B A;  1XZ1 A;  1IES A;  2XGW A;  2JD7 0;  3PWF A;  3O7S A;  2ZA8 A;  1DVB A;  3E1P A;  3E2C A;  1LB3 A;  3U90 A;  1GWG A;  3BVL A;  4ITT A;  3EZ0 A;  4MUD A;  1L8I A;  1RCG A;  2D5K A;  3Q4N A;  4TOH A;  3PVR B;  3HL1 A;  1HRS A;  4XGS A;  2ZA6 A;  3E6S A;  3BVK A;  3R2L A;  3R2M A;  4A25 A;  1LKO A;  1Z4A A;  3PWQ A;  4RC5 A;  5J9V A;  1NF6 A;  2HTN A;  3E1O A;  4RC7 A;  2XJN A;  2FHA A;  2XJO A;  3PVT A;  5D8R A;  5I4J A;  1DPS A;  2BKC A;  4II4 A;  4AM2 A;  2V2J A;  1VEL A;  4TOC A;  3A9Q A;  4M35 A;  4DYU A;  4CMY V;  2VZB A;  3PW8 C;  3RAV A;  1JTS A;  3SID A;  1NF4 A;  3KA3 A;  5E1U A;  2C2U A;  3T9J A;  4TW3 A;  1LKP A;  2VXI A;  2BW1 A;  3OJ5 A;  1TJO A;  5D8O A;  1VJX A;  1SQ3 A;  3RE7 A;  2ZG8 X;  3BKN A;  4E6K A;  4CY9 A;  2W0O A;  3NP2 X;  5ERJ A;  3R2O A; 
#chains in the Genus database with same CATH topology
 1QGH A;  4MJY A;  4KVR A;  5C6F A;  2AR0 A;  3BVI A;  4ZL6 A;  1RYT A;  3RBC A;  3F39 A;  2FZF A;  4W4L B;  2FFX J;  5IX6 A;  2RBD A;  3SE1 A;  3SHX A;  4TOE A;  2UX1 A;  3PW1 A;  5ERK A;  4DYZ A;  1JKV A;  2V2S A;  3GE4 A;  5HQO A;  4MKU A;  3BVF A;  5JDO B;  1AEW A;  3JZ9 A;  1RCI A;  3E1J A;  3TA8 A;  3BVE A;  4M32 A;  4IWK A;  3E6R A;  4MN9 A;  4PGK A;  4W4K B;  1DAT A;  3E1M A;  3WVU A;  4ZMC A;  3SH6 A;  3WVW A;  3ISE A;  1JRE A;  5LBH A;  4TO9 A;  2YJJ A;  2WLU A;  4LQN A;  1IER A;  1RCE A;  3PWQ C;  4ML5 A;  5JKM A;  4CYA A;  2ZG7 X;  1NNQ A;  4ZKW A;  2C6R A;  4LYX A;  3PVY B;  1UMN A;  1JI5 A;  5LG8 A;  3UOI A;  1EUM A;  3IQ1 A;  4TOA A;  2Y3Q A;  2GYQ A;  2BJY A;  2FL0 A;  3ES3 A;  4RC5 B;  4U3G A;  4CYB A;  2V8U A;  2JD8 0;  2IB0 A;  4RC7 B;  3GGY A;  5LS9 A;  2V15 A;  3FI6 A;  3R2H A;  5LG2 A;  5GU0 X;  4LQV A;  4DYX A;  5HU6 D;  4II4 B;  4R42 A;  3GGZ A;  1S3Q A;  2WWX B;  5GU2 X;  5HJF A;  3EZU A;  2CLU A;  2Y44 A;  1H96 A;  5GOU A;  2VXX A;  3L0M A;  1JGC A;  3KHK A;  1JKU A;  4KXR B;  2FG4 A;  1VEI A;  4EVD A;  2HR5 A;  4AM4 A;  3F38 A;  5HJH A;  1JYB A;  2Z5R A;  5K53 A;  3QHC A;  3E1N A;  2QF9 A;  4OYN A;  2V2N A;  4RC6 A;  2CN7 A;  1ZS3 A;  2CF7 A;  3QD8 A;  5J8W A;  3PW1 B;  3RGD A;  5K52 A;  1YV1 A;  5JKM G;  4ZKH A;  5CMR A;  3IS8 A;  4TOF A;  1BG7 A;  2V2I A;  3GHQ A;  3R2K A;  2OH3 A;  2XJM A;  5D8Q A;  1ZUJ A;  4ISM A;  5GU1 X;  2CN6 A;  4Z5S A;  3AF8 X;  3F33 A;  5D8Y A;  1FHA A;  1Z6O M;  5JAC A;  1TK6 A;  4TOB A;  3VNX A;  2WTL A;  1RCC A;  2C41 A;  3FVB A;  5FEJ A;  2YW7 A;  4DAS A;  1TKP A;  4RC8 A;  5GN8 A;  3KWO A;  4ZJK A;  1MFR A;  1MOJ A;  3QHB A;  2IY4 A;  1F33 A;  4E40 A;  1BFR A;  2CHP A;  3FSE A;  4AM5 A;  3C1Y A;  4ISP A;  3KA4 A;  4CVP A;  2CHI A;  5FFE A;  3VV9 A;  4YXM A;  2V2P A;  1JI4 A;  1O9I A;  4MY7 A;  4XKU A;  3QVD A;  3H7G A;  3ISF A;  3EGM A;  4TOD A;  4KVQ A;  2PYB A;  3NOZ X;  5D8X A;  2CWL A;  5AXS A;  3KXU A;  2CLB A;  3HIU A;  4CMY A;  3VVA A;  2GYD A;  2XKQ A;  3Q4O A;  1XZ3 A;  3Q4Q A;  5GU3 X;  5E2D A;  1S2Z A;  3DBY A;  1TKO A;  2C2F A;  4ZTT A;  3KA8 A;  3C23 A;  1VEQ A;  2V2R A;  4LPJ A;  3PVT B;  2CEI A;  4M33 A;  1B71 A;  2FG8 A;  2YW6 A;  3C1Z A;  4ETR A;  3UNO A;  1YUZ A;  5JKL A;  2V2M A;  3PZA A;  2OKC A;  4XKT A;  3WVV A;  1S30 A;  2MGY A;  2X17 0;  2ZA7 A;  3PVY A;  5J8S A;  3D19 A;  2Z5Q A;  3NP0 X;  4PG0 A;  3UFB A;  4DYY A;  4RC6 B;  3KA9 A;  3AJP A;  4LPM A;  3KA6 A;  5FFB A;  4PG1 A;  1F30 A;  3E1L A;  2JD6 0;  4WJG 4;  1Z6O A;  3LKD A;  4IWJ A;  4YKH A;  3BT5 A;  3PVR A;  2Z90 A;  5FFC A;  2G4H A;  4LQJ A;  1KRQ A;  2V2L A;  3GVY A;  4ZLW A;  1O9R A;  3N6O A;  4M34 A;  2V2O A;  4YVZ A;  2OC5 A;  2YJK A;  3KDQ A;  4KVS A;  4DE6 A;  4DZ0 A;  2F7N A;  2Z5P A;  4Y08 A;  2V8T A;  1OTK A;  3AJO A;  2QQY A;  3R2S A;  5GN8 B;  3QB9 A;  4CVR A;  3F34 A;  2Z6M A;  1LKM A;  4QUW A;  3FRS A;  2FKZ A;  1VLG A;  3R2R A;  5D8P A;  5CZU A;  2ZG9 X;  1JIG A;  1RCD A;  3FRR A;  3O7R A;  3PW8 A;  3A68 A;  2BK6 A;  4ZKX A;  4ITW A;  4REU A;  3F35 A;  4LQH A;  4EVC A;  1QYB A;  3AF7 X;  5CMQ A;  5JKL G;  1YUX A;  2C2J A;  3UOF A;  4TOG A;  5FFA A;  3QZ3 A;  2ITB A;  1L8H A;  1R03 A;  3WNW A;  5D8S A;  3AJQ A;  1NFV A;  1N1Q A;  4P18 A;  2WLA A;  3IS7 A;  3F36 A;  3F37 A;  1J30 A;  2IU2 A;  4DI0 A;  4LYU A;  5JDO A;  1UVH A;  4EVE A;  3MPS A;  2FJC A;  2CIH A;  3E1Q A;  5FFD A;  4CVT A;  1BCF A;  4ZL5 A;  2GS4 A;  3AK9 A;  4PGI A;  4XKS A;  3KX9 A;  2G38 B;  3RD0 A;  3OGH A;  4EVB A;  2ZUR X;  5J93 A;  3F32 A;  4ERU A;  1SOF A;  3Q4R A;  4YXJ A;  4IXK A;  4CVS A;  3AF9 X;  3AK8 A;  3ERZ A;  4LPN A;  4Z3B A;  1XZ1 A;  1IES A;  3C21 A;  2XGW A;  2JD7 0;  3PWF A;  3O7S A;  2ZA8 A;  1DVB A;  3E1P A;  3E2C A;  1LB3 A;  3W54 A;  3JZA B;  3U90 A;  1GWG A;  3BVL A;  4ITT A;  3EZ0 A;  4MUD A;  1L8I A;  1RCG A;  2D5K A;  3Q4N A;  4TOH A;  3V3K B;  3PVR B;  3HL1 A;  1HRS A;  4XGS A;  2ZA6 A;  3E6S A;  3BVK A;  3R2L A;  3R2M A;  4A25 A;  1LKO A;  1Z4A A;  4MXP A;  3PWQ A;  4RC5 A;  3M6J A;  5J9V A;  1NF6 A;  2HTN A;  3E1O A;  4RC7 A;  2XJN A;  2FHA A;  4X0J A;  2XJO A;  2N02 A;  3PVT A;  5D8R A;  5I4J A;  1DPS A;  2BKC A;  4II4 A;  4AM2 A;  2V2J A;  1VEL A;  4TOC A;  3A9Q A;  4M35 A;  4DYU A;  4CMY V;  2VZB A;  3PW8 C;  3RAV A;  1JTS A;  3SID A;  1NF4 A;  3KA3 A;  5E1U A;  2C2U A;  3T9J A;  4TW3 A;  1LKP A;  2VXI A;  2BW1 A;  3OJ5 A;  1TJO A;  5D8O A;  1VJX A;  1SQ3 A;  3RE7 A;  2ZG8 X;  3BKN A;  4E6K A;  4CY9 A;  2W0O A;  3NP2 X;  5ERJ A;  3R2O A; 
#chains in the Genus database with same CATH homology
 1QGH A;  4MJY A;  4KVR A;  5C6F A;  2AR0 A;  3BVI A;  4ZL6 A;  1RYT A;  3RBC A;  3F39 A;  2FZF A;  4W4L B;  2FFX J;  5IX6 A;  2RBD A;  3SE1 A;  3SHX A;  4TOE A;  2UX1 A;  3PW1 A;  5ERK A;  4DYZ A;  1JKV A;  2V2S A;  3GE4 A;  5HQO A;  4MKU A;  3BVF A;  5JDO B;  1AEW A;  3JZ9 A;  1RCI A;  3E1J A;  3TA8 A;  3BVE A;  4M32 A;  4IWK A;  3E6R A;  4MN9 A;  4PGK A;  4W4K B;  1DAT A;  3E1M A;  3WVU A;  4ZMC A;  3SH6 A;  3WVW A;  3ISE A;  1JRE A;  5LBH A;  4TO9 A;  2YJJ A;  2WLU A;  4LQN A;  1IER A;  1RCE A;  3PWQ C;  4ML5 A;  5JKM A;  4CYA A;  2ZG7 X;  1NNQ A;  4ZKW A;  2C6R A;  4LYX A;  3PVY B;  1UMN A;  1JI5 A;  5LG8 A;  3UOI A;  1EUM A;  3IQ1 A;  4TOA A;  2Y3Q A;  2GYQ A;  2BJY A;  2FL0 A;  3ES3 A;  4RC5 B;  4U3G A;  4CYB A;  2V8U A;  2JD8 0;  2IB0 A;  4RC7 B;  3GGY A;  5LS9 A;  2V15 A;  3FI6 A;  3R2H A;  5LG2 A;  5GU0 X;  4LQV A;  4DYX A;  5HU6 D;  4II4 B;  4R42 A;  3GGZ A;  1S3Q A;  2WWX B;  5GU2 X;  5HJF A;  3EZU A;  2CLU A;  2Y44 A;  1H96 A;  5GOU A;  2VXX A;  3L0M A;  1JGC A;  3KHK A;  1JKU A;  4KXR B;  2FG4 A;  1VEI A;  4EVD A;  2HR5 A;  4AM4 A;  3F38 A;  5HJH A;  1JYB A;  2Z5R A;  5K53 A;  3QHC A;  3E1N A;  2QF9 A;  4OYN A;  2V2N A;  4RC6 A;  2CN7 A;  1ZS3 A;  2CF7 A;  3QD8 A;  5J8W A;  3PW1 B;  3RGD A;  5K52 A;  1YV1 A;  5JKM G;  4ZKH A;  5CMR A;  3IS8 A;  4TOF A;  1BG7 A;  2V2I A;  3GHQ A;  3R2K A;  2OH3 A;  2XJM A;  5D8Q A;  1ZUJ A;  4ISM A;  5GU1 X;  2CN6 A;  4Z5S A;  3AF8 X;  3F33 A;  5D8Y A;  1FHA A;  1Z6O M;  5JAC A;  1TK6 A;  4TOB A;  3VNX A;  2WTL A;  1RCC A;  2C41 A;  3FVB A;  5FEJ A;  2YW7 A;  4DAS A;  1TKP A;  4RC8 A;  5GN8 A;  3KWO A;  4ZJK A;  1MFR A;  1MOJ A;  3QHB A;  2IY4 A;  1F33 A;  4E40 A;  1BFR A;  2CHP A;  3FSE A;  4AM5 A;  3C1Y A;  4ISP A;  3KA4 A;  4CVP A;  2CHI A;  5FFE A;  3VV9 A;  4YXM A;  2V2P A;  1JI4 A;  1O9I A;  4MY7 A;  4XKU A;  3QVD A;  3H7G A;  3ISF A;  3EGM A;  4TOD A;  4KVQ A;  2PYB A;  3NOZ X;  5D8X A;  2CWL A;  5AXS A;  3KXU A;  2CLB A;  3HIU A;  4CMY A;  3VVA A;  2GYD A;  2XKQ A;  3Q4O A;  1XZ3 A;  3Q4Q A;  5GU3 X;  5E2D A;  1S2Z A;  3DBY A;  1TKO A;  2C2F A;  4ZTT A;  3KA8 A;  3C23 A;  1VEQ A;  2V2R A;  4LPJ A;  3PVT B;  2CEI A;  4M33 A;  1B71 A;  2FG8 A;  2YW6 A;  3C1Z A;  4ETR A;  3UNO A;  1YUZ A;  5JKL A;  2V2M A;  3PZA A;  2OKC A;  4XKT A;  3WVV A;  1S30 A;  2MGY A;  2X17 0;  2ZA7 A;  3PVY A;  5J8S A;  3D19 A;  2Z5Q A;  3NP0 X;  4PG0 A;  3UFB A;  4DYY A;  4RC6 B;  3KA9 A;  3AJP A;  4LPM A;  3KA6 A;  5FFB A;  4PG1 A;  1F30 A;  3E1L A;  2JD6 0;  4WJG 4;  1Z6O A;  3LKD A;  4IWJ A;  4YKH A;  3BT5 A;  3PVR A;  2Z90 A;  5FFC A;  2G4H A;  4LQJ A;  1KRQ A;  2V2L A;  3GVY A;  4ZLW A;  1O9R A;  3N6O A;  4M34 A;  2V2O A;  4YVZ A;  2OC5 A;  2YJK A;  3KDQ A;  4KVS A;  4DE6 A;  4DZ0 A;  2F7N A;  2Z5P A;  4Y08 A;  2V8T A;  1OTK A;  3AJO A;  2QQY A;  3R2S A;  5GN8 B;  3QB9 A;  4CVR A;  3F34 A;  2Z6M A;  1LKM A;  4QUW A;  3FRS A;  2FKZ A;  1VLG A;  3R2R A;  5D8P A;  5CZU A;  2ZG9 X;  1JIG A;  1RCD A;  3FRR A;  3O7R A;  3PW8 A;  3A68 A;  2BK6 A;  4ZKX A;  4ITW A;  4REU A;  3F35 A;  4LQH A;  4EVC A;  1QYB A;  3AF7 X;  5CMQ A;  5JKL G;  1YUX A;  2C2J A;  3UOF A;  4TOG A;  5FFA A;  3QZ3 A;  2ITB A;  1L8H A;  1R03 A;  3WNW A;  5D8S A;  3AJQ A;  1NFV A;  1N1Q A;  4P18 A;  2WLA A;  3IS7 A;  3F36 A;  3F37 A;  1J30 A;  2IU2 A;  4DI0 A;  4LYU A;  5JDO A;  1UVH A;  4EVE A;  3MPS A;  2FJC A;  2CIH A;  3E1Q A;  5FFD A;  4CVT A;  1BCF A;  4ZL5 A;  2GS4 A;  3AK9 A;  4PGI A;  4XKS A;  3KX9 A;  2G38 B;  3RD0 A;  3OGH A;  4EVB A;  2ZUR X;  5J93 A;  3F32 A;  4ERU A;  1SOF A;  3Q4R A;  4YXJ A;  4IXK A;  4CVS A;  3AF9 X;  3AK8 A;  3ERZ A;  4LPN A;  4Z3B A;  1XZ1 A;  1IES A;  3C21 A;  2XGW A;  2JD7 0;  3PWF A;  3O7S A;  2ZA8 A;  1DVB A;  3E1P A;  3E2C A;  1LB3 A;  3W54 A;  3JZA B;  3U90 A;  1GWG A;  3BVL A;  4ITT A;  3EZ0 A;  4MUD A;  1L8I A;  1RCG A;  2D5K A;  3Q4N A;  4TOH A;  3V3K B;  3PVR B;  3HL1 A;  1HRS A;  4XGS A;  2ZA6 A;  3E6S A;  3BVK A;  3R2L A;  3R2M A;  4A25 A;  1LKO A;  1Z4A A;  4MXP A;  3PWQ A;  4RC5 A;  3M6J A;  5J9V A;  1NF6 A;  2HTN A;  3E1O A;  4RC7 A;  2XJN A;  2FHA A;  4X0J A;  2XJO A;  2N02 A;  3PVT A;  5D8R A;  5I4J A;  1DPS A;  2BKC A;  4II4 A;  4AM2 A;  2V2J A;  1VEL A;  4TOC A;  3A9Q A;  4M35 A;  4DYU A;  4CMY V;  2VZB A;  3PW8 C;  3RAV A;  1JTS A;  3SID A;  1NF4 A;  3KA3 A;  5E1U A;  2C2U A;  3T9J A;  4TW3 A;  1LKP A;  2VXI A;  2BW1 A;  3OJ5 A;  1TJO A;  5D8O A;  1VJX A;  1SQ3 A;  3RE7 A;  2ZG8 X;  3BKN A;  4E6K A;  4CY9 A;  2W0O A;  3NP2 X;  5ERJ A;  3R2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...