4R42A

Crystal structure of katb, a manganese catalase from anabaena pcc7120
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
225
structure length
219
Chain Sequence
MVFHKKEPIHVVNIGEANPRFAQLLLEQFGGATGELSAALQYWVQSFHVENAGIKDMLQDIAIEEFSHLEMVGKLIEAHTKNVDQTEAYKSTLFAVRGMGPHFLDSQGNAWTASYLNEGGDVVRDLRANIAAEAGARQTYEELIKLSPDEGTKQTLVHLLTREISHTQMFMKALDSLGKLTDPFFGNVQPDETVALYYNLSSERGPWNSEPAFKYVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alr3090 protein
publication title KatB, a cyanobacterial Mn-catalase with unique active site configuration: Implications for enzyme function.
pubmed doi rcsb
source organism Nostoc sp. pcc 7120
total genus 80
structure length 219
sequence length 225
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05067 Mn_catalase Manganese containing catalase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4r42A01
5FFCA 4YKHA 4ISPA 1JKVA 1J30A 3SH6A 3Q4QA 1GWGA 4ERUA 2XKQA 4MJYA 3NP2X 2BW1A 5E2DA 4AM4A 2PYBA 3H7GA 2HR5A 5K52A 2IY4A 4ZJKA 5AXSA 1VJXA 3RBCA 2ZA7A 1R03A 5J9VA 3AK8A 4DZ0A 4PGIA 1O9IA 3QHBA 5D8QA 3R2OA 5HJFA 2YW7A 1TJOA 2OC5A 4LQJA 2C2UA 1HRSA 2V2IA 3F39A 4ZLWA 3UNOA 1RCDA 1KRQA 2CF7A 2WLAA 3R2SA 4Z5SA 4EVEA 4MUDA 3KA6A 1O9RA 2GYDA 5LG8A 3E6RA 2Z6MA 2V2MA 3GE4A 2V2JA 3AJPA 1F30A 2V2NA 5GU3X 3A9QA 4TOEA 5FEJA 3GHQA 2VXXA 1JKUA 2IU2A 5GOUA 3O7SA 3AK9A 1BG7A 5I4JA 3HL1A 4RC6B 2ZG9X 1S3QA 4MY7A 3PWFA 4IWKA 3Q4RA 2Z5RA 2Y3QA 3PW8A 2FJCA 2ZURX 3PW8C 1ZUJA 4ZKWA 3PW1A 3KWOA 3R2LA 2ZG8X 4EVDA 2V15A 2GYQA 1QYBA 4CVTA 2ITBA 5JKLG 4RC7A 2FHAA 3O7RA 4IWJA 4IXKA 2OH3A 5E1UA 4Y08A 3Q4NA 3QD8A 4TOBA 4PG1A 4ZKXA 1H96A 2WLUA 3E1NA 3R2KA 4CVPA 4M35A 3PVYB 3R2RA 5D8SA 1QGHA 5GN8B 2Z5PA 3RAVA 4MN9A 3UOIA 2C2FA 4LQHA 1Z6OA 4ZL6A 5LG2A 3KA8A 3E1PA 1L8HA 1FHAA 4RC8A 5D8XA 1IESA 2YW6A 2HTNA 4LYXA 1YUXA 2XJOA 4KVSA 4E6KA 3E1JA 1EUMA 3BVEA 4KVQA 1RCEA 3EZUA 2YJKA 3KX9A 4CMYV 4TOHA 4CYBA 1OTKA 4DYYA 4M33A 4ISMA 1B71A 4KVRA 3TA8A 2FZFA 1LKOA 2CLBA 2VZBA 5GN8A 5CMRA 4CY9A 3SE1A 5FFAA 1VELA 2V2LA 2JD80 1S2ZA 4II4B 4EVBA 4CMYA 1TK6A 2FFXJ 4LPJA 4A25A 3F32A 3WVWA 1BFRA 3AF9X 4ITWA 4LQVA 1NF6A 4DYZA 2D5KA 3EZ0A 1IERA 3R2HA 1DATA 3AJQA 3KA4A 3A68A 4ZL5A 1NNQA 1DVBA 3FSEA 4P18A 1S30A 2FG8A 5D8PA 4ZTTA 4DYXA 2G4HA 1JIGA 2Z90A 1N1QA 5FFEA 3SIDA 2V2PA 2YJJA 3QVDA 2QQYA 2UX1A 1MFRA 5FFDA 1NF4A 2ZA6A 3PVTB 3UOFA 5GU2X 3KA3A 3PVRB 5JKLA 4TOFA 4Z3BA 1L8IA 2CIHA 2C41A 3BVFA 3ES3A 3SHXA 1UVHA 1TKOA 1RCIA 5J8WA 1AEWA 2QF9A 5ERKA 3IS8A 2CN6A 4TOCA 2XGWA 1LB3A 3PWQA 3MPSA 3WNWA 3PWQC 4PG0A 3Q4OA 4RC6A 1ZS3A 5JACA 3F33A 1BCFA 3WVVA 5C6FA 1LKPA 3EGMA 1JI4A 4LPNA 3NOZX 2XJMA 3PVRA 5D8YA 3OJ5A 5K53A 2GS4A 4XGSA 4LQNA 1LKMA 2RBDA 3AF8X 3IS7A 5LS9A 2XJNA 1RYTA 4M34A 1XZ1A 3F36A 3AJOA 2F7NA 2BK6A 2CEIA 2WTLA 2CN7A 3BVLA 3E6SA 4REUA 1JTSA 3KXUA 4OYNA 3BVIA 2ZG7X 4TOAA 2VXIA 1Z4AA 3KA9A 3WVUA 3R2MA 5JKMG 2V2OA 1XZ3A 3RE7A 3IQ1A 3E1MA 4AM5A 1YUZA 3PVYA 2BKCA 5IX6A 1DPSA 4U3GA 5ERJA 3E1OA 1YV1A 1VEIA 4ML5A 1JGCA 4XKTA 2Z5QA 5LBHA 4DI0A 1RCGA 3BVKA 3RGDA 3AF7X 4RC5B 4CVRA 1JYBA 2IB0A 2V2RA 5D8OA 4PGKA 4DYUA 2JD70 3QB9A 2CHIA 1TKPA 4M32A 4DASA 2C6RA 3F38A 3F37A 3RD0A 3BT5A 3ERZA 1NFVA 2V2SA 4TOGA 4EVCA 4MKUA 5J8SA 3E1QA 4II4A 1SOFA 2W0OA 4TODA 3PW1B 3E2CA 4ETRA 4LPMA 5CZUA 5GU1X 4CYAA 3ISFA 3F35A 4XKSA 4RC5A 4DE6A 4RC7B 3VNXA 4TO9A 4LYUA 1F33A 2FG4A 3OGHA 2CHPA 2FKZA 1UMNA 3PZAA 3FVBA 3GVYA 2FL0A 1JREA 3T9JA 2X170 4XKUA 4TW3A 1Z6OM 2JD60 5HQOA 1MOJA 3QHCA 1SQ3A 3BKNA 3FI6A 2ZA8A 4ZKHA 5GU0X 3U90A 3ISEA 3QZ3A 3PVTA 4ITTA 3E1LA 5HJHA 5FFBA 4QUWA 1RCCA 1JI5A 5D8RA 5CMQA 5J93A 4R42A 3NP0X 2CLUA 4ZMCA 5JKMA 4AM2A 1VEQA 2BJYA 2C2JA 4CVSA 3HIUA 1VLGA 3F34A
chains in the Genus database with same CATH superfamily
5FFCA 3KDQA 3D19A 4YKHA 4ISPA 1JKVA 4YVZA 1J30A 3SH6A 3Q4QA 1GWGA 4WJG4 4ERUA 2XKQA 4MJYA 3NP2X 2BW1A 5E2DA 4AM4A 2PYBA 3H7GA 2HR5A 5K52A 2IY4A 4ZJKA 5AXSA 1VJXA 3RBCA 2ZA7A 1R03A 5J9VA 3AK8A 4DZ0A 4PGIA 1O9IA 3QHBA 5D8QA 3R2OA 5HJFA 2YW7A 3FRSA 1TJOA 3C1ZA 2OC5A 4LQJA 2C2UA 1HRSA 2V2IA 3F39A 4MXPA 4ZLWA 3UNOA 1RCDA 2AR0A 1KRQA 2CF7A 2WLAA 3R2SA 4Z5SA 4EVEA 4MUDA 3KA6A 1O9RA 2GYDA 5LG8A 4KXRB 3E6RA 2Z6MA 3FRRA 2V2MA 3M6JA 3GE4A 2V2JA 3AJPA 1F30A 2V2NA 5GU3X 3A9QA 4TOEA 5FEJA 3GHQA 2VXXA 1JKUA 2IU2A 5GOUA 3O7SA 3AK9A 1BG7A 5I4JA 3HL1A 4RC6B 2ZG9X 1S3QA 3N6OA 4MY7A 3PWFA 3C23A 4IWKA 3Q4RA 2Z5RA 2Y3QA 3PW8A 2FJCA 2ZURX 3PW8C 1ZUJA 4ZKWA 3PW1A 3KWOA 3R2LA 2ZG8X 4EVDA 2V15A 2GYQA 1QYBA 4CVTA 2ITBA 5JKLG 4RC7A 2FHAA 3O7RA 4IXKA 4IWJA 3GGYA 2OH3A 5E1UA 4Y08A 3LKDA 3Q4NA 3QD8A 4TOBA 4PG1A 4ZKXA 1H96A 2WLUA 3E1NA 3R2KA 4CVPA 2V8UA 2CWLA 4M35A 3PVYB 3R2RA 5D8SA 1QGHA 5GN8B 2Z5PA 3RAVA 4MN9A 3UOIA 2C2FA 4LQHA 1Z6OA 4ZL6A 5LG2A 3KA8A 3E1PA 1L8HA 1FHAA 4RC8A 5D8XA 4YXJA 1IESA 2YW6A 2HTNA 4LYXA 1YUXA 2XJOA 4KVSA 4E6KA 3E1JA 1EUMA 3BVEA 4KVQA 1RCEA 3EZUA 2YJKA 3KX9A 4CMYV 4TOHA 4CYBA 3UFBA 1OTKA 4DYYA 4M33A 4ISMA 1B71A 4KVRA 3TA8A 2FZFA 1LKOA 2CLBA 2VZBA 5GN8A 5CMRA 4CY9A 3SE1A 5FFAA 1VELA 2V2LA 2JD80 1S2ZA 4II4B 4EVBA 4CMYA 1TK6A 2FFXJ 4LPJA 4A25A 3F32A 3WVWA 1BFRA 3AF9X 4ITWA 4LQVA 1NF6A 4DYZA 5JDOB 2D5KA 3EZ0A 1IERA 3R2HA 1DATA 3AJQA 3KA4A 3A68A 4ZL5A 1NNQA 1DVBA 3FSEA 4P18A 1S30A 4W4LB 2FG8A 5D8PA 4ZTTA 4DYXA 2G4HA 1JIGA 2Z90A 1N1QA 5FFEA 3SIDA 2V2PA 2YJJA 3QVDA 2QQYA 2UX1A 1MFRA 5FFDA 1NF4A 2ZA6A 3PVTB 3UOFA 5GU2X 3KA3A 3PVRB 5JKLA 4TOFA 4Z3BA 1L8IA 2CIHA 2C41A 3BVFA 3ES3A 3SHXA 1UVHA 1TKOA 1RCIA 5J8WA 1AEWA 3KHKA 2QF9A 5ERKA 3IS8A 2CN6A 4TOCA 2XGWA 1LB3A 3PWQA 3MPSA 3WNWA 3PWQC 4PG0A 2V8TA 3Q4OA 4RC6A 1ZS3A 3VVAA 5JACA 3F33A 1BCFA 2N02A 3WVVA 5C6FA 1LKPA 3EGMA 1JI4A 4LPNA 3NOZX 2XJMA 3PVRA 5D8YA 3OJ5A 5K53A 2GS4A 4XGSA 4LQNA 1LKMA 2RBDA 3AF8X 3IS7A 5LS9A 2XJNA 1RYTA 4M34A 1XZ1A 3F36A 3AJOA 2F7NA 2BK6A 2CEIA 2WTLA 2CN7A 3BVLA 3E6SA 4REUA 1JTSA 3KXUA 4OYNA 3BVIA 2ZG7X 4TOAA 2VXIA 1Z4AA 3KA9A 3WVUA 3R2MA 4YXMA 3VV9A 5JKMG 2V2OA 1XZ3A 3RE7A 3IQ1A 3L0MA 3GGZA 3E1MA 4AM5A 1YUZA 3PVYA 2BKCA 5IX6A 1DPSA 4U3GA 5ERJA 3E1OA 1YV1A 1VEIA 4ML5A 1JGCA 4XKTA 2Z5QA 5LBHA 4DI0A 1RCGA 3BVKA 3RGDA 3AF7X 2OKCA 4RC5B 4CVRA 1JYBA 2IB0A 2V2RA 5D8OA 4PGKA 4DYUA 2JD70 3QB9A 2CHIA 1TKPA 4M32A 3C1YA 4DASA 2C6RA 3F38A 3F37A 3RD0A 3BT5A 3ERZA 4W4KB 1NFVA 2V2SA 4TOGA 4EVCA 4MKUA 5J8SA 3V3KB 3E1QA 4II4A 1SOFA 2W0OA 2Y44A 4TODA 3PW1B 3E2CA 4ETRA 4LPMA 4E40A 5CZUA 5GU1X 4CYAA 3ISFA 3F35A 4XKSA 4RC5A 4DE6A 4RC7B 3VNXA 5JDOA 4TO9A 4LYUA 1F33A 2FG4A 3OGHA 2CHPA 3JZAB 2FKZA 1UMNA 3PZAA 5HU6D 3FVBA 3C21A 3GVYA 3W54A 2FL0A 1JREA 3T9JA 2X170 4XKUA 4TW3A 1Z6OM 2JD60 5HQOA 3JZ9A 1MOJA 3QHCA 1SQ3A 3BKNA 4X0JA 3FI6A 2ZA8A 4ZKHA 5GU0X 2MGYA 3U90A 3ISEA 3QZ3A 3PVTA 4ITTA 3E1LA 5HJHA 5FFBA 4QUWA 1RCCA 1JI5A 5D8RA 5CMQA 5J93A 4R42A 2WWXB 3NP0X 2CLUA 4ZMCA 5JKMA 4AM2A 1VEQA 2BJYA 2C2JA 4CVSA 3HIUA 2G38B 3DBYA 1VLGA 3F34A
chains in the Genus database with same CATH topology
5FFCA 3KDQA 3D19A 4YKHA 4ISPA 1JKVA 4YVZA 1J30A 3SH6A 3Q4QA 1GWGA 4WJG4 4ERUA 2XKQA 4MJYA 3NP2X 2BW1A 5E2DA 4AM4A 2PYBA 3H7GA 2HR5A 5K52A 2IY4A 4ZJKA 5AXSA 1VJXA 3RBCA 2ZA7A 1R03A 5J9VA 3AK8A 4DZ0A 4PGIA 1O9IA 3QHBA 5D8QA 3R2OA 5HJFA 2YW7A 3FRSA 1TJOA 3C1ZA 2OC5A 4LQJA 2C2UA 1HRSA 2V2IA 3F39A 4MXPA 4ZLWA 3UNOA 1RCDA 2AR0A 1KRQA 2CF7A 2WLAA 3R2SA 4Z5SA 4EVEA 4MUDA 3KA6A 1O9RA 2GYDA 5LG8A 4KXRB 3E6RA 2Z6MA 3FRRA 2V2MA 3M6JA 3GE4A 2V2JA 3AJPA 1F30A 2V2NA 5GU3X 3A9QA 4TOEA 5FEJA 3GHQA 2VXXA 1JKUA 2IU2A 5GOUA 3O7SA 3AK9A 1BG7A 5I4JA 3HL1A 4RC6B 2ZG9X 1S3QA 3N6OA 4MY7A 3PWFA 3C23A 4IWKA 3Q4RA 2Z5RA 2Y3QA 3PW8A 2FJCA 2ZURX 3PW8C 1ZUJA 4ZKWA 3PW1A 3KWOA 3R2LA 2ZG8X 4EVDA 2V15A 2GYQA 1QYBA 4CVTA 2ITBA 5JKLG 4RC7A 2FHAA 3O7RA 4IXKA 4IWJA 3GGYA 2OH3A 5E1UA 4Y08A 3LKDA 3Q4NA 3QD8A 4TOBA 4PG1A 4ZKXA 1H96A 2WLUA 3E1NA 3R2KA 4CVPA 2V8UA 2CWLA 4M35A 3PVYB 3R2RA 5D8SA 1QGHA 5GN8B 2Z5PA 3RAVA 4MN9A 3UOIA 2C2FA 4LQHA 1Z6OA 4ZL6A 5LG2A 3KA8A 3E1PA 1L8HA 1FHAA 4RC8A 5D8XA 4YXJA 1IESA 2YW6A 2HTNA 4LYXA 1YUXA 2XJOA 4KVSA 4E6KA 3E1JA 1EUMA 3BVEA 4KVQA 1RCEA 3EZUA 2YJKA 3KX9A 4CMYV 4TOHA 4CYBA 3UFBA 1OTKA 4DYYA 4M33A 4ISMA 1B71A 4KVRA 3TA8A 2FZFA 1LKOA 2CLBA 2VZBA 5GN8A 5CMRA 4CY9A 3SE1A 5FFAA 1VELA 2V2LA 2JD80 1S2ZA 4II4B 4EVBA 4CMYA 1TK6A 2FFXJ 4LPJA 4A25A 3F32A 3WVWA 1BFRA 3AF9X 4ITWA 4LQVA 1NF6A 4DYZA 5JDOB 2D5KA 3EZ0A 1IERA 3R2HA 1DATA 3AJQA 3KA4A 3A68A 4ZL5A 1NNQA 1DVBA 3FSEA 4P18A 1S30A 4W4LB 2FG8A 5D8PA 4ZTTA 4DYXA 2G4HA 1JIGA 2Z90A 1N1QA 5FFEA 3SIDA 2V2PA 2YJJA 3QVDA 2QQYA 2UX1A 1MFRA 5FFDA 1NF4A 2ZA6A 3PVTB 3UOFA 5GU2X 3KA3A 3PVRB 5JKLA 4TOFA 4Z3BA 1L8IA 2CIHA 2C41A 3BVFA 3ES3A 3SHXA 1UVHA 1TKOA 1RCIA 5J8WA 1AEWA 3KHKA 2QF9A 5ERKA 3IS8A 2CN6A 4TOCA 2XGWA 1LB3A 3PWQA 3MPSA 3WNWA 3PWQC 4PG0A 2V8TA 3Q4OA 4RC6A 1ZS3A 3VVAA 5JACA 3F33A 1BCFA 2N02A 3WVVA 5C6FA 1LKPA 3EGMA 1JI4A 4LPNA 3NOZX 2XJMA 3PVRA 5D8YA 3OJ5A 5K53A 2GS4A 4XGSA 4LQNA 1LKMA 2RBDA 3AF8X 3IS7A 5LS9A 2XJNA 1RYTA 4M34A 1XZ1A 3F36A 3AJOA 2F7NA 2BK6A 2CEIA 2WTLA 2CN7A 3BVLA 3E6SA 4REUA 1JTSA 3KXUA 4OYNA 3BVIA 2ZG7X 4TOAA 2VXIA 1Z4AA 3KA9A 3WVUA 3R2MA 4YXMA 3VV9A 5JKMG 2V2OA 1XZ3A 3RE7A 3IQ1A 3L0MA 3GGZA 3E1MA 4AM5A 1YUZA 3PVYA 2BKCA 5IX6A 1DPSA 4U3GA 5ERJA 3E1OA 1YV1A 1VEIA 4ML5A 1JGCA 4XKTA 2Z5QA 5LBHA 4DI0A 1RCGA 3BVKA 3RGDA 3AF7X 2OKCA 4RC5B 4CVRA 1JYBA 2IB0A 2V2RA 5D8OA 4PGKA 4DYUA 2JD70 3QB9A 2CHIA 1TKPA 4M32A 3C1YA 4DASA 2C6RA 3F38A 3F37A 3RD0A 3BT5A 3ERZA 4W4KB 1NFVA 2V2SA 4TOGA 4EVCA 4MKUA 5J8SA 3V3KB 3E1QA 4II4A 1SOFA 2W0OA 2Y44A 4TODA 3PW1B 3E2CA 4ETRA 4LPMA 4E40A 5CZUA 5GU1X 4CYAA 3ISFA 3F35A 4XKSA 4RC5A 4DE6A 4RC7B 3VNXA 5JDOA 4TO9A 4LYUA 1F33A 2FG4A 3OGHA 2CHPA 3JZAB 2FKZA 1UMNA 3PZAA 5HU6D 3FVBA 3C21A 3GVYA 3W54A 2FL0A 1JREA 3T9JA 2X170 4XKUA 4TW3A 1Z6OM 2JD60 5HQOA 3JZ9A 1MOJA 3QHCA 1SQ3A 3BKNA 4X0JA 3FI6A 2ZA8A 4ZKHA 5GU0X 2MGYA 3U90A 3ISEA 3QZ3A 3PVTA 4ITTA 3E1LA 5HJHA 5FFBA 4QUWA 1RCCA 1JI5A 5D8RA 5CMQA 5J93A 4R42A 2WWXB 3NP0X 2CLUA 4ZMCA 5JKMA 4AM2A 1VEQA 2BJYA 2C2JA 4CVSA 3HIUA 2G38B 3DBYA 1VLGA 3F34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFC A;  4YKH A;  4ISP A;  1JKV A;  1J30 A;  3SH6 A;  3Q4Q A;  1GWG A;  4ERU A;  2XKQ A;  4MJY A;  3NP2 X;  2BW1 A;  5E2D A;  4AM4 A;  2PYB A;  3H7G A;  2HR5 A;  5K52 A;  2IY4 A;  4ZJK A;  5AXS A;  1VJX A;  3RBC A;  2ZA7 A;  1R03 A;  5J9V A;  3AK8 A;  4DZ0 A;  4PGI A;  1O9I A;  3QHB A;  5D8Q A;  3R2O A;  5HJF A;  2YW7 A;  1TJO A;  2OC5 A;  4LQJ A;  2C2U A;  1HRS A;  2V2I A;  3F39 A;  4ZLW A;  3UNO A;  1RCD A;  1KRQ A;  2CF7 A;  2WLA A;  3R2S A;  4Z5S A;  4EVE A;  4MUD A;  3KA6 A;  1O9R A;  2GYD A;  5LG8 A;  3E6R A;  2Z6M A;  2V2M A;  3GE4 A;  2V2J A;  3AJP A;  1F30 A;  2V2N A;  5GU3 X;  3A9Q A;  4TOE A;  5FEJ A;  3GHQ A;  2VXX A;  1JKU A;  2IU2 A;  5GOU A;  3O7S A;  3AK9 A;  1BG7 A;  5I4J A;  3HL1 A;  4RC6 B;  2ZG9 X;  1S3Q A;  4MY7 A;  3PWF A;  4IWK A;  3Q4R A;  2Z5R A;  2Y3Q A;  3PW8 A;  2FJC A;  2ZUR X;  3PW8 C;  1ZUJ A;  4ZKW A;  3PW1 A;  3KWO A;  3R2L A;  2ZG8 X;  4EVD A;  2V15 A;  2GYQ A;  1QYB A;  4CVT A;  2ITB A;  5JKL G;  4RC7 A;  2FHA A;  3O7R A;  4IWJ A;  4IXK A;  2OH3 A;  5E1U A;  4Y08 A;  3Q4N A;  3QD8 A;  4TOB A;  4PG1 A;  4ZKX A;  1H96 A;  2WLU A;  3E1N A;  3R2K A;  4CVP A;  4M35 A;  3PVY B;  3R2R A;  5D8S A;  1QGH A;  5GN8 B;  2Z5P A;  3RAV A;  4MN9 A;  3UOI A;  2C2F A;  4LQH A;  1Z6O A;  4ZL6 A;  5LG2 A;  3KA8 A;  3E1P A;  1L8H A;  1FHA A;  4RC8 A;  5D8X A;  1IES A;  2YW6 A;  2HTN A;  4LYX A;  1YUX A;  2XJO A;  4KVS A;  4E6K A;  3E1J A;  1EUM A;  3BVE A;  4KVQ A;  1RCE A;  3EZU A;  2YJK A;  3KX9 A;  4CMY V;  4TOH A;  4CYB A;  1OTK A;  4DYY A;  4M33 A;  4ISM A;  1B71 A;  4KVR A;  3TA8 A;  2FZF A;  1LKO A;  2CLB A;  2VZB A;  5GN8 A;  5CMR A;  4CY9 A;  3SE1 A;  5FFA A;  1VEL A;  2V2L A;  2JD8 0;  1S2Z A;  4II4 B;  4EVB A;  4CMY A;  1TK6 A;  2FFX J;  4LPJ A;  4A25 A;  3F32 A;  3WVW A;  1BFR A;  3AF9 X;  4ITW A;  4LQV A;  1NF6 A;  4DYZ A;  2D5K A;  3EZ0 A;  1IER A;  3R2H A;  1DAT A;  3AJQ A;  3KA4 A;  3A68 A;  4ZL5 A;  1NNQ A;  1DVB A;  3FSE A;  4P18 A;  1S30 A;  2FG8 A;  5D8P A;  4ZTT A;  4DYX A;  2G4H A;  1JIG A;  2Z90 A;  1N1Q A;  5FFE A;  3SID A;  2V2P A;  2YJJ A;  3QVD A;  2QQY A;  2UX1 A;  1MFR A;  5FFD A;  1NF4 A;  2ZA6 A;  3PVT B;  3UOF A;  5GU2 X;  3KA3 A;  3PVR B;  5JKL A;  4TOF A;  4Z3B A;  1L8I A;  2CIH A;  2C41 A;  3BVF A;  3ES3 A;  3SHX A;  1UVH A;  1TKO A;  1RCI A;  5J8W A;  1AEW A;  2QF9 A;  5ERK A;  3IS8 A;  2CN6 A;  4TOC A;  2XGW A;  1LB3 A;  3PWQ A;  3MPS A;  3WNW A;  3PWQ C;  4PG0 A;  3Q4O A;  4RC6 A;  1ZS3 A;  5JAC A;  3F33 A;  1BCF A;  3WVV A;  5C6F A;  1LKP A;  3EGM A;  1JI4 A;  4LPN A;  3NOZ X;  2XJM A;  3PVR A;  5D8Y A;  3OJ5 A;  5K53 A;  2GS4 A;  4XGS A;  4LQN A;  1LKM A;  2RBD A;  3AF8 X;  3IS7 A;  5LS9 A;  2XJN A;  1RYT A;  4M34 A;  1XZ1 A;  3F36 A;  3AJO A;  2F7N A;  2BK6 A;  2CEI A;  2WTL A;  2CN7 A;  3BVL A;  3E6S A;  4REU A;  1JTS A;  3KXU A;  4OYN A;  3BVI A;  2ZG7 X;  4TOA A;  2VXI A;  1Z4A A;  3KA9 A;  3WVU A;  3R2M A;  5JKM G;  2V2O A;  1XZ3 A;  3RE7 A;  3IQ1 A;  3E1M A;  4AM5 A;  1YUZ A;  3PVY A;  2BKC A;  5IX6 A;  1DPS A;  4U3G A;  5ERJ A;  3E1O A;  1YV1 A;  1VEI A;  4ML5 A;  1JGC A;  4XKT A;  2Z5Q A;  5LBH A;  4DI0 A;  1RCG A;  3BVK A;  3RGD A;  3AF7 X;  4RC5 B;  4CVR A;  1JYB A;  2IB0 A;  2V2R A;  5D8O A;  4PGK A;  4DYU A;  2JD7 0;  3QB9 A;  2CHI A;  1TKP A;  4M32 A;  4DAS A;  2C6R A;  3F38 A;  3F37 A;  3RD0 A;  3BT5 A;  3ERZ A;  1NFV A;  2V2S A;  4TOG A;  4EVC A;  4MKU A;  5J8S A;  3E1Q A;  4II4 A;  1SOF A;  2W0O A;  4TOD A;  3PW1 B;  3E2C A;  4ETR A;  4LPM A;  5CZU A;  5GU1 X;  4CYA A;  3ISF A;  3F35 A;  4XKS A;  4RC5 A;  4DE6 A;  4RC7 B;  3VNX A;  4TO9 A;  4LYU A;  1F33 A;  2FG4 A;  3OGH A;  2CHP A;  2FKZ A;  1UMN A;  3PZA A;  3FVB A;  3GVY A;  2FL0 A;  1JRE A;  3T9J A;  2X17 0;  4XKU A;  4TW3 A;  1Z6O M;  2JD6 0;  5HQO A;  1MOJ A;  3QHC A;  1SQ3 A;  3BKN A;  3FI6 A;  2ZA8 A;  4ZKH A;  5GU0 X;  3U90 A;  3ISE A;  3QZ3 A;  3PVT A;  4ITT A;  3E1L A;  5HJH A;  5FFB A;  4QUW A;  1RCC A;  1JI5 A;  5D8R A;  5CMQ A;  5J93 A;  4R42 A;  3NP0 X;  2CLU A;  4ZMC A;  5JKM A;  4AM2 A;  1VEQ A;  2BJY A;  2C2J A;  4CVS A;  3HIU A;  1VLG A;  3F34 A; 
#chains in the Genus database with same CATH topology
 5FFC A;  3KDQ A;  3D19 A;  4YKH A;  4ISP A;  1JKV A;  4YVZ A;  1J30 A;  3SH6 A;  3Q4Q A;  1GWG A;  4WJG 4;  4ERU A;  2XKQ A;  4MJY A;  3NP2 X;  2BW1 A;  5E2D A;  4AM4 A;  2PYB A;  3H7G A;  2HR5 A;  5K52 A;  2IY4 A;  4ZJK A;  5AXS A;  1VJX A;  3RBC A;  2ZA7 A;  1R03 A;  5J9V A;  3AK8 A;  4DZ0 A;  4PGI A;  1O9I A;  3QHB A;  5D8Q A;  3R2O A;  5HJF A;  2YW7 A;  3FRS A;  1TJO A;  3C1Z A;  2OC5 A;  4LQJ A;  2C2U A;  1HRS A;  2V2I A;  3F39 A;  4MXP A;  4ZLW A;  3UNO A;  1RCD A;  2AR0 A;  1KRQ A;  2CF7 A;  2WLA A;  3R2S A;  4Z5S A;  4EVE A;  4MUD A;  3KA6 A;  1O9R A;  2GYD A;  5LG8 A;  4KXR B;  3E6R A;  2Z6M A;  3FRR A;  2V2M A;  3M6J A;  3GE4 A;  2V2J A;  3AJP A;  1F30 A;  2V2N A;  5GU3 X;  3A9Q A;  4TOE A;  5FEJ A;  3GHQ A;  2VXX A;  1JKU A;  2IU2 A;  5GOU A;  3O7S A;  3AK9 A;  1BG7 A;  5I4J A;  3HL1 A;  4RC6 B;  2ZG9 X;  1S3Q A;  3N6O A;  4MY7 A;  3PWF A;  3C23 A;  4IWK A;  3Q4R A;  2Z5R A;  2Y3Q A;  3PW8 A;  2FJC A;  2ZUR X;  3PW8 C;  1ZUJ A;  4ZKW A;  3PW1 A;  3KWO A;  3R2L A;  2ZG8 X;  4EVD A;  2V15 A;  2GYQ A;  1QYB A;  4CVT A;  2ITB A;  5JKL G;  4RC7 A;  2FHA A;  3O7R A;  4IXK A;  4IWJ A;  3GGY A;  2OH3 A;  5E1U A;  4Y08 A;  3LKD A;  3Q4N A;  3QD8 A;  4TOB A;  4PG1 A;  4ZKX A;  1H96 A;  2WLU A;  3E1N A;  3R2K A;  4CVP A;  2V8U A;  2CWL A;  4M35 A;  3PVY B;  3R2R A;  5D8S A;  1QGH A;  5GN8 B;  2Z5P A;  3RAV A;  4MN9 A;  3UOI A;  2C2F A;  4LQH A;  1Z6O A;  4ZL6 A;  5LG2 A;  3KA8 A;  3E1P A;  1L8H A;  1FHA A;  4RC8 A;  5D8X A;  4YXJ A;  1IES A;  2YW6 A;  2HTN A;  4LYX A;  1YUX A;  2XJO A;  4KVS A;  4E6K A;  3E1J A;  1EUM A;  3BVE A;  4KVQ A;  1RCE A;  3EZU A;  2YJK A;  3KX9 A;  4CMY V;  4TOH A;  4CYB A;  3UFB A;  1OTK A;  4DYY A;  4M33 A;  4ISM A;  1B71 A;  4KVR A;  3TA8 A;  2FZF A;  1LKO A;  2CLB A;  2VZB A;  5GN8 A;  5CMR A;  4CY9 A;  3SE1 A;  5FFA A;  1VEL A;  2V2L A;  2JD8 0;  1S2Z A;  4II4 B;  4EVB A;  4CMY A;  1TK6 A;  2FFX J;  4LPJ A;  4A25 A;  3F32 A;  3WVW A;  1BFR A;  3AF9 X;  4ITW A;  4LQV A;  1NF6 A;  4DYZ A;  5JDO B;  2D5K A;  3EZ0 A;  1IER A;  3R2H A;  1DAT A;  3AJQ A;  3KA4 A;  3A68 A;  4ZL5 A;  1NNQ A;  1DVB A;  3FSE A;  4P18 A;  1S30 A;  4W4L B;  2FG8 A;  5D8P A;  4ZTT A;  4DYX A;  2G4H A;  1JIG A;  2Z90 A;  1N1Q A;  5FFE A;  3SID A;  2V2P A;  2YJJ A;  3QVD A;  2QQY A;  2UX1 A;  1MFR A;  5FFD A;  1NF4 A;  2ZA6 A;  3PVT B;  3UOF A;  5GU2 X;  3KA3 A;  3PVR B;  5JKL A;  4TOF A;  4Z3B A;  1L8I A;  2CIH A;  2C41 A;  3BVF A;  3ES3 A;  3SHX A;  1UVH A;  1TKO A;  1RCI A;  5J8W A;  1AEW A;  3KHK A;  2QF9 A;  5ERK A;  3IS8 A;  2CN6 A;  4TOC A;  2XGW A;  1LB3 A;  3PWQ A;  3MPS A;  3WNW A;  3PWQ C;  4PG0 A;  2V8T A;  3Q4O A;  4RC6 A;  1ZS3 A;  3VVA A;  5JAC A;  3F33 A;  1BCF A;  2N02 A;  3WVV A;  5C6F A;  1LKP A;  3EGM A;  1JI4 A;  4LPN A;  3NOZ X;  2XJM A;  3PVR A;  5D8Y A;  3OJ5 A;  5K53 A;  2GS4 A;  4XGS A;  4LQN A;  1LKM A;  2RBD A;  3AF8 X;  3IS7 A;  5LS9 A;  2XJN A;  1RYT A;  4M34 A;  1XZ1 A;  3F36 A;  3AJO A;  2F7N A;  2BK6 A;  2CEI A;  2WTL A;  2CN7 A;  3BVL A;  3E6S A;  4REU A;  1JTS A;  3KXU A;  4OYN A;  3BVI A;  2ZG7 X;  4TOA A;  2VXI A;  1Z4A A;  3KA9 A;  3WVU A;  3R2M A;  4YXM A;  3VV9 A;  5JKM G;  2V2O A;  1XZ3 A;  3RE7 A;  3IQ1 A;  3L0M A;  3GGZ A;  3E1M A;  4AM5 A;  1YUZ A;  3PVY A;  2BKC A;  5IX6 A;  1DPS A;  4U3G A;  5ERJ A;  3E1O A;  1YV1 A;  1VEI A;  4ML5 A;  1JGC A;  4XKT A;  2Z5Q A;  5LBH A;  4DI0 A;  1RCG A;  3BVK A;  3RGD A;  3AF7 X;  2OKC A;  4RC5 B;  4CVR A;  1JYB A;  2IB0 A;  2V2R A;  5D8O A;  4PGK A;  4DYU A;  2JD7 0;  3QB9 A;  2CHI A;  1TKP A;  4M32 A;  3C1Y A;  4DAS A;  2C6R A;  3F38 A;  3F37 A;  3RD0 A;  3BT5 A;  3ERZ A;  4W4K B;  1NFV A;  2V2S A;  4TOG A;  4EVC A;  4MKU A;  5J8S A;  3V3K B;  3E1Q A;  4II4 A;  1SOF A;  2W0O A;  2Y44 A;  4TOD A;  3PW1 B;  3E2C A;  4ETR A;  4LPM A;  4E40 A;  5CZU A;  5GU1 X;  4CYA A;  3ISF A;  3F35 A;  4XKS A;  4RC5 A;  4DE6 A;  4RC7 B;  3VNX A;  5JDO A;  4TO9 A;  4LYU A;  1F33 A;  2FG4 A;  3OGH A;  2CHP A;  3JZA B;  2FKZ A;  1UMN A;  3PZA A;  5HU6 D;  3FVB A;  3C21 A;  3GVY A;  3W54 A;  2FL0 A;  1JRE A;  3T9J A;  2X17 0;  4XKU A;  4TW3 A;  1Z6O M;  2JD6 0;  5HQO A;  3JZ9 A;  1MOJ A;  3QHC A;  1SQ3 A;  3BKN A;  4X0J A;  3FI6 A;  2ZA8 A;  4ZKH A;  5GU0 X;  2MGY A;  3U90 A;  3ISE A;  3QZ3 A;  3PVT A;  4ITT A;  3E1L A;  5HJH A;  5FFB A;  4QUW A;  1RCC A;  1JI5 A;  5D8R A;  5CMQ A;  5J93 A;  4R42 A;  2WWX B;  3NP0 X;  2CLU A;  4ZMC A;  5JKM A;  4AM2 A;  1VEQ A;  2BJY A;  2C2J A;  4CVS A;  3HIU A;  2G38 B;  3DBY A;  1VLG A;  3F34 A; 
#chains in the Genus database with same CATH homology
 5FFC A;  3KDQ A;  3D19 A;  4YKH A;  4ISP A;  1JKV A;  4YVZ A;  1J30 A;  3SH6 A;  3Q4Q A;  1GWG A;  4WJG 4;  4ERU A;  2XKQ A;  4MJY A;  3NP2 X;  2BW1 A;  5E2D A;  4AM4 A;  2PYB A;  3H7G A;  2HR5 A;  5K52 A;  2IY4 A;  4ZJK A;  5AXS A;  1VJX A;  3RBC A;  2ZA7 A;  1R03 A;  5J9V A;  3AK8 A;  4DZ0 A;  4PGI A;  1O9I A;  3QHB A;  5D8Q A;  3R2O A;  5HJF A;  2YW7 A;  3FRS A;  1TJO A;  3C1Z A;  2OC5 A;  4LQJ A;  2C2U A;  1HRS A;  2V2I A;  3F39 A;  4MXP A;  4ZLW A;  3UNO A;  1RCD A;  2AR0 A;  1KRQ A;  2CF7 A;  2WLA A;  3R2S A;  4Z5S A;  4EVE A;  4MUD A;  3KA6 A;  1O9R A;  2GYD A;  5LG8 A;  4KXR B;  3E6R A;  2Z6M A;  3FRR A;  2V2M A;  3M6J A;  3GE4 A;  2V2J A;  3AJP A;  1F30 A;  2V2N A;  5GU3 X;  3A9Q A;  4TOE A;  5FEJ A;  3GHQ A;  2VXX A;  1JKU A;  2IU2 A;  5GOU A;  3O7S A;  3AK9 A;  1BG7 A;  5I4J A;  3HL1 A;  4RC6 B;  2ZG9 X;  1S3Q A;  3N6O A;  4MY7 A;  3PWF A;  3C23 A;  4IWK A;  3Q4R A;  2Z5R A;  2Y3Q A;  3PW8 A;  2FJC A;  2ZUR X;  3PW8 C;  1ZUJ A;  4ZKW A;  3PW1 A;  3KWO A;  3R2L A;  2ZG8 X;  4EVD A;  2V15 A;  2GYQ A;  1QYB A;  4CVT A;  2ITB A;  5JKL G;  4RC7 A;  2FHA A;  3O7R A;  4IXK A;  4IWJ A;  3GGY A;  2OH3 A;  5E1U A;  4Y08 A;  3LKD A;  3Q4N A;  3QD8 A;  4TOB A;  4PG1 A;  4ZKX A;  1H96 A;  2WLU A;  3E1N A;  3R2K A;  4CVP A;  2V8U A;  2CWL A;  4M35 A;  3PVY B;  3R2R A;  5D8S A;  1QGH A;  5GN8 B;  2Z5P A;  3RAV A;  4MN9 A;  3UOI A;  2C2F A;  4LQH A;  1Z6O A;  4ZL6 A;  5LG2 A;  3KA8 A;  3E1P A;  1L8H A;  1FHA A;  4RC8 A;  5D8X A;  4YXJ A;  1IES A;  2YW6 A;  2HTN A;  4LYX A;  1YUX A;  2XJO A;  4KVS A;  4E6K A;  3E1J A;  1EUM A;  3BVE A;  4KVQ A;  1RCE A;  3EZU A;  2YJK A;  3KX9 A;  4CMY V;  4TOH A;  4CYB A;  3UFB A;  1OTK A;  4DYY A;  4M33 A;  4ISM A;  1B71 A;  4KVR A;  3TA8 A;  2FZF A;  1LKO A;  2CLB A;  2VZB A;  5GN8 A;  5CMR A;  4CY9 A;  3SE1 A;  5FFA A;  1VEL A;  2V2L A;  2JD8 0;  1S2Z A;  4II4 B;  4EVB A;  4CMY A;  1TK6 A;  2FFX J;  4LPJ A;  4A25 A;  3F32 A;  3WVW A;  1BFR A;  3AF9 X;  4ITW A;  4LQV A;  1NF6 A;  4DYZ A;  5JDO B;  2D5K A;  3EZ0 A;  1IER A;  3R2H A;  1DAT A;  3AJQ A;  3KA4 A;  3A68 A;  4ZL5 A;  1NNQ A;  1DVB A;  3FSE A;  4P18 A;  1S30 A;  4W4L B;  2FG8 A;  5D8P A;  4ZTT A;  4DYX A;  2G4H A;  1JIG A;  2Z90 A;  1N1Q A;  5FFE A;  3SID A;  2V2P A;  2YJJ A;  3QVD A;  2QQY A;  2UX1 A;  1MFR A;  5FFD A;  1NF4 A;  2ZA6 A;  3PVT B;  3UOF A;  5GU2 X;  3KA3 A;  3PVR B;  5JKL A;  4TOF A;  4Z3B A;  1L8I A;  2CIH A;  2C41 A;  3BVF A;  3ES3 A;  3SHX A;  1UVH A;  1TKO A;  1RCI A;  5J8W A;  1AEW A;  3KHK A;  2QF9 A;  5ERK A;  3IS8 A;  2CN6 A;  4TOC A;  2XGW A;  1LB3 A;  3PWQ A;  3MPS A;  3WNW A;  3PWQ C;  4PG0 A;  2V8T A;  3Q4O A;  4RC6 A;  1ZS3 A;  3VVA A;  5JAC A;  3F33 A;  1BCF A;  2N02 A;  3WVV A;  5C6F A;  1LKP A;  3EGM A;  1JI4 A;  4LPN A;  3NOZ X;  2XJM A;  3PVR A;  5D8Y A;  3OJ5 A;  5K53 A;  2GS4 A;  4XGS A;  4LQN A;  1LKM A;  2RBD A;  3AF8 X;  3IS7 A;  5LS9 A;  2XJN A;  1RYT A;  4M34 A;  1XZ1 A;  3F36 A;  3AJO A;  2F7N A;  2BK6 A;  2CEI A;  2WTL A;  2CN7 A;  3BVL A;  3E6S A;  4REU A;  1JTS A;  3KXU A;  4OYN A;  3BVI A;  2ZG7 X;  4TOA A;  2VXI A;  1Z4A A;  3KA9 A;  3WVU A;  3R2M A;  4YXM A;  3VV9 A;  5JKM G;  2V2O A;  1XZ3 A;  3RE7 A;  3IQ1 A;  3L0M A;  3GGZ A;  3E1M A;  4AM5 A;  1YUZ A;  3PVY A;  2BKC A;  5IX6 A;  1DPS A;  4U3G A;  5ERJ A;  3E1O A;  1YV1 A;  1VEI A;  4ML5 A;  1JGC A;  4XKT A;  2Z5Q A;  5LBH A;  4DI0 A;  1RCG A;  3BVK A;  3RGD A;  3AF7 X;  2OKC A;  4RC5 B;  4CVR A;  1JYB A;  2IB0 A;  2V2R A;  5D8O A;  4PGK A;  4DYU A;  2JD7 0;  3QB9 A;  2CHI A;  1TKP A;  4M32 A;  3C1Y A;  4DAS A;  2C6R A;  3F38 A;  3F37 A;  3RD0 A;  3BT5 A;  3ERZ A;  4W4K B;  1NFV A;  2V2S A;  4TOG A;  4EVC A;  4MKU A;  5J8S A;  3V3K B;  3E1Q A;  4II4 A;  1SOF A;  2W0O A;  2Y44 A;  4TOD A;  3PW1 B;  3E2C A;  4ETR A;  4LPM A;  4E40 A;  5CZU A;  5GU1 X;  4CYA A;  3ISF A;  3F35 A;  4XKS A;  4RC5 A;  4DE6 A;  4RC7 B;  3VNX A;  5JDO A;  4TO9 A;  4LYU A;  1F33 A;  2FG4 A;  3OGH A;  2CHP A;  3JZA B;  2FKZ A;  1UMN A;  3PZA A;  5HU6 D;  3FVB A;  3C21 A;  3GVY A;  3W54 A;  2FL0 A;  1JRE A;  3T9J A;  2X17 0;  4XKU A;  4TW3 A;  1Z6O M;  2JD6 0;  5HQO A;  3JZ9 A;  1MOJ A;  3QHC A;  1SQ3 A;  3BKN A;  4X0J A;  3FI6 A;  2ZA8 A;  4ZKH A;  5GU0 X;  2MGY A;  3U90 A;  3ISE A;  3QZ3 A;  3PVT A;  4ITT A;  3E1L A;  5HJH A;  5FFB A;  4QUW A;  1RCC A;  1JI5 A;  5D8R A;  5CMQ A;  5J93 A;  4R42 A;  2WWX B;  3NP0 X;  2CLU A;  4ZMC A;  5JKM A;  4AM2 A;  1VEQ A;  2BJY A;  2C2J A;  4CVS A;  3HIU A;  2G38 B;  3DBY A;  1VLG A;  3F34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...