4R42A

Crystal structure of katb, a manganese catalase from anabaena pcc7120
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
225
structure length
219
Chain Sequence
MVFHKKEPIHVVNIGEANPRFAQLLLEQFGGATGELSAALQYWVQSFHVENAGIKDMLQDIAIEEFSHLEMVGKLIEAHTKNVDQTEAYKSTLFAVRGMGPHFLDSQGNAWTASYLNEGGDVVRDLRANIAAEAGARQTYEELIKLSPDEGTKQTLVHLLTREISHTQMFMKALDSLGKLTDPFFGNVQPDETVALYYNLSSERGPWNSEPAFKYVANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alr3090 protein
publication title KatB, a cyanobacterial Mn-catalase with unique active site configuration: Implications for enzyme function.
pubmed doi rcsb
source organism Nostoc sp. pcc 7120
molecule tags Oxidoreductase
total genus 80
structure length 219
sequence length 225
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05067 Mn_catalase Manganese containing catalase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4r42A01
3F32A 1H96A 4AM2A 1MOJA 3AK9A 1DVBA 3IQ1A 3EGMA 3PWQA 2D5KA 2ZG9X 4ISPA 2GYDA 1NF6A 5K52A 4Z3BA 2JD70 3BT5A 4TODA 3AF7X 4RC6B 1Z4AA 5FFDA 2C2UA 4PG0A 2C2FA 4LPJA 3T9JA 1RYTA 1S3QA 2FZFA 2QQYA 5FEJA 3R2HA 2YJKA 4MUDA 1JKUA 3QB9A 3WVWA 2HTNA 4MY7A 2GYQA 2ZURX 1JI5A 2Z5RA 3A9QA 1F33A 3BKNA 4MKUA 5JKLA 3OJ5A 4M34A 1TJOA 2UX1A 4II4A 3KWOA 1TK6A 4TOGA 3PW8C 5D8PA 3TA8A 5JKMG 2PYBA 3ERZA 4DYXA 3E1LA 1BFRA 3KA9A 3Q4RA 3BVLA 3PWFA 1RCCA 4EVEA 5J8WA 4ZLWA 3GHQA 3AF9X 4II4B 5D8XA 5E1UA 2YW7A 1TKOA 3E1NA 5ERKA 3A68A 5HJHA 5IX6A 4ZL6A 4DYYA 3IS8A 4ZL5A 1BCFA 2FFXJ 1O9IA 3PW1B 1JYBA 1RCGA 4IWJA 4ZJKA 5C6FA 4U3GA 2V2PA 4KVRA 4RC7A 2ITBA 2GS4A 4OYNA 3E6RA 3OGHA 3AF8X 2W0OA 4PGIA 5LBHA 5GU1X 3WVUA 4ITWA 3O7RA 3RGDA 2CLBA 4ZKHA 3HIUA 3AJOA 5D8SA 2CEIA 5GU0X 3FVBA 2ZG7X 2ZA8A 4RC6A 5FFCA 5LS9A 3KX9A 1JGCA 4RC7B 2BK6A 1LKOA 2YJJA 4ISMA 1XZ3A 3HL1A 4RC5B 3U90A 3E2CA 4TOBA 1Z6OA 4QUWA 2OH3A 2JD60 5D8RA 3MPSA 1ZUJA 1XZ1A 3QD8A 4CMYV 3KA3A 4TOEA 3UOFA 3F36A 4AM4A 1TKPA 4MJYA 3RBCA 2FL0A 4TW3A 3PVRB 3E1PA 3PWQC 1DATA 3BVFA 4ZKXA 1VEIA 4AM5A 4M33A 1VJXA 4PG1A 1IESA 3R2KA 2XJOA 5JACA 1BG7A 1VLGA 2Z90A 3O7SA 4ZKWA 3E6SA 1OTKA 1JKVA 4TOHA 4EVDA 2CHPA 2V15A 4ZMCA 5GN8B 1FHAA 1R03A 3KA6A 1NF4A 5FFEA 1QYBA 3KA4A 3Q4OA 1SQ3A 4TOFA 1QGHA 5FFAA 1NFVA 2RBDA 3SHXA 4DZ0A 3R2OA 5D8YA 3QHCA 1ZS3A 4CYBA 3E1MA 3PW1A 2FHAA 3QZ3A 1S2ZA 3UOIA 5JKLG 3NP0X 3Q4QA 4ITTA 5HJFA 1KRQA 4DASA 2Z5QA 3FI6A 2FKZA 4A25A 2V2NA 2ZA6A 4XKUA 2V2OA 3IS7A 1F30A 4LYUA 4Y08A 1YUZA 3F35A 3PVYB 1VEQA 2VXXA 1RCDA 2V2LA 4ZTTA 2BKCA 2V2JA 2YW6A 1B71A 3FSEA 2CN7A 3E1JA 3F38A 5GU2X 5D8OA 1GWGA 4LPMA 1JI4A 2BW1A 4DI0A 4LPNA 4RC5A 5J93A 4Z5SA 4M35A 5AXSA 4TO9A 2VXIA 2C2JA 5FFBA 4DYZA 5E2DA 3EZ0A 3H7GA 4CY9A 3F34A 1J30A 4CVSA 3R2MA 4DE6A 5HQOA 3PVRA 1L8IA 5LG8A 4YKHA 3R2SA 4LYXA 2IB0A 2WLUA 4XGSA 2Z5PA 3BVIA 4EVCA 1JREA 2ZG8X 1RCEA 3AJQA 2JD80 5GN8A 1O9RA 2XJMA 1JTSA 2X170 1IERA 2C6RA 3WVVA 3F37A 4R42A 3KXUA 3R2LA 4ETRA 2ZA7A 3ISFA 1EUMA 3AK8A 1LKPA 3PVTB 2V2RA 1LKMA 4KVQA 5K53A 2FG4A 2IU2A 2V2SA 2CIHA 3QVDA 5JKMA 5GOUA 1L8HA 3SIDA 3E1OA 2HR5A 3PW8A 3RE7A 3NP2X 4CVPA 2IY4A 1UMNA 3F39A 3NOZX 5CZUA 5D8QA 3PVYA 3SH6A 4ERUA 2OC5A 4E6KA 3RD0A 2XGWA 4CYAA 1S30A 2CHIA 4MN9A 5ERJA 1JIGA 2WTLA 2FG8A 5CMRA 1DPSA 3EZUA 3QHBA 3GVYA 3ES3A 3E1QA 4TOCA 1RCIA 4LQVA 3GE4A 4KVSA 4REUA 3WNWA 3ISEA 1UVHA 2VZBA 2Z6MA 2F7NA 2C41A 3R2RA 5CMQA 4XKSA 5GU3X 2BJYA 4M32A 5J9VA 3Q4NA 4XKTA 1LB3A 4RC8A 4LQJA 4CVTA 4PGKA 3RAVA 4ML5A 1VELA 2XJNA 2FJCA 5J8SA 1SOFA 4LQNA 5I4JA 2XKQA 5LG2A 2Y3QA 1NNQA 2QF9A 3BVEA 3KA8A 2CLUA 3SE1A 4CMYA 1Z6OM 3AJPA 2CF7A 2CN6A 4IWKA 1AEWA 2WLAA 3UNOA 1N1QA 3F33A 2G4HA 3VNXA 4IXKA 2V2IA 1HRSA 2V2MA 1MFRA 4EVBA 4CVRA 4P18A 1YV1A 4LQHA 1YUXA 4TOAA 3BVKA 3PZAA 3PVTA 4DYUA
chains in the Genus database with same CATH superfamily
3F32A 1H96A 4AM2A 1MOJA 3AK9A 1DVBA 3IQ1A 3EGMA 3PWQA 2D5KA 2ZG9X 4ISPA 2GYDA 1NF6A 4WJG4 5K52A 2JD70 3BT5A 4Z3BA 4TODA 3AF7X 4RC6B 1Z4AA 5FFDA 2C2UA 4PG0A 2C2FA 4LPJA 3T9JA 1RYTA 1S3QA 2FZFA 2QQYA 5FEJA 3R2HA 2YJKA 4MUDA 3UFBA 1JKUA 3QB9A 3GGZA 3WVWA 2HTNA 2WWXB 2GYQA 2ZURX 4MY7A 1JI5A 2Z5RA 3A9QA 1F33A 3BKNA 4MKUA 5JKLA 3OJ5A 4M34A 1TJOA 2UX1A 4II4A 3KWOA 1TK6A 4TOGA 5JDOA 4X0JA 3PW8C 5HU6D 5D8PA 3TA8A 5JKMG 2PYBA 3ERZA 4DYXA 3E1LA 1BFRA 3KA9A 2MGYA 3Q4RA 3BVLA 3PWFA 2AR0A 1RCCA 3N6OA 4EVEA 5J8WA 4ZLWA 3GHQA 3AF9X 4II4B 5D8XA 5E1UA 2YW7A 1TKOA 5JDOB 2OKCA 3C1ZA 3E1NA 5ERKA 3A68A 5HJHA 5IX6A 4ZL6A 3JZ9A 4DYYA 3IS8A 4ZL5A 1BCFA 2FFXJ 1O9IA 3PW1B 1JYBA 4YVZA 1RCGA 4IWJA 4ZJKA 5C6FA 4U3GA 2V2PA 4KVRA 4RC7A 2ITBA 2GS4A 4OYNA 3E6RA 3OGHA 3AF8X 2W0OA 4PGIA 5LBHA 5GU1X 3WVUA 4ITWA 3O7RA 3RGDA 2CLBA 4KXRB 4ZKHA 3HIUA 3AJOA 5D8SA 4MXPA 2CEIA 5GU0X 3FVBA 2ZG7X 2ZA8A 4RC6A 5FFCA 3DBYA 5LS9A 3KX9A 1JGCA 2Y44A 4RC7B 2BK6A 1LKOA 2V8TA 2YJJA 4ISMA 1XZ3A 3HL1A 4RC5B 3U90A 3E2CA 4TOBA 1Z6OA 4QUWA 2OH3A 2JD60 5D8RA 3MPSA 1ZUJA 1XZ1A 3QD8A 4CMYV 3KA3A 4TOEA 3UOFA 3FRSA 3GGYA 3F36A 4AM4A 1TKPA 4MJYA 3RBCA 2FL0A 4TW3A 3PVRB 3E1PA 3PWQC 1DATA 3BVFA 4ZKXA 1VEIA 4AM5A 4E40A 4M33A 1VJXA 4PG1A 1IESA 3R2KA 2N02A 2XJOA 5JACA 1BG7A 1VLGA 2Z90A 3O7SA 2G38B 4ZKWA 3E6SA 1OTKA 3LKDA 1JKVA 4TOHA 4EVDA 2CHPA 2V15A 4ZMCA 5GN8B 1FHAA 1R03A 3KA6A 1NF4A 5FFEA 1QYBA 3KA4A 3Q4OA 1SQ3A 4TOFA 1QGHA 5FFAA 1NFVA 2RBDA 3SHXA 4DZ0A 3R2OA 5D8YA 3QHCA 1ZS3A 4CYBA 3E1MA 3PW1A 2FHAA 3QZ3A 1S2ZA 3UOIA 5JKLG 3NP0X 3Q4QA 4ITTA 5HJFA 1KRQA 4DASA 2Z5QA 3FI6A 2FKZA 4A25A 2V2NA 2ZA6A 4XKUA 3V3KB 2V2OA 3IS7A 1F30A 4LYUA 4Y08A 1YUZA 3F35A 3PVYB 3VV9A 1VEQA 2VXXA 3VVAA 1RCDA 2V2LA 4ZTTA 2BKCA 2V2JA 2YW6A 1B71A 3FSEA 2CN7A 3E1JA 3F38A 5GU2X 5D8OA 1GWGA 4LPMA 4YXMA 1JI4A 2BW1A 3JZAB 4DI0A 3KHKA 4LPNA 4RC5A 5J93A 4Z5SA 4M35A 5AXSA 4W4LB 4TO9A 2VXIA 2C2JA 5FFBA 4DYZA 5E2DA 3EZ0A 3H7GA 4CY9A 3F34A 1J30A 4CVSA 3R2MA 4DE6A 5HQOA 3PVRA 3C21A 1L8IA 5LG8A 4YKHA 3R2SA 4LYXA 3KDQA 2IB0A 2WLUA 4XGSA 2Z5PA 3BVIA 4EVCA 2CWLA 1JREA 2ZG8X 1RCEA 3AJQA 2JD80 3D19A 5GN8A 2V8UA 1O9RA 2XJMA 1JTSA 2X170 3W54A 1IERA 2C6RA 3WVVA 3F37A 4R42A 3KXUA 3R2LA 4ETRA 2ZA7A 3ISFA 1EUMA 3AK8A 1LKPA 3PVTB 2V2RA 1LKMA 4KVQA 5K53A 2FG4A 2IU2A 2V2SA 2CIHA 3QVDA 5JKMA 5GOUA 1L8HA 3SIDA 3E1OA 2HR5A 3PW8A 3RE7A 3NP2X 4CVPA 2IY4A 3C1YA 1UMNA 3F39A 3NOZX 5CZUA 5D8QA 3PVYA 3SH6A 4YXJA 3L0MA 4ERUA 2OC5A 4E6KA 3RD0A 2XGWA 4CYAA 1S30A 2CHIA 4MN9A 5ERJA 1JIGA 2WTLA 2FG8A 5CMRA 1DPSA 3EZUA 3QHBA 3GVYA 3ES3A 3E1QA 4TOCA 1RCIA 4LQVA 3GE4A 4KVSA 4REUA 3WNWA 3ISEA 1UVHA 2VZBA 2Z6MA 2F7NA 2C41A 3R2RA 5CMQA 4XKSA 5GU3X 2BJYA 4M32A 5J9VA 3Q4NA 4XKTA 1LB3A 4RC8A 4LQJA 4CVTA 4PGKA 3RAVA 4ML5A 1VELA 3M6JA 2XJNA 2FJCA 5J8SA 1SOFA 4LQNA 5I4JA 2XKQA 5LG2A 2Y3QA 1NNQA 2QF9A 3BVEA 3KA8A 2CLUA 3FRRA 3SE1A 4CMYA 1Z6OM 3AJPA 2CF7A 2CN6A 4IWKA 1AEWA 2WLAA 3UNOA 1N1QA 3F33A 2G4HA 3VNXA 3C23A 4IXKA 2V2IA 1HRSA 2V2MA 1MFRA 4EVBA 4CVRA 4P18A 1YV1A 4LQHA 1YUXA 4TOAA 4W4KB 3BVKA 3PZAA 3PVTA 4DYUA
chains in the Genus database with same CATH topology
3F32A 1H96A 4AM2A 1MOJA 3AK9A 1DVBA 3IQ1A 3EGMA 3PWQA 2D5KA 2ZG9X 4ISPA 2GYDA 1NF6A 4WJG4 5K52A 2JD70 3BT5A 4Z3BA 4TODA 3AF7X 4RC6B 1Z4AA 5FFDA 2C2UA 4PG0A 2C2FA 4LPJA 3T9JA 1RYTA 1S3QA 2FZFA 2QQYA 5FEJA 3R2HA 2YJKA 4MUDA 3UFBA 1JKUA 3QB9A 3GGZA 3WVWA 2HTNA 2WWXB 2GYQA 2ZURX 4MY7A 1JI5A 2Z5RA 3A9QA 1F33A 3BKNA 4MKUA 5JKLA 3OJ5A 4M34A 1TJOA 2UX1A 4II4A 3KWOA 1TK6A 4TOGA 5JDOA 4X0JA 3PW8C 5HU6D 5D8PA 3TA8A 5JKMG 2PYBA 3ERZA 4DYXA 3E1LA 1BFRA 3KA9A 2MGYA 3Q4RA 3BVLA 3PWFA 2AR0A 1RCCA 3N6OA 4EVEA 5J8WA 4ZLWA 3GHQA 3AF9X 4II4B 5D8XA 5E1UA 2YW7A 1TKOA 5JDOB 2OKCA 3C1ZA 3E1NA 5ERKA 3A68A 5HJHA 5IX6A 4ZL6A 3JZ9A 4DYYA 3IS8A 4ZL5A 1BCFA 2FFXJ 1O9IA 3PW1B 1JYBA 4YVZA 1RCGA 4IWJA 4ZJKA 5C6FA 4U3GA 2V2PA 4KVRA 4RC7A 2ITBA 2GS4A 4OYNA 3E6RA 3OGHA 3AF8X 2W0OA 4PGIA 5LBHA 5GU1X 3WVUA 4ITWA 3O7RA 3RGDA 2CLBA 4KXRB 4ZKHA 3HIUA 3AJOA 5D8SA 4MXPA 2CEIA 5GU0X 3FVBA 2ZG7X 2ZA8A 4RC6A 5FFCA 3DBYA 5LS9A 3KX9A 1JGCA 2Y44A 4RC7B 2BK6A 1LKOA 2V8TA 2YJJA 4ISMA 1XZ3A 3HL1A 4RC5B 3U90A 3E2CA 4TOBA 1Z6OA 4QUWA 2OH3A 2JD60 5D8RA 3MPSA 1ZUJA 1XZ1A 3QD8A 4CMYV 3KA3A 4TOEA 3UOFA 3FRSA 3GGYA 3F36A 4AM4A 1TKPA 4MJYA 3RBCA 2FL0A 4TW3A 3PVRB 3E1PA 3PWQC 1DATA 3BVFA 4ZKXA 1VEIA 4AM5A 4E40A 4M33A 1VJXA 4PG1A 1IESA 3R2KA 2N02A 2XJOA 5JACA 1BG7A 1VLGA 2Z90A 3O7SA 2G38B 4ZKWA 3E6SA 1OTKA 3LKDA 1JKVA 4TOHA 4EVDA 2CHPA 2V15A 4ZMCA 5GN8B 1FHAA 1R03A 3KA6A 1NF4A 5FFEA 1QYBA 3KA4A 3Q4OA 1SQ3A 4TOFA 1QGHA 5FFAA 1NFVA 2RBDA 3SHXA 4DZ0A 3R2OA 5D8YA 3QHCA 1ZS3A 4CYBA 3E1MA 3PW1A 2FHAA 3QZ3A 1S2ZA 3UOIA 5JKLG 3NP0X 3Q4QA 4ITTA 5HJFA 1KRQA 4DASA 2Z5QA 3FI6A 2FKZA 4A25A 2V2NA 2ZA6A 4XKUA 3V3KB 2V2OA 3IS7A 1F30A 4LYUA 4Y08A 1YUZA 3F35A 3PVYB 3VV9A 1VEQA 2VXXA 3VVAA 1RCDA 2V2LA 4ZTTA 2BKCA 2V2JA 2YW6A 1B71A 3FSEA 2CN7A 3E1JA 3F38A 5GU2X 5D8OA 1GWGA 4LPMA 4YXMA 1JI4A 2BW1A 3JZAB 4DI0A 3KHKA 4LPNA 4RC5A 5J93A 4Z5SA 4M35A 5AXSA 4W4LB 4TO9A 2VXIA 2C2JA 5FFBA 4DYZA 5E2DA 3EZ0A 3H7GA 4CY9A 3F34A 1J30A 4CVSA 3R2MA 4DE6A 5HQOA 3PVRA 3C21A 1L8IA 5LG8A 4YKHA 3R2SA 4LYXA 3KDQA 2IB0A 2WLUA 4XGSA 2Z5PA 3BVIA 4EVCA 2CWLA 1JREA 2ZG8X 1RCEA 3AJQA 2JD80 3D19A 5GN8A 2V8UA 1O9RA 2XJMA 1JTSA 2X170 3W54A 1IERA 2C6RA 3WVVA 3F37A 4R42A 3KXUA 3R2LA 4ETRA 2ZA7A 3ISFA 1EUMA 3AK8A 1LKPA 3PVTB 2V2RA 1LKMA 4KVQA 5K53A 2FG4A 2IU2A 2V2SA 2CIHA 3QVDA 5JKMA 5GOUA 1L8HA 3SIDA 3E1OA 2HR5A 3PW8A 3RE7A 3NP2X 4CVPA 2IY4A 3C1YA 1UMNA 3F39A 3NOZX 5CZUA 5D8QA 3PVYA 3SH6A 4YXJA 3L0MA 4ERUA 2OC5A 4E6KA 3RD0A 2XGWA 4CYAA 1S30A 2CHIA 4MN9A 5ERJA 1JIGA 2WTLA 2FG8A 5CMRA 1DPSA 3EZUA 3QHBA 3GVYA 3ES3A 3E1QA 4TOCA 1RCIA 4LQVA 3GE4A 4KVSA 4REUA 3WNWA 3ISEA 1UVHA 2VZBA 2Z6MA 2F7NA 2C41A 3R2RA 5CMQA 4XKSA 5GU3X 2BJYA 4M32A 5J9VA 3Q4NA 4XKTA 1LB3A 4RC8A 4LQJA 4CVTA 4PGKA 3RAVA 4ML5A 1VELA 3M6JA 2XJNA 2FJCA 5J8SA 1SOFA 4LQNA 5I4JA 2XKQA 5LG2A 2Y3QA 1NNQA 2QF9A 3BVEA 3KA8A 2CLUA 3FRRA 3SE1A 4CMYA 1Z6OM 3AJPA 2CF7A 2CN6A 4IWKA 1AEWA 2WLAA 3UNOA 1N1QA 3F33A 2G4HA 3VNXA 3C23A 4IXKA 2V2IA 1HRSA 2V2MA 1MFRA 4EVBA 4CVRA 4P18A 1YV1A 4LQHA 1YUXA 4TOAA 4W4KB 3BVKA 3PZAA 3PVTA 4DYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F32 A;  1H96 A;  4AM2 A;  1MOJ A;  3AK9 A;  1DVB A;  3IQ1 A;  3EGM A;  3PWQ A;  2D5K A;  2ZG9 X;  4ISP A;  2GYD A;  1NF6 A;  5K52 A;  4Z3B A;  2JD7 0;  3BT5 A;  4TOD A;  3AF7 X;  4RC6 B;  1Z4A A;  5FFD A;  2C2U A;  4PG0 A;  2C2F A;  4LPJ A;  3T9J A;  1RYT A;  1S3Q A;  2FZF A;  2QQY A;  5FEJ A;  3R2H A;  2YJK A;  4MUD A;  1JKU A;  3QB9 A;  3WVW A;  2HTN A;  4MY7 A;  2GYQ A;  2ZUR X;  1JI5 A;  2Z5R A;  3A9Q A;  1F33 A;  3BKN A;  4MKU A;  5JKL A;  3OJ5 A;  4M34 A;  1TJO A;  2UX1 A;  4II4 A;  3KWO A;  1TK6 A;  4TOG A;  3PW8 C;  5D8P A;  3TA8 A;  5JKM G;  2PYB A;  3ERZ A;  4DYX A;  3E1L A;  1BFR A;  3KA9 A;  3Q4R A;  3BVL A;  3PWF A;  1RCC A;  4EVE A;  5J8W A;  4ZLW A;  3GHQ A;  3AF9 X;  4II4 B;  5D8X A;  5E1U A;  2YW7 A;  1TKO A;  3E1N A;  5ERK A;  3A68 A;  5HJH A;  5IX6 A;  4ZL6 A;  4DYY A;  3IS8 A;  4ZL5 A;  1BCF A;  2FFX J;  1O9I A;  3PW1 B;  1JYB A;  1RCG A;  4IWJ A;  4ZJK A;  5C6F A;  4U3G A;  2V2P A;  4KVR A;  4RC7 A;  2ITB A;  2GS4 A;  4OYN A;  3E6R A;  3OGH A;  3AF8 X;  2W0O A;  4PGI A;  5LBH A;  5GU1 X;  3WVU A;  4ITW A;  3O7R A;  3RGD A;  2CLB A;  4ZKH A;  3HIU A;  3AJO A;  5D8S A;  2CEI A;  5GU0 X;  3FVB A;  2ZG7 X;  2ZA8 A;  4RC6 A;  5FFC A;  5LS9 A;  3KX9 A;  1JGC A;  4RC7 B;  2BK6 A;  1LKO A;  2YJJ A;  4ISM A;  1XZ3 A;  3HL1 A;  4RC5 B;  3U90 A;  3E2C A;  4TOB A;  1Z6O A;  4QUW A;  2OH3 A;  2JD6 0;  5D8R A;  3MPS A;  1ZUJ A;  1XZ1 A;  3QD8 A;  4CMY V;  3KA3 A;  4TOE A;  3UOF A;  3F36 A;  4AM4 A;  1TKP A;  4MJY A;  3RBC A;  2FL0 A;  4TW3 A;  3PVR B;  3E1P A;  3PWQ C;  1DAT A;  3BVF A;  4ZKX A;  1VEI A;  4AM5 A;  4M33 A;  1VJX A;  4PG1 A;  1IES A;  3R2K A;  2XJO A;  5JAC A;  1BG7 A;  1VLG A;  2Z90 A;  3O7S A;  4ZKW A;  3E6S A;  1OTK A;  1JKV A;  4TOH A;  4EVD A;  2CHP A;  2V15 A;  4ZMC A;  5GN8 B;  1FHA A;  1R03 A;  3KA6 A;  1NF4 A;  5FFE A;  1QYB A;  3KA4 A;  3Q4O A;  1SQ3 A;  4TOF A;  1QGH A;  5FFA A;  1NFV A;  2RBD A;  3SHX A;  4DZ0 A;  3R2O A;  5D8Y A;  3QHC A;  1ZS3 A;  4CYB A;  3E1M A;  3PW1 A;  2FHA A;  3QZ3 A;  1S2Z A;  3UOI A;  5JKL G;  3NP0 X;  3Q4Q A;  4ITT A;  5HJF A;  1KRQ A;  4DAS A;  2Z5Q A;  3FI6 A;  2FKZ A;  4A25 A;  2V2N A;  2ZA6 A;  4XKU A;  2V2O A;  3IS7 A;  1F30 A;  4LYU A;  4Y08 A;  1YUZ A;  3F35 A;  3PVY B;  1VEQ A;  2VXX A;  1RCD A;  2V2L A;  4ZTT A;  2BKC A;  2V2J A;  2YW6 A;  1B71 A;  3FSE A;  2CN7 A;  3E1J A;  3F38 A;  5GU2 X;  5D8O A;  1GWG A;  4LPM A;  1JI4 A;  2BW1 A;  4DI0 A;  4LPN A;  4RC5 A;  5J93 A;  4Z5S A;  4M35 A;  5AXS A;  4TO9 A;  2VXI A;  2C2J A;  5FFB A;  4DYZ A;  5E2D A;  3EZ0 A;  3H7G A;  4CY9 A;  3F34 A;  1J30 A;  4CVS A;  3R2M A;  4DE6 A;  5HQO A;  3PVR A;  1L8I A;  5LG8 A;  4YKH A;  3R2S A;  4LYX A;  2IB0 A;  2WLU A;  4XGS A;  2Z5P A;  3BVI A;  4EVC A;  1JRE A;  2ZG8 X;  1RCE A;  3AJQ A;  2JD8 0;  5GN8 A;  1O9R A;  2XJM A;  1JTS A;  2X17 0;  1IER A;  2C6R A;  3WVV A;  3F37 A;  4R42 A;  3KXU A;  3R2L A;  4ETR A;  2ZA7 A;  3ISF A;  1EUM A;  3AK8 A;  1LKP A;  3PVT B;  2V2R A;  1LKM A;  4KVQ A;  5K53 A;  2FG4 A;  2IU2 A;  2V2S A;  2CIH A;  3QVD A;  5JKM A;  5GOU A;  1L8H A;  3SID A;  3E1O A;  2HR5 A;  3PW8 A;  3RE7 A;  3NP2 X;  4CVP A;  2IY4 A;  1UMN A;  3F39 A;  3NOZ X;  5CZU A;  5D8Q A;  3PVY A;  3SH6 A;  4ERU A;  2OC5 A;  4E6K A;  3RD0 A;  2XGW A;  4CYA A;  1S30 A;  2CHI A;  4MN9 A;  5ERJ A;  1JIG A;  2WTL A;  2FG8 A;  5CMR A;  1DPS A;  3EZU A;  3QHB A;  3GVY A;  3ES3 A;  3E1Q A;  4TOC A;  1RCI A;  4LQV A;  3GE4 A;  4KVS A;  4REU A;  3WNW A;  3ISE A;  1UVH A;  2VZB A;  2Z6M A;  2F7N A;  2C41 A;  3R2R A;  5CMQ A;  4XKS A;  5GU3 X;  2BJY A;  4M32 A;  5J9V A;  3Q4N A;  4XKT A;  1LB3 A;  4RC8 A;  4LQJ A;  4CVT A;  4PGK A;  3RAV A;  4ML5 A;  1VEL A;  2XJN A;  2FJC A;  5J8S A;  1SOF A;  4LQN A;  5I4J A;  2XKQ A;  5LG2 A;  2Y3Q A;  1NNQ A;  2QF9 A;  3BVE A;  3KA8 A;  2CLU A;  3SE1 A;  4CMY A;  1Z6O M;  3AJP A;  2CF7 A;  2CN6 A;  4IWK A;  1AEW A;  2WLA A;  3UNO A;  1N1Q A;  3F33 A;  2G4H A;  3VNX A;  4IXK A;  2V2I A;  1HRS A;  2V2M A;  1MFR A;  4EVB A;  4CVR A;  4P18 A;  1YV1 A;  4LQH A;  1YUX A;  4TOA A;  3BVK A;  3PZA A;  3PVT A;  4DYU A; 
#chains in the Genus database with same CATH topology
 3F32 A;  1H96 A;  4AM2 A;  1MOJ A;  3AK9 A;  1DVB A;  3IQ1 A;  3EGM A;  3PWQ A;  2D5K A;  2ZG9 X;  4ISP A;  2GYD A;  1NF6 A;  4WJG 4;  5K52 A;  2JD7 0;  3BT5 A;  4Z3B A;  4TOD A;  3AF7 X;  4RC6 B;  1Z4A A;  5FFD A;  2C2U A;  4PG0 A;  2C2F A;  4LPJ A;  3T9J A;  1RYT A;  1S3Q A;  2FZF A;  2QQY A;  5FEJ A;  3R2H A;  2YJK A;  4MUD A;  3UFB A;  1JKU A;  3QB9 A;  3GGZ A;  3WVW A;  2HTN A;  2WWX B;  2GYQ A;  2ZUR X;  4MY7 A;  1JI5 A;  2Z5R A;  3A9Q A;  1F33 A;  3BKN A;  4MKU A;  5JKL A;  3OJ5 A;  4M34 A;  1TJO A;  2UX1 A;  4II4 A;  3KWO A;  1TK6 A;  4TOG A;  5JDO A;  4X0J A;  3PW8 C;  5HU6 D;  5D8P A;  3TA8 A;  5JKM G;  2PYB A;  3ERZ A;  4DYX A;  3E1L A;  1BFR A;  3KA9 A;  2MGY A;  3Q4R A;  3BVL A;  3PWF A;  2AR0 A;  1RCC A;  3N6O A;  4EVE A;  5J8W A;  4ZLW A;  3GHQ A;  3AF9 X;  4II4 B;  5D8X A;  5E1U A;  2YW7 A;  1TKO A;  5JDO B;  2OKC A;  3C1Z A;  3E1N A;  5ERK A;  3A68 A;  5HJH A;  5IX6 A;  4ZL6 A;  3JZ9 A;  4DYY A;  3IS8 A;  4ZL5 A;  1BCF A;  2FFX J;  1O9I A;  3PW1 B;  1JYB A;  4YVZ A;  1RCG A;  4IWJ A;  4ZJK A;  5C6F A;  4U3G A;  2V2P A;  4KVR A;  4RC7 A;  2ITB A;  2GS4 A;  4OYN A;  3E6R A;  3OGH A;  3AF8 X;  2W0O A;  4PGI A;  5LBH A;  5GU1 X;  3WVU A;  4ITW A;  3O7R A;  3RGD A;  2CLB A;  4KXR B;  4ZKH A;  3HIU A;  3AJO A;  5D8S A;  4MXP A;  2CEI A;  5GU0 X;  3FVB A;  2ZG7 X;  2ZA8 A;  4RC6 A;  5FFC A;  3DBY A;  5LS9 A;  3KX9 A;  1JGC A;  2Y44 A;  4RC7 B;  2BK6 A;  1LKO A;  2V8T A;  2YJJ A;  4ISM A;  1XZ3 A;  3HL1 A;  4RC5 B;  3U90 A;  3E2C A;  4TOB A;  1Z6O A;  4QUW A;  2OH3 A;  2JD6 0;  5D8R A;  3MPS A;  1ZUJ A;  1XZ1 A;  3QD8 A;  4CMY V;  3KA3 A;  4TOE A;  3UOF A;  3FRS A;  3GGY A;  3F36 A;  4AM4 A;  1TKP A;  4MJY A;  3RBC A;  2FL0 A;  4TW3 A;  3PVR B;  3E1P A;  3PWQ C;  1DAT A;  3BVF A;  4ZKX A;  1VEI A;  4AM5 A;  4E40 A;  4M33 A;  1VJX A;  4PG1 A;  1IES A;  3R2K A;  2N02 A;  2XJO A;  5JAC A;  1BG7 A;  1VLG A;  2Z90 A;  3O7S A;  2G38 B;  4ZKW A;  3E6S A;  1OTK A;  3LKD A;  1JKV A;  4TOH A;  4EVD A;  2CHP A;  2V15 A;  4ZMC A;  5GN8 B;  1FHA A;  1R03 A;  3KA6 A;  1NF4 A;  5FFE A;  1QYB A;  3KA4 A;  3Q4O A;  1SQ3 A;  4TOF A;  1QGH A;  5FFA A;  1NFV A;  2RBD A;  3SHX A;  4DZ0 A;  3R2O A;  5D8Y A;  3QHC A;  1ZS3 A;  4CYB A;  3E1M A;  3PW1 A;  2FHA A;  3QZ3 A;  1S2Z A;  3UOI A;  5JKL G;  3NP0 X;  3Q4Q A;  4ITT A;  5HJF A;  1KRQ A;  4DAS A;  2Z5Q A;  3FI6 A;  2FKZ A;  4A25 A;  2V2N A;  2ZA6 A;  4XKU A;  3V3K B;  2V2O A;  3IS7 A;  1F30 A;  4LYU A;  4Y08 A;  1YUZ A;  3F35 A;  3PVY B;  3VV9 A;  1VEQ A;  2VXX A;  3VVA A;  1RCD A;  2V2L A;  4ZTT A;  2BKC A;  2V2J A;  2YW6 A;  1B71 A;  3FSE A;  2CN7 A;  3E1J A;  3F38 A;  5GU2 X;  5D8O A;  1GWG A;  4LPM A;  4YXM A;  1JI4 A;  2BW1 A;  3JZA B;  4DI0 A;  3KHK A;  4LPN A;  4RC5 A;  5J93 A;  4Z5S A;  4M35 A;  5AXS A;  4W4L B;  4TO9 A;  2VXI A;  2C2J A;  5FFB A;  4DYZ A;  5E2D A;  3EZ0 A;  3H7G A;  4CY9 A;  3F34 A;  1J30 A;  4CVS A;  3R2M A;  4DE6 A;  5HQO A;  3PVR A;  3C21 A;  1L8I A;  5LG8 A;  4YKH A;  3R2S A;  4LYX A;  3KDQ A;  2IB0 A;  2WLU A;  4XGS A;  2Z5P A;  3BVI A;  4EVC A;  2CWL A;  1JRE A;  2ZG8 X;  1RCE A;  3AJQ A;  2JD8 0;  3D19 A;  5GN8 A;  2V8U A;  1O9R A;  2XJM A;  1JTS A;  2X17 0;  3W54 A;  1IER A;  2C6R A;  3WVV A;  3F37 A;  4R42 A;  3KXU A;  3R2L A;  4ETR A;  2ZA7 A;  3ISF A;  1EUM A;  3AK8 A;  1LKP A;  3PVT B;  2V2R A;  1LKM A;  4KVQ A;  5K53 A;  2FG4 A;  2IU2 A;  2V2S A;  2CIH A;  3QVD A;  5JKM A;  5GOU A;  1L8H A;  3SID A;  3E1O A;  2HR5 A;  3PW8 A;  3RE7 A;  3NP2 X;  4CVP A;  2IY4 A;  3C1Y A;  1UMN A;  3F39 A;  3NOZ X;  5CZU A;  5D8Q A;  3PVY A;  3SH6 A;  4YXJ A;  3L0M A;  4ERU A;  2OC5 A;  4E6K A;  3RD0 A;  2XGW A;  4CYA A;  1S30 A;  2CHI A;  4MN9 A;  5ERJ A;  1JIG A;  2WTL A;  2FG8 A;  5CMR A;  1DPS A;  3EZU A;  3QHB A;  3GVY A;  3ES3 A;  3E1Q A;  4TOC A;  1RCI A;  4LQV A;  3GE4 A;  4KVS A;  4REU A;  3WNW A;  3ISE A;  1UVH A;  2VZB A;  2Z6M A;  2F7N A;  2C41 A;  3R2R A;  5CMQ A;  4XKS A;  5GU3 X;  2BJY A;  4M32 A;  5J9V A;  3Q4N A;  4XKT A;  1LB3 A;  4RC8 A;  4LQJ A;  4CVT A;  4PGK A;  3RAV A;  4ML5 A;  1VEL A;  3M6J A;  2XJN A;  2FJC A;  5J8S A;  1SOF A;  4LQN A;  5I4J A;  2XKQ A;  5LG2 A;  2Y3Q A;  1NNQ A;  2QF9 A;  3BVE A;  3KA8 A;  2CLU A;  3FRR A;  3SE1 A;  4CMY A;  1Z6O M;  3AJP A;  2CF7 A;  2CN6 A;  4IWK A;  1AEW A;  2WLA A;  3UNO A;  1N1Q A;  3F33 A;  2G4H A;  3VNX A;  3C23 A;  4IXK A;  2V2I A;  1HRS A;  2V2M A;  1MFR A;  4EVB A;  4CVR A;  4P18 A;  1YV1 A;  4LQH A;  1YUX A;  4TOA A;  4W4K B;  3BVK A;  3PZA A;  3PVT A;  4DYU A; 
#chains in the Genus database with same CATH homology
 3F32 A;  1H96 A;  4AM2 A;  1MOJ A;  3AK9 A;  1DVB A;  3IQ1 A;  3EGM A;  3PWQ A;  2D5K A;  2ZG9 X;  4ISP A;  2GYD A;  1NF6 A;  4WJG 4;  5K52 A;  2JD7 0;  3BT5 A;  4Z3B A;  4TOD A;  3AF7 X;  4RC6 B;  1Z4A A;  5FFD A;  2C2U A;  4PG0 A;  2C2F A;  4LPJ A;  3T9J A;  1RYT A;  1S3Q A;  2FZF A;  2QQY A;  5FEJ A;  3R2H A;  2YJK A;  4MUD A;  3UFB A;  1JKU A;  3QB9 A;  3GGZ A;  3WVW A;  2HTN A;  2WWX B;  2GYQ A;  2ZUR X;  4MY7 A;  1JI5 A;  2Z5R A;  3A9Q A;  1F33 A;  3BKN A;  4MKU A;  5JKL A;  3OJ5 A;  4M34 A;  1TJO A;  2UX1 A;  4II4 A;  3KWO A;  1TK6 A;  4TOG A;  5JDO A;  4X0J A;  3PW8 C;  5HU6 D;  5D8P A;  3TA8 A;  5JKM G;  2PYB A;  3ERZ A;  4DYX A;  3E1L A;  1BFR A;  3KA9 A;  2MGY A;  3Q4R A;  3BVL A;  3PWF A;  2AR0 A;  1RCC A;  3N6O A;  4EVE A;  5J8W A;  4ZLW A;  3GHQ A;  3AF9 X;  4II4 B;  5D8X A;  5E1U A;  2YW7 A;  1TKO A;  5JDO B;  2OKC A;  3C1Z A;  3E1N A;  5ERK A;  3A68 A;  5HJH A;  5IX6 A;  4ZL6 A;  3JZ9 A;  4DYY A;  3IS8 A;  4ZL5 A;  1BCF A;  2FFX J;  1O9I A;  3PW1 B;  1JYB A;  4YVZ A;  1RCG A;  4IWJ A;  4ZJK A;  5C6F A;  4U3G A;  2V2P A;  4KVR A;  4RC7 A;  2ITB A;  2GS4 A;  4OYN A;  3E6R A;  3OGH A;  3AF8 X;  2W0O A;  4PGI A;  5LBH A;  5GU1 X;  3WVU A;  4ITW A;  3O7R A;  3RGD A;  2CLB A;  4KXR B;  4ZKH A;  3HIU A;  3AJO A;  5D8S A;  4MXP A;  2CEI A;  5GU0 X;  3FVB A;  2ZG7 X;  2ZA8 A;  4RC6 A;  5FFC A;  3DBY A;  5LS9 A;  3KX9 A;  1JGC A;  2Y44 A;  4RC7 B;  2BK6 A;  1LKO A;  2V8T A;  2YJJ A;  4ISM A;  1XZ3 A;  3HL1 A;  4RC5 B;  3U90 A;  3E2C A;  4TOB A;  1Z6O A;  4QUW A;  2OH3 A;  2JD6 0;  5D8R A;  3MPS A;  1ZUJ A;  1XZ1 A;  3QD8 A;  4CMY V;  3KA3 A;  4TOE A;  3UOF A;  3FRS A;  3GGY A;  3F36 A;  4AM4 A;  1TKP A;  4MJY A;  3RBC A;  2FL0 A;  4TW3 A;  3PVR B;  3E1P A;  3PWQ C;  1DAT A;  3BVF A;  4ZKX A;  1VEI A;  4AM5 A;  4E40 A;  4M33 A;  1VJX A;  4PG1 A;  1IES A;  3R2K A;  2N02 A;  2XJO A;  5JAC A;  1BG7 A;  1VLG A;  2Z90 A;  3O7S A;  2G38 B;  4ZKW A;  3E6S A;  1OTK A;  3LKD A;  1JKV A;  4TOH A;  4EVD A;  2CHP A;  2V15 A;  4ZMC A;  5GN8 B;  1FHA A;  1R03 A;  3KA6 A;  1NF4 A;  5FFE A;  1QYB A;  3KA4 A;  3Q4O A;  1SQ3 A;  4TOF A;  1QGH A;  5FFA A;  1NFV A;  2RBD A;  3SHX A;  4DZ0 A;  3R2O A;  5D8Y A;  3QHC A;  1ZS3 A;  4CYB A;  3E1M A;  3PW1 A;  2FHA A;  3QZ3 A;  1S2Z A;  3UOI A;  5JKL G;  3NP0 X;  3Q4Q A;  4ITT A;  5HJF A;  1KRQ A;  4DAS A;  2Z5Q A;  3FI6 A;  2FKZ A;  4A25 A;  2V2N A;  2ZA6 A;  4XKU A;  3V3K B;  2V2O A;  3IS7 A;  1F30 A;  4LYU A;  4Y08 A;  1YUZ A;  3F35 A;  3PVY B;  3VV9 A;  1VEQ A;  2VXX A;  3VVA A;  1RCD A;  2V2L A;  4ZTT A;  2BKC A;  2V2J A;  2YW6 A;  1B71 A;  3FSE A;  2CN7 A;  3E1J A;  3F38 A;  5GU2 X;  5D8O A;  1GWG A;  4LPM A;  4YXM A;  1JI4 A;  2BW1 A;  3JZA B;  4DI0 A;  3KHK A;  4LPN A;  4RC5 A;  5J93 A;  4Z5S A;  4M35 A;  5AXS A;  4W4L B;  4TO9 A;  2VXI A;  2C2J A;  5FFB A;  4DYZ A;  5E2D A;  3EZ0 A;  3H7G A;  4CY9 A;  3F34 A;  1J30 A;  4CVS A;  3R2M A;  4DE6 A;  5HQO A;  3PVR A;  3C21 A;  1L8I A;  5LG8 A;  4YKH A;  3R2S A;  4LYX A;  3KDQ A;  2IB0 A;  2WLU A;  4XGS A;  2Z5P A;  3BVI A;  4EVC A;  2CWL A;  1JRE A;  2ZG8 X;  1RCE A;  3AJQ A;  2JD8 0;  3D19 A;  5GN8 A;  2V8U A;  1O9R A;  2XJM A;  1JTS A;  2X17 0;  3W54 A;  1IER A;  2C6R A;  3WVV A;  3F37 A;  4R42 A;  3KXU A;  3R2L A;  4ETR A;  2ZA7 A;  3ISF A;  1EUM A;  3AK8 A;  1LKP A;  3PVT B;  2V2R A;  1LKM A;  4KVQ A;  5K53 A;  2FG4 A;  2IU2 A;  2V2S A;  2CIH A;  3QVD A;  5JKM A;  5GOU A;  1L8H A;  3SID A;  3E1O A;  2HR5 A;  3PW8 A;  3RE7 A;  3NP2 X;  4CVP A;  2IY4 A;  3C1Y A;  1UMN A;  3F39 A;  3NOZ X;  5CZU A;  5D8Q A;  3PVY A;  3SH6 A;  4YXJ A;  3L0M A;  4ERU A;  2OC5 A;  4E6K A;  3RD0 A;  2XGW A;  4CYA A;  1S30 A;  2CHI A;  4MN9 A;  5ERJ A;  1JIG A;  2WTL A;  2FG8 A;  5CMR A;  1DPS A;  3EZU A;  3QHB A;  3GVY A;  3ES3 A;  3E1Q A;  4TOC A;  1RCI A;  4LQV A;  3GE4 A;  4KVS A;  4REU A;  3WNW A;  3ISE A;  1UVH A;  2VZB A;  2Z6M A;  2F7N A;  2C41 A;  3R2R A;  5CMQ A;  4XKS A;  5GU3 X;  2BJY A;  4M32 A;  5J9V A;  3Q4N A;  4XKT A;  1LB3 A;  4RC8 A;  4LQJ A;  4CVT A;  4PGK A;  3RAV A;  4ML5 A;  1VEL A;  3M6J A;  2XJN A;  2FJC A;  5J8S A;  1SOF A;  4LQN A;  5I4J A;  2XKQ A;  5LG2 A;  2Y3Q A;  1NNQ A;  2QF9 A;  3BVE A;  3KA8 A;  2CLU A;  3FRR A;  3SE1 A;  4CMY A;  1Z6O M;  3AJP A;  2CF7 A;  2CN6 A;  4IWK A;  1AEW A;  2WLA A;  3UNO A;  1N1Q A;  3F33 A;  2G4H A;  3VNX A;  3C23 A;  4IXK A;  2V2I A;  1HRS A;  2V2M A;  1MFR A;  4EVB A;  4CVR A;  4P18 A;  1YV1 A;  4LQH A;  1YUX A;  4TOA A;  4W4K B;  3BVK A;  3PZA A;  3PVT A;  4DYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...