3AF7X

Crystal structure of 25pd(allyl)/apo-fr
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
173
structure length
172
Chain Sequence
SSQIRQNYSTEVEAAVNRLVNLYLRASYTYLSLGFYFDRDDVALEGVCHFFRELAEEKREGAERLLKMQNQRGGRALFQDLQKPSQDEWGTTLDAMKAAIVLEKSLNQALLDLHALGSAQADPHLCDFLEHFLDEEVKLIKKMGDHLTNIQRLVGSQAGLGEYLFERLTLKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin light chain
publication title Mechanism of Accumulation and Incorporation of Organometallic Pd Complexes into the Protein Nanocage of apo-Ferritin.
pubmed doi rcsb
source organism Equus caballus
molecule tags Metal binding protein
total genus 67
structure length 172
sequence length 173
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3af7X00
3RE7A 2Z5PA 3OJ5A 1QGHA 4ZKWA 3AF9X 1RCDA 4PGIA 3OGHA 3RGDA 2HTNA 5ERKA 1IERA 5D8PA 2FKZA 3KXUA 2IY4A 5FFEA 1BG7A 4OYNA 2RBDA 3E2CA 5D8XA 5IX6A 1TKOA 3AJQA 5D8SA 5J9VA 2YJKA 1VEIA 3IS8A 5CZUA 4ZKHA 4A25A 2YW7A 1MFRA 4RC5B 1YUXA 2XJOA 3QZ3A 1L8HA 2CF7A 4AM4A 4ETRA 2G4HA 3E6SA 5LG8A 3KA3A 2FG8A 4ZTTA 2ZG8X 1Z6OA 1TK6A 1Z4AA 3IS7A 1JI4A 3F38A 3EZUA 1JTSA 4REUA 3VNXA 2FHAA 4ITTA 1JREA 1DATA 5FEJA 3AJOA 4CVSA 2ZURX 2BW1A 2CN6A 3QHBA 2C2FA 4MKUA 4RC7B 1KRQA 2FZFA 3E1JA 3R2KA 4ITWA 3QVDA 3GVYA 2ZA7A 3TA8A 3SH6A 4MUDA 3FVBA 4LQHA 4LYXA 3PW1A 2Z5QA 3SHXA 5CMQA 3ES3A 4ERUA 1H96A 2ZA6A 5D8RA 2W0OA 2GYQA 1O9RA 1AEWA 4DYZA 2V2LA 3BVEA 3PVYB 4ISPA 2Z90A 4CMYA 5FFCA 5GU3X 2YJJA 4AM5A 1NNQA 4KVQA 3EZ0A 2OH3A 2VZBA 4ZL5A 2VXIA 3UNOA 2BK6A 1XZ1A 1NF4A 2IU2A 4XKUA 3BVLA 5LG2A 3HIUA 3HL1A 3KA4A 2ZG7X 3RBCA 4IWKA 4CYBA 1LB3A 4LQNA 2CEIA 4IXKA 1L8IA 1YV1A 1F30A 4M34A 5FFAA 2CLBA 5I4JA 4ZMCA 5K53A 2FL0A 2HR5A 5JKMG 5ERJA 2XJMA 3PW8A 4TW3A 1BFRA 4ISMA 4QUWA 4RC6A 5E1UA 4DYXA 3PWQA 1DPSA 4CYAA 3WVUA 5JKMA 4MY7A 3O7SA 2VXXA 4DYYA 4DYUA 1RYTA 1S2ZA 5D8OA 4KVRA 2UX1A 3U90A 3FI6A 5GU2X 4CY9A 2PYBA 1QYBA 4E6KA 3NP2X 3QD8A 4LQVA 4YKHA 1HRSA 4EVCA 4CVPA 2CHPA 4II4A 2C6RA 5CMRA 3Q4QA 3MPSA 3E1PA 5JACA 5LS9A 3E1NA 3R2RA 3AK9A 1F33A 2C41A 3BVIA 1JKVA 3F33A 5J8WA 1VEQA 1RCCA 3PW1B 4CVTA 1XZ3A 3ERZA 5JKLG 4PGKA 1JGCA 1O9IA 5GOUA 2BJYA 4TOBA 2FG4A 4P18A 1VLGA 1R03A 3F37A 2CIHA 3F36A 4LPMA 1GWGA 1JI5A 4LYUA 5JKLA 2V2IA 1NF6A 3BT5A 4IWJA 4LQJA 5D8YA 5HQOA 4M33A 1JKUA 1RCGA 3PVTA 5D8QA 2X170 1IESA 1UVHA 2V2NA 3F39A 4ZLWA 4TOEA 3PVYA 5GN8A 4DZ0A 2F7NA 1JIGA 2V2OA 4AM2A 5K52A 2QQYA 3GE4A 4DI0A 4Y08A 4Z5SA 2Y3QA 2V2SA 4KVSA 4TO9A 5FFBA 3F32A 1OTKA 1SQ3A 2Z6MA 2WLAA 3T9JA 2OC5A 3A9QA 3AJPA 3IQ1A 3F34A 1B71A 2JD80 3R2OA 1RCIA 3E1OA 2WTLA 2GS4A 5C6FA 3H7GA 4PG0A 2YW6A 2C2UA 4MJYA 3RD0A 4ZL6A 3AK8A 4LPJA 4TOHA 3KA8A 3PVRA 5GU1X 5J8SA 1TJOA 1SOFA 2JD70 2ITBA 1LKOA 3O7RA 3R2MA 3Q4RA 3FSEA 2ZG9X 3ISEA 2V2PA 4ZJKA 4R42A 3KWOA 4DASA 1VELA 4M35A 2QF9A 3AF8X 3R2LA 2IB0A 2XJNA 3GHQA 3WNWA 3WVWA 1UMNA 4XGSA 1EUMA 3SIDA 4RC5A 4CMYV 4II4B 4TOCA 5AXSA 4TOAA 5FFDA 3PWFA 3A68A 1LKPA 4ZKXA 1NFVA 4EVBA 5GU0X 1BCFA 3QB9A 4M32A 1RCEA 3NP0X 2V2MA 4TODA 4RC7A 2V15A 3AF7X 4PG1A 4EVEA 2Z5RA 2D5KA 2GYDA 3BKNA 3EGMA 4CVRA 1VJXA 2CN7A 5HJFA 3Q4OA 5J93A 2XKQA 3E6RA 3PVTB 1MOJA 2JD60 3WVVA 1S30A 4U3GA 4LPNA 3E1QA 4TOFA 2WLUA 2ZA8A 4DE6A 4Z3BA 2V2JA 3R2SA 5GN8B 4TOGA 4XKSA 1ZUJA 4MN9A 2FJCA 1YUZA 1J30A 3KX9A 2FFXJ 2BKCA 2XGWA 3PZAA 3Q4NA 3UOIA 3E1LA 3ISFA 5HJHA 3KA9A 2CHIA 1LKMA 3F35A 3NOZX 1JYBA 1DVBA 2C2JA 3BVKA 1ZS3A 3UOFA 1TKPA 2V2RA 3KA6A 3PW8C 4RC6B 4RC8A 2CLUA 3SE1A 1S3QA 4EVDA 5LBHA 3PWQC 1Z6OM 3BVFA 4XKTA 3PVRB 3RAVA 3E1MA 3QHCA 1N1QA 3R2HA 4ML5A 1FHAA 5E2DA
chains in the Genus database with same CATH superfamily
3RE7A 2Z5PA 3OJ5A 3VVAA 1QGHA 4ZKWA 2V8TA 3AF9X 1RCDA 4PGIA 3OGHA 3RGDA 2HTNA 5ERKA 1IERA 5D8PA 5JDOB 2FKZA 3UFBA 3KXUA 2IY4A 4W4LB 5FFEA 1BG7A 4OYNA 2RBDA 3E2CA 5D8XA 5IX6A 1TKOA 3AJQA 5D8SA 5J9VA 2YJKA 1VEIA 3IS8A 5CZUA 4ZKHA 3M6JA 2YW7A 4A25A 1MFRA 4RC5B 1YUXA 2XJOA 3QZ3A 1L8HA 2CF7A 4AM4A 4ETRA 2G4HA 3VV9A 3E6SA 5LG8A 3KA3A 2FG8A 2OKCA 4ZTTA 2ZG8X 1Z6OA 1TK6A 1Z4AA 3IS7A 1JI4A 3F38A 3EZUA 1JTSA 4REUA 3VNXA 2FHAA 4ITTA 1JREA 1DATA 5FEJA 3AJOA 4CVSA 2ZURX 2BW1A 4E40A 2CN6A 4W4KB 3W54A 3QHBA 2C2FA 4MKUA 2G38B 4RC7B 1KRQA 2FZFA 3E1JA 3R2KA 4ITWA 3QVDA 3GVYA 2N02A 2ZA7A 3TA8A 3SH6A 3DBYA 4MUDA 3FVBA 4LQHA 4LYXA 3PW1A 2Z5QA 3SHXA 5CMQA 3ES3A 4ERUA 1H96A 2ZA6A 5D8RA 2W0OA 2GYQA 1O9RA 1AEWA 4DYZA 2V2LA 3BVEA 3PVYB 3N6OA 2Z90A 4ISPA 4CMYA 4YXJA 5FFCA 5GU3X 2YJJA 4AM5A 1NNQA 4KVQA 2WWXB 3EZ0A 2OH3A 2VZBA 4ZL5A 2VXIA 3UNOA 2BK6A 1XZ1A 1NF4A 2IU2A 4XKUA 3BVLA 5LG2A 3HIUA 3HL1A 3KA4A 2ZG7X 3RBCA 4IWKA 4CYBA 1LB3A 4LQNA 2CEIA 4IXKA 3V3KB 1L8IA 1YV1A 1F30A 4M34A 5FFAA 2CLBA 5I4JA 4ZMCA 5K53A 2FL0A 2HR5A 5JKMG 5ERJA 2XJMA 3PW8A 4TW3A 1BFRA 4ISMA 4QUWA 4RC6A 5E1UA 4DYXA 3PWQA 1DPSA 4CYAA 3WVUA 5JKMA 4MY7A 3O7SA 2VXXA 3GGYA 4DYYA 4DYUA 1RYTA 1S2ZA 5D8OA 4KVRA 3C23A 5JDOA 2UX1A 3D19A 3U90A 3FI6A 5GU2X 4CY9A 2PYBA 1QYBA 3LKDA 4E6KA 3C1ZA 3NP2X 3QD8A 4LQVA 4YKHA 1HRSA 4EVCA 4CVPA 2CHPA 4II4A 2C6RA 5CMRA 3Q4QA 3MPSA 3E1PA 5JACA 5LS9A 3E1NA 3R2RA 3AK9A 1F33A 2C41A 3BVIA 1JKVA 3F33A 5J8WA 1VEQA 1RCCA 3PW1B 4CVTA 1XZ3A 3ERZA 5JKLG 4PGKA 1JGCA 1O9IA 5GOUA 2BJYA 4TOBA 2FG4A 4P18A 1VLGA 1R03A 3F37A 2CIHA 3F36A 4LPMA 1GWGA 1JI5A 4LYUA 5JKLA 2V2IA 1NF6A 3BT5A 4IWJA 4LQJA 5D8YA 5HQOA 4M33A 3JZAB 1JKUA 4X0JA 1RCGA 3PVTA 5D8QA 2X170 1IESA 1UVHA 2V2NA 3F39A 4ZLWA 4TOEA 3PVYA 5GN8A 4DZ0A 2F7NA 1JIGA 2V2OA 4AM2A 5K52A 2QQYA 3GE4A 4DI0A 4Y08A 4Z5SA 2Y3QA 2V2SA 4KVSA 4TO9A 5FFBA 3F32A 3KDQA 1OTKA 1SQ3A 2Z6MA 2WLAA 3T9JA 2OC5A 3A9QA 3AJPA 3IQ1A 3F34A 1B71A 2JD80 3R2OA 3C1YA 3JZ9A 3L0MA 1RCIA 3E1OA 2WTLA 2GS4A 5C6FA 3H7GA 3FRSA 4PG0A 2YW6A 2C2UA 4MJYA 3RD0A 4ZL6A 3AK8A 4LPJA 4TOHA 3KA8A 3PVRA 5GU1X 5HU6D 5J8SA 1TJOA 1SOFA 2JD70 2ITBA 1LKOA 4YVZA 3O7RA 3R2MA 3Q4RA 3FSEA 2ZG9X 2Y44A 3ISEA 2V2PA 4ZJKA 4R42A 3KWOA 4DASA 1VELA 4M35A 2QF9A 3AF8X 3R2LA 2IB0A 2XJNA 4KXRB 3GHQA 3WNWA 3WVWA 1UMNA 4XGSA 1EUMA 3SIDA 4RC5A 4CMYV 4II4B 4TOCA 5AXSA 2CWLA 4TOAA 5FFDA 3PWFA 3A68A 1LKPA 4ZKXA 1NFVA 4EVBA 5GU0X 1BCFA 3QB9A 4M32A 1RCEA 3NP0X 2V2MA 4TODA 4RC7A 2V15A 3AF7X 4PG1A 4EVEA 2Z5RA 2D5KA 2GYDA 3BKNA 3GGZA 3EGMA 4CVRA 1VJXA 3FRRA 2CN7A 5HJFA 3Q4OA 5J93A 2XKQA 3E6RA 3PVTB 1MOJA 2JD60 3WVVA 1S30A 4MXPA 4U3GA 4LPNA 3E1QA 4TOFA 2WLUA 2ZA8A 4DE6A 4Z3BA 2V2JA 3R2SA 5GN8B 4TOGA 4XKSA 2V8UA 1ZUJA 3KHKA 4MN9A 2FJCA 1YUZA 2AR0A 1J30A 3KX9A 2FFXJ 2BKCA 2MGYA 4YXMA 2XGWA 3PZAA 3Q4NA 3UOIA 3E1LA 3ISFA 5HJHA 3KA9A 2CHIA 1LKMA 3F35A 3NOZX 1JYBA 1DVBA 3C21A 2C2JA 3BVKA 1ZS3A 3UOFA 1TKPA 2V2RA 3KA6A 3PW8C 4RC6B 4RC8A 2CLUA 3SE1A 1S3QA 4EVDA 5LBHA 4WJG4 3PWQC 1Z6OM 3BVFA 4XKTA 3PVRB 3RAVA 3E1MA 3QHCA 1N1QA 3R2HA 4ML5A 1FHAA 5E2DA
chains in the Genus database with same CATH topology
3RE7A 2Z5PA 3OJ5A 3VVAA 1QGHA 4ZKWA 2V8TA 3AF9X 1RCDA 4PGIA 3OGHA 3RGDA 2HTNA 5ERKA 1IERA 5D8PA 5JDOB 2FKZA 3UFBA 3KXUA 2IY4A 4W4LB 5FFEA 1BG7A 4OYNA 2RBDA 3E2CA 5D8XA 5IX6A 1TKOA 3AJQA 5D8SA 5J9VA 2YJKA 1VEIA 3IS8A 5CZUA 4ZKHA 3M6JA 2YW7A 4A25A 1MFRA 4RC5B 1YUXA 2XJOA 3QZ3A 1L8HA 2CF7A 4AM4A 4ETRA 2G4HA 3VV9A 3E6SA 5LG8A 3KA3A 2FG8A 2OKCA 4ZTTA 2ZG8X 1Z6OA 1TK6A 1Z4AA 3IS7A 1JI4A 3F38A 3EZUA 1JTSA 4REUA 3VNXA 2FHAA 4ITTA 1JREA 1DATA 5FEJA 3AJOA 4CVSA 2ZURX 2BW1A 4E40A 2CN6A 4W4KB 3W54A 3QHBA 2C2FA 4MKUA 2G38B 4RC7B 1KRQA 2FZFA 3E1JA 3R2KA 4ITWA 3QVDA 3GVYA 2N02A 2ZA7A 3TA8A 3SH6A 3DBYA 4MUDA 3FVBA 4LQHA 4LYXA 3PW1A 2Z5QA 3SHXA 5CMQA 3ES3A 4ERUA 1H96A 2ZA6A 5D8RA 2W0OA 2GYQA 1O9RA 1AEWA 4DYZA 2V2LA 3BVEA 3PVYB 3N6OA 2Z90A 4ISPA 4CMYA 4YXJA 5FFCA 5GU3X 2YJJA 4AM5A 1NNQA 4KVQA 2WWXB 3EZ0A 2OH3A 2VZBA 4ZL5A 2VXIA 3UNOA 2BK6A 1XZ1A 1NF4A 2IU2A 4XKUA 3BVLA 5LG2A 3HIUA 3HL1A 3KA4A 2ZG7X 3RBCA 4IWKA 4CYBA 1LB3A 4LQNA 2CEIA 4IXKA 3V3KB 1L8IA 1YV1A 1F30A 4M34A 5FFAA 2CLBA 5I4JA 4ZMCA 5K53A 2FL0A 2HR5A 5JKMG 5ERJA 2XJMA 3PW8A 4TW3A 1BFRA 4ISMA 4QUWA 4RC6A 5E1UA 4DYXA 3PWQA 1DPSA 4CYAA 3WVUA 5JKMA 4MY7A 3O7SA 2VXXA 3GGYA 4DYYA 4DYUA 1RYTA 1S2ZA 5D8OA 4KVRA 3C23A 5JDOA 2UX1A 3D19A 3U90A 3FI6A 5GU2X 4CY9A 2PYBA 1QYBA 3LKDA 4E6KA 3C1ZA 3NP2X 3QD8A 4LQVA 4YKHA 1HRSA 4EVCA 4CVPA 2CHPA 4II4A 2C6RA 5CMRA 3Q4QA 3MPSA 3E1PA 5JACA 5LS9A 3E1NA 3R2RA 3AK9A 1F33A 2C41A 3BVIA 1JKVA 3F33A 5J8WA 1VEQA 1RCCA 3PW1B 4CVTA 1XZ3A 3ERZA 5JKLG 4PGKA 1JGCA 1O9IA 5GOUA 2BJYA 4TOBA 2FG4A 4P18A 1VLGA 1R03A 3F37A 2CIHA 3F36A 4LPMA 1GWGA 1JI5A 4LYUA 5JKLA 2V2IA 1NF6A 3BT5A 4IWJA 4LQJA 5D8YA 5HQOA 4M33A 3JZAB 1JKUA 4X0JA 1RCGA 3PVTA 5D8QA 2X170 1IESA 1UVHA 2V2NA 3F39A 4ZLWA 4TOEA 3PVYA 5GN8A 4DZ0A 2F7NA 1JIGA 2V2OA 4AM2A 5K52A 2QQYA 3GE4A 4DI0A 4Y08A 4Z5SA 2Y3QA 2V2SA 4KVSA 4TO9A 5FFBA 3F32A 3KDQA 1OTKA 1SQ3A 2Z6MA 2WLAA 3T9JA 2OC5A 3A9QA 3AJPA 3IQ1A 3F34A 1B71A 2JD80 3R2OA 3C1YA 3JZ9A 3L0MA 1RCIA 3E1OA 2WTLA 2GS4A 5C6FA 3H7GA 3FRSA 4PG0A 2YW6A 2C2UA 4MJYA 3RD0A 4ZL6A 3AK8A 4LPJA 4TOHA 3KA8A 3PVRA 5GU1X 5HU6D 5J8SA 1TJOA 1SOFA 2JD70 2ITBA 1LKOA 4YVZA 3O7RA 3R2MA 3Q4RA 3FSEA 2ZG9X 2Y44A 3ISEA 2V2PA 4ZJKA 4R42A 3KWOA 4DASA 1VELA 4M35A 2QF9A 3AF8X 3R2LA 2IB0A 2XJNA 4KXRB 3GHQA 3WNWA 3WVWA 1UMNA 4XGSA 1EUMA 3SIDA 4RC5A 4CMYV 4II4B 4TOCA 5AXSA 2CWLA 4TOAA 5FFDA 3PWFA 3A68A 1LKPA 4ZKXA 1NFVA 4EVBA 5GU0X 1BCFA 3QB9A 4M32A 1RCEA 3NP0X 2V2MA 4TODA 4RC7A 2V15A 3AF7X 4PG1A 4EVEA 2Z5RA 2D5KA 2GYDA 3BKNA 3GGZA 3EGMA 4CVRA 1VJXA 3FRRA 2CN7A 5HJFA 3Q4OA 5J93A 2XKQA 3E6RA 3PVTB 1MOJA 2JD60 3WVVA 1S30A 4MXPA 4U3GA 4LPNA 3E1QA 4TOFA 2WLUA 2ZA8A 4DE6A 4Z3BA 2V2JA 3R2SA 5GN8B 4TOGA 4XKSA 2V8UA 1ZUJA 3KHKA 4MN9A 2FJCA 1YUZA 2AR0A 1J30A 3KX9A 2FFXJ 2BKCA 2MGYA 4YXMA 2XGWA 3PZAA 3Q4NA 3UOIA 3E1LA 3ISFA 5HJHA 3KA9A 2CHIA 1LKMA 3F35A 3NOZX 1JYBA 1DVBA 3C21A 2C2JA 3BVKA 1ZS3A 3UOFA 1TKPA 2V2RA 3KA6A 3PW8C 4RC6B 4RC8A 2CLUA 3SE1A 1S3QA 4EVDA 5LBHA 4WJG4 3PWQC 1Z6OM 3BVFA 4XKTA 3PVRB 3RAVA 3E1MA 3QHCA 1N1QA 3R2HA 4ML5A 1FHAA 5E2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RE7 A;  2Z5P A;  3OJ5 A;  1QGH A;  4ZKW A;  3AF9 X;  1RCD A;  4PGI A;  3OGH A;  3RGD A;  2HTN A;  5ERK A;  1IER A;  5D8P A;  2FKZ A;  3KXU A;  2IY4 A;  5FFE A;  1BG7 A;  4OYN A;  2RBD A;  3E2C A;  5D8X A;  5IX6 A;  1TKO A;  3AJQ A;  5D8S A;  5J9V A;  2YJK A;  1VEI A;  3IS8 A;  5CZU A;  4ZKH A;  4A25 A;  2YW7 A;  1MFR A;  4RC5 B;  1YUX A;  2XJO A;  3QZ3 A;  1L8H A;  2CF7 A;  4AM4 A;  4ETR A;  2G4H A;  3E6S A;  5LG8 A;  3KA3 A;  2FG8 A;  4ZTT A;  2ZG8 X;  1Z6O A;  1TK6 A;  1Z4A A;  3IS7 A;  1JI4 A;  3F38 A;  3EZU A;  1JTS A;  4REU A;  3VNX A;  2FHA A;  4ITT A;  1JRE A;  1DAT A;  5FEJ A;  3AJO A;  4CVS A;  2ZUR X;  2BW1 A;  2CN6 A;  3QHB A;  2C2F A;  4MKU A;  4RC7 B;  1KRQ A;  2FZF A;  3E1J A;  3R2K A;  4ITW A;  3QVD A;  3GVY A;  2ZA7 A;  3TA8 A;  3SH6 A;  4MUD A;  3FVB A;  4LQH A;  4LYX A;  3PW1 A;  2Z5Q A;  3SHX A;  5CMQ A;  3ES3 A;  4ERU A;  1H96 A;  2ZA6 A;  5D8R A;  2W0O A;  2GYQ A;  1O9R A;  1AEW A;  4DYZ A;  2V2L A;  3BVE A;  3PVY B;  4ISP A;  2Z90 A;  4CMY A;  5FFC A;  5GU3 X;  2YJJ A;  4AM5 A;  1NNQ A;  4KVQ A;  3EZ0 A;  2OH3 A;  2VZB A;  4ZL5 A;  2VXI A;  3UNO A;  2BK6 A;  1XZ1 A;  1NF4 A;  2IU2 A;  4XKU A;  3BVL A;  5LG2 A;  3HIU A;  3HL1 A;  3KA4 A;  2ZG7 X;  3RBC A;  4IWK A;  4CYB A;  1LB3 A;  4LQN A;  2CEI A;  4IXK A;  1L8I A;  1YV1 A;  1F30 A;  4M34 A;  5FFA A;  2CLB A;  5I4J A;  4ZMC A;  5K53 A;  2FL0 A;  2HR5 A;  5JKM G;  5ERJ A;  2XJM A;  3PW8 A;  4TW3 A;  1BFR A;  4ISM A;  4QUW A;  4RC6 A;  5E1U A;  4DYX A;  3PWQ A;  1DPS A;  4CYA A;  3WVU A;  5JKM A;  4MY7 A;  3O7S A;  2VXX A;  4DYY A;  4DYU A;  1RYT A;  1S2Z A;  5D8O A;  4KVR A;  2UX1 A;  3U90 A;  3FI6 A;  5GU2 X;  4CY9 A;  2PYB A;  1QYB A;  4E6K A;  3NP2 X;  3QD8 A;  4LQV A;  4YKH A;  1HRS A;  4EVC A;  4CVP A;  2CHP A;  4II4 A;  2C6R A;  5CMR A;  3Q4Q A;  3MPS A;  3E1P A;  5JAC A;  5LS9 A;  3E1N A;  3R2R A;  3AK9 A;  1F33 A;  2C41 A;  3BVI A;  1JKV A;  3F33 A;  5J8W A;  1VEQ A;  1RCC A;  3PW1 B;  4CVT A;  1XZ3 A;  3ERZ A;  5JKL G;  4PGK A;  1JGC A;  1O9I A;  5GOU A;  2BJY A;  4TOB A;  2FG4 A;  4P18 A;  1VLG A;  1R03 A;  3F37 A;  2CIH A;  3F36 A;  4LPM A;  1GWG A;  1JI5 A;  4LYU A;  5JKL A;  2V2I A;  1NF6 A;  3BT5 A;  4IWJ A;  4LQJ A;  5D8Y A;  5HQO A;  4M33 A;  1JKU A;  1RCG A;  3PVT A;  5D8Q A;  2X17 0;  1IES A;  1UVH A;  2V2N A;  3F39 A;  4ZLW A;  4TOE A;  3PVY A;  5GN8 A;  4DZ0 A;  2F7N A;  1JIG A;  2V2O A;  4AM2 A;  5K52 A;  2QQY A;  3GE4 A;  4DI0 A;  4Y08 A;  4Z5S A;  2Y3Q A;  2V2S A;  4KVS A;  4TO9 A;  5FFB A;  3F32 A;  1OTK A;  1SQ3 A;  2Z6M A;  2WLA A;  3T9J A;  2OC5 A;  3A9Q A;  3AJP A;  3IQ1 A;  3F34 A;  1B71 A;  2JD8 0;  3R2O A;  1RCI A;  3E1O A;  2WTL A;  2GS4 A;  5C6F A;  3H7G A;  4PG0 A;  2YW6 A;  2C2U A;  4MJY A;  3RD0 A;  4ZL6 A;  3AK8 A;  4LPJ A;  4TOH A;  3KA8 A;  3PVR A;  5GU1 X;  5J8S A;  1TJO A;  1SOF A;  2JD7 0;  2ITB A;  1LKO A;  3O7R A;  3R2M A;  3Q4R A;  3FSE A;  2ZG9 X;  3ISE A;  2V2P A;  4ZJK A;  4R42 A;  3KWO A;  4DAS A;  1VEL A;  4M35 A;  2QF9 A;  3AF8 X;  3R2L A;  2IB0 A;  2XJN A;  3GHQ A;  3WNW A;  3WVW A;  1UMN A;  4XGS A;  1EUM A;  3SID A;  4RC5 A;  4CMY V;  4II4 B;  4TOC A;  5AXS A;  4TOA A;  5FFD A;  3PWF A;  3A68 A;  1LKP A;  4ZKX A;  1NFV A;  4EVB A;  5GU0 X;  1BCF A;  3QB9 A;  4M32 A;  1RCE A;  3NP0 X;  2V2M A;  4TOD A;  4RC7 A;  2V15 A;  3AF7 X;  4PG1 A;  4EVE A;  2Z5R A;  2D5K A;  2GYD A;  3BKN A;  3EGM A;  4CVR A;  1VJX A;  2CN7 A;  5HJF A;  3Q4O A;  5J93 A;  2XKQ A;  3E6R A;  3PVT B;  1MOJ A;  2JD6 0;  3WVV A;  1S30 A;  4U3G A;  4LPN A;  3E1Q A;  4TOF A;  2WLU A;  2ZA8 A;  4DE6 A;  4Z3B A;  2V2J A;  3R2S A;  5GN8 B;  4TOG A;  4XKS A;  1ZUJ A;  4MN9 A;  2FJC A;  1YUZ A;  1J30 A;  3KX9 A;  2FFX J;  2BKC A;  2XGW A;  3PZA A;  3Q4N A;  3UOI A;  3E1L A;  3ISF A;  5HJH A;  3KA9 A;  2CHI A;  1LKM A;  3F35 A;  3NOZ X;  1JYB A;  1DVB A;  2C2J A;  3BVK A;  1ZS3 A;  3UOF A;  1TKP A;  2V2R A;  3KA6 A;  3PW8 C;  4RC6 B;  4RC8 A;  2CLU A;  3SE1 A;  1S3Q A;  4EVD A;  5LBH A;  3PWQ C;  1Z6O M;  3BVF A;  4XKT A;  3PVR B;  3RAV A;  3E1M A;  3QHC A;  1N1Q A;  3R2H A;  4ML5 A;  1FHA A;  5E2D A; 
#chains in the Genus database with same CATH topology
 3RE7 A;  2Z5P A;  3OJ5 A;  3VVA A;  1QGH A;  4ZKW A;  2V8T A;  3AF9 X;  1RCD A;  4PGI A;  3OGH A;  3RGD A;  2HTN A;  5ERK A;  1IER A;  5D8P A;  5JDO B;  2FKZ A;  3UFB A;  3KXU A;  2IY4 A;  4W4L B;  5FFE A;  1BG7 A;  4OYN A;  2RBD A;  3E2C A;  5D8X A;  5IX6 A;  1TKO A;  3AJQ A;  5D8S A;  5J9V A;  2YJK A;  1VEI A;  3IS8 A;  5CZU A;  4ZKH A;  3M6J A;  2YW7 A;  4A25 A;  1MFR A;  4RC5 B;  1YUX A;  2XJO A;  3QZ3 A;  1L8H A;  2CF7 A;  4AM4 A;  4ETR A;  2G4H A;  3VV9 A;  3E6S A;  5LG8 A;  3KA3 A;  2FG8 A;  2OKC A;  4ZTT A;  2ZG8 X;  1Z6O A;  1TK6 A;  1Z4A A;  3IS7 A;  1JI4 A;  3F38 A;  3EZU A;  1JTS A;  4REU A;  3VNX A;  2FHA A;  4ITT A;  1JRE A;  1DAT A;  5FEJ A;  3AJO A;  4CVS A;  2ZUR X;  2BW1 A;  4E40 A;  2CN6 A;  4W4K B;  3W54 A;  3QHB A;  2C2F A;  4MKU A;  2G38 B;  4RC7 B;  1KRQ A;  2FZF A;  3E1J A;  3R2K A;  4ITW A;  3QVD A;  3GVY A;  2N02 A;  2ZA7 A;  3TA8 A;  3SH6 A;  3DBY A;  4MUD A;  3FVB A;  4LQH A;  4LYX A;  3PW1 A;  2Z5Q A;  3SHX A;  5CMQ A;  3ES3 A;  4ERU A;  1H96 A;  2ZA6 A;  5D8R A;  2W0O A;  2GYQ A;  1O9R A;  1AEW A;  4DYZ A;  2V2L A;  3BVE A;  3PVY B;  3N6O A;  2Z90 A;  4ISP A;  4CMY A;  4YXJ A;  5FFC A;  5GU3 X;  2YJJ A;  4AM5 A;  1NNQ A;  4KVQ A;  2WWX B;  3EZ0 A;  2OH3 A;  2VZB A;  4ZL5 A;  2VXI A;  3UNO A;  2BK6 A;  1XZ1 A;  1NF4 A;  2IU2 A;  4XKU A;  3BVL A;  5LG2 A;  3HIU A;  3HL1 A;  3KA4 A;  2ZG7 X;  3RBC A;  4IWK A;  4CYB A;  1LB3 A;  4LQN A;  2CEI A;  4IXK A;  3V3K B;  1L8I A;  1YV1 A;  1F30 A;  4M34 A;  5FFA A;  2CLB A;  5I4J A;  4ZMC A;  5K53 A;  2FL0 A;  2HR5 A;  5JKM G;  5ERJ A;  2XJM A;  3PW8 A;  4TW3 A;  1BFR A;  4ISM A;  4QUW A;  4RC6 A;  5E1U A;  4DYX A;  3PWQ A;  1DPS A;  4CYA A;  3WVU A;  5JKM A;  4MY7 A;  3O7S A;  2VXX A;  3GGY A;  4DYY A;  4DYU A;  1RYT A;  1S2Z A;  5D8O A;  4KVR A;  3C23 A;  5JDO A;  2UX1 A;  3D19 A;  3U90 A;  3FI6 A;  5GU2 X;  4CY9 A;  2PYB A;  1QYB A;  3LKD A;  4E6K A;  3C1Z A;  3NP2 X;  3QD8 A;  4LQV A;  4YKH A;  1HRS A;  4EVC A;  4CVP A;  2CHP A;  4II4 A;  2C6R A;  5CMR A;  3Q4Q A;  3MPS A;  3E1P A;  5JAC A;  5LS9 A;  3E1N A;  3R2R A;  3AK9 A;  1F33 A;  2C41 A;  3BVI A;  1JKV A;  3F33 A;  5J8W A;  1VEQ A;  1RCC A;  3PW1 B;  4CVT A;  1XZ3 A;  3ERZ A;  5JKL G;  4PGK A;  1JGC A;  1O9I A;  5GOU A;  2BJY A;  4TOB A;  2FG4 A;  4P18 A;  1VLG A;  1R03 A;  3F37 A;  2CIH A;  3F36 A;  4LPM A;  1GWG A;  1JI5 A;  4LYU A;  5JKL A;  2V2I A;  1NF6 A;  3BT5 A;  4IWJ A;  4LQJ A;  5D8Y A;  5HQO A;  4M33 A;  3JZA B;  1JKU A;  4X0J A;  1RCG A;  3PVT A;  5D8Q A;  2X17 0;  1IES A;  1UVH A;  2V2N A;  3F39 A;  4ZLW A;  4TOE A;  3PVY A;  5GN8 A;  4DZ0 A;  2F7N A;  1JIG A;  2V2O A;  4AM2 A;  5K52 A;  2QQY A;  3GE4 A;  4DI0 A;  4Y08 A;  4Z5S A;  2Y3Q A;  2V2S A;  4KVS A;  4TO9 A;  5FFB A;  3F32 A;  3KDQ A;  1OTK A;  1SQ3 A;  2Z6M A;  2WLA A;  3T9J A;  2OC5 A;  3A9Q A;  3AJP A;  3IQ1 A;  3F34 A;  1B71 A;  2JD8 0;  3R2O A;  3C1Y A;  3JZ9 A;  3L0M A;  1RCI A;  3E1O A;  2WTL A;  2GS4 A;  5C6F A;  3H7G A;  3FRS A;  4PG0 A;  2YW6 A;  2C2U A;  4MJY A;  3RD0 A;  4ZL6 A;  3AK8 A;  4LPJ A;  4TOH A;  3KA8 A;  3PVR A;  5GU1 X;  5HU6 D;  5J8S A;  1TJO A;  1SOF A;  2JD7 0;  2ITB A;  1LKO A;  4YVZ A;  3O7R A;  3R2M A;  3Q4R A;  3FSE A;  2ZG9 X;  2Y44 A;  3ISE A;  2V2P A;  4ZJK A;  4R42 A;  3KWO A;  4DAS A;  1VEL A;  4M35 A;  2QF9 A;  3AF8 X;  3R2L A;  2IB0 A;  2XJN A;  4KXR B;  3GHQ A;  3WNW A;  3WVW A;  1UMN A;  4XGS A;  1EUM A;  3SID A;  4RC5 A;  4CMY V;  4II4 B;  4TOC A;  5AXS A;  2CWL A;  4TOA A;  5FFD A;  3PWF A;  3A68 A;  1LKP A;  4ZKX A;  1NFV A;  4EVB A;  5GU0 X;  1BCF A;  3QB9 A;  4M32 A;  1RCE A;  3NP0 X;  2V2M A;  4TOD A;  4RC7 A;  2V15 A;  3AF7 X;  4PG1 A;  4EVE A;  2Z5R A;  2D5K A;  2GYD A;  3BKN A;  3GGZ A;  3EGM A;  4CVR A;  1VJX A;  3FRR A;  2CN7 A;  5HJF A;  3Q4O A;  5J93 A;  2XKQ A;  3E6R A;  3PVT B;  1MOJ A;  2JD6 0;  3WVV A;  1S30 A;  4MXP A;  4U3G A;  4LPN A;  3E1Q A;  4TOF A;  2WLU A;  2ZA8 A;  4DE6 A;  4Z3B A;  2V2J A;  3R2S A;  5GN8 B;  4TOG A;  4XKS A;  2V8U A;  1ZUJ A;  3KHK A;  4MN9 A;  2FJC A;  1YUZ A;  2AR0 A;  1J30 A;  3KX9 A;  2FFX J;  2BKC A;  2MGY A;  4YXM A;  2XGW A;  3PZA A;  3Q4N A;  3UOI A;  3E1L A;  3ISF A;  5HJH A;  3KA9 A;  2CHI A;  1LKM A;  3F35 A;  3NOZ X;  1JYB A;  1DVB A;  3C21 A;  2C2J A;  3BVK A;  1ZS3 A;  3UOF A;  1TKP A;  2V2R A;  3KA6 A;  3PW8 C;  4RC6 B;  4RC8 A;  2CLU A;  3SE1 A;  1S3Q A;  4EVD A;  5LBH A;  4WJG 4;  3PWQ C;  1Z6O M;  3BVF A;  4XKT A;  3PVR B;  3RAV A;  3E1M A;  3QHC A;  1N1Q A;  3R2H A;  4ML5 A;  1FHA A;  5E2D A; 
#chains in the Genus database with same CATH homology
 3RE7 A;  2Z5P A;  3OJ5 A;  3VVA A;  1QGH A;  4ZKW A;  2V8T A;  3AF9 X;  1RCD A;  4PGI A;  3OGH A;  3RGD A;  2HTN A;  5ERK A;  1IER A;  5D8P A;  5JDO B;  2FKZ A;  3UFB A;  3KXU A;  2IY4 A;  4W4L B;  5FFE A;  1BG7 A;  4OYN A;  2RBD A;  3E2C A;  5D8X A;  5IX6 A;  1TKO A;  3AJQ A;  5D8S A;  5J9V A;  2YJK A;  1VEI A;  3IS8 A;  5CZU A;  4ZKH A;  3M6J A;  2YW7 A;  4A25 A;  1MFR A;  4RC5 B;  1YUX A;  2XJO A;  3QZ3 A;  1L8H A;  2CF7 A;  4AM4 A;  4ETR A;  2G4H A;  3VV9 A;  3E6S A;  5LG8 A;  3KA3 A;  2FG8 A;  2OKC A;  4ZTT A;  2ZG8 X;  1Z6O A;  1TK6 A;  1Z4A A;  3IS7 A;  1JI4 A;  3F38 A;  3EZU A;  1JTS A;  4REU A;  3VNX A;  2FHA A;  4ITT A;  1JRE A;  1DAT A;  5FEJ A;  3AJO A;  4CVS A;  2ZUR X;  2BW1 A;  4E40 A;  2CN6 A;  4W4K B;  3W54 A;  3QHB A;  2C2F A;  4MKU A;  2G38 B;  4RC7 B;  1KRQ A;  2FZF A;  3E1J A;  3R2K A;  4ITW A;  3QVD A;  3GVY A;  2N02 A;  2ZA7 A;  3TA8 A;  3SH6 A;  3DBY A;  4MUD A;  3FVB A;  4LQH A;  4LYX A;  3PW1 A;  2Z5Q A;  3SHX A;  5CMQ A;  3ES3 A;  4ERU A;  1H96 A;  2ZA6 A;  5D8R A;  2W0O A;  2GYQ A;  1O9R A;  1AEW A;  4DYZ A;  2V2L A;  3BVE A;  3PVY B;  3N6O A;  2Z90 A;  4ISP A;  4CMY A;  4YXJ A;  5FFC A;  5GU3 X;  2YJJ A;  4AM5 A;  1NNQ A;  4KVQ A;  2WWX B;  3EZ0 A;  2OH3 A;  2VZB A;  4ZL5 A;  2VXI A;  3UNO A;  2BK6 A;  1XZ1 A;  1NF4 A;  2IU2 A;  4XKU A;  3BVL A;  5LG2 A;  3HIU A;  3HL1 A;  3KA4 A;  2ZG7 X;  3RBC A;  4IWK A;  4CYB A;  1LB3 A;  4LQN A;  2CEI A;  4IXK A;  3V3K B;  1L8I A;  1YV1 A;  1F30 A;  4M34 A;  5FFA A;  2CLB A;  5I4J A;  4ZMC A;  5K53 A;  2FL0 A;  2HR5 A;  5JKM G;  5ERJ A;  2XJM A;  3PW8 A;  4TW3 A;  1BFR A;  4ISM A;  4QUW A;  4RC6 A;  5E1U A;  4DYX A;  3PWQ A;  1DPS A;  4CYA A;  3WVU A;  5JKM A;  4MY7 A;  3O7S A;  2VXX A;  3GGY A;  4DYY A;  4DYU A;  1RYT A;  1S2Z A;  5D8O A;  4KVR A;  3C23 A;  5JDO A;  2UX1 A;  3D19 A;  3U90 A;  3FI6 A;  5GU2 X;  4CY9 A;  2PYB A;  1QYB A;  3LKD A;  4E6K A;  3C1Z A;  3NP2 X;  3QD8 A;  4LQV A;  4YKH A;  1HRS A;  4EVC A;  4CVP A;  2CHP A;  4II4 A;  2C6R A;  5CMR A;  3Q4Q A;  3MPS A;  3E1P A;  5JAC A;  5LS9 A;  3E1N A;  3R2R A;  3AK9 A;  1F33 A;  2C41 A;  3BVI A;  1JKV A;  3F33 A;  5J8W A;  1VEQ A;  1RCC A;  3PW1 B;  4CVT A;  1XZ3 A;  3ERZ A;  5JKL G;  4PGK A;  1JGC A;  1O9I A;  5GOU A;  2BJY A;  4TOB A;  2FG4 A;  4P18 A;  1VLG A;  1R03 A;  3F37 A;  2CIH A;  3F36 A;  4LPM A;  1GWG A;  1JI5 A;  4LYU A;  5JKL A;  2V2I A;  1NF6 A;  3BT5 A;  4IWJ A;  4LQJ A;  5D8Y A;  5HQO A;  4M33 A;  3JZA B;  1JKU A;  4X0J A;  1RCG A;  3PVT A;  5D8Q A;  2X17 0;  1IES A;  1UVH A;  2V2N A;  3F39 A;  4ZLW A;  4TOE A;  3PVY A;  5GN8 A;  4DZ0 A;  2F7N A;  1JIG A;  2V2O A;  4AM2 A;  5K52 A;  2QQY A;  3GE4 A;  4DI0 A;  4Y08 A;  4Z5S A;  2Y3Q A;  2V2S A;  4KVS A;  4TO9 A;  5FFB A;  3F32 A;  3KDQ A;  1OTK A;  1SQ3 A;  2Z6M A;  2WLA A;  3T9J A;  2OC5 A;  3A9Q A;  3AJP A;  3IQ1 A;  3F34 A;  1B71 A;  2JD8 0;  3R2O A;  3C1Y A;  3JZ9 A;  3L0M A;  1RCI A;  3E1O A;  2WTL A;  2GS4 A;  5C6F A;  3H7G A;  3FRS A;  4PG0 A;  2YW6 A;  2C2U A;  4MJY A;  3RD0 A;  4ZL6 A;  3AK8 A;  4LPJ A;  4TOH A;  3KA8 A;  3PVR A;  5GU1 X;  5HU6 D;  5J8S A;  1TJO A;  1SOF A;  2JD7 0;  2ITB A;  1LKO A;  4YVZ A;  3O7R A;  3R2M A;  3Q4R A;  3FSE A;  2ZG9 X;  2Y44 A;  3ISE A;  2V2P A;  4ZJK A;  4R42 A;  3KWO A;  4DAS A;  1VEL A;  4M35 A;  2QF9 A;  3AF8 X;  3R2L A;  2IB0 A;  2XJN A;  4KXR B;  3GHQ A;  3WNW A;  3WVW A;  1UMN A;  4XGS A;  1EUM A;  3SID A;  4RC5 A;  4CMY V;  4II4 B;  4TOC A;  5AXS A;  2CWL A;  4TOA A;  5FFD A;  3PWF A;  3A68 A;  1LKP A;  4ZKX A;  1NFV A;  4EVB A;  5GU0 X;  1BCF A;  3QB9 A;  4M32 A;  1RCE A;  3NP0 X;  2V2M A;  4TOD A;  4RC7 A;  2V15 A;  3AF7 X;  4PG1 A;  4EVE A;  2Z5R A;  2D5K A;  2GYD A;  3BKN A;  3GGZ A;  3EGM A;  4CVR A;  1VJX A;  3FRR A;  2CN7 A;  5HJF A;  3Q4O A;  5J93 A;  2XKQ A;  3E6R A;  3PVT B;  1MOJ A;  2JD6 0;  3WVV A;  1S30 A;  4MXP A;  4U3G A;  4LPN A;  3E1Q A;  4TOF A;  2WLU A;  2ZA8 A;  4DE6 A;  4Z3B A;  2V2J A;  3R2S A;  5GN8 B;  4TOG A;  4XKS A;  2V8U A;  1ZUJ A;  3KHK A;  4MN9 A;  2FJC A;  1YUZ A;  2AR0 A;  1J30 A;  3KX9 A;  2FFX J;  2BKC A;  2MGY A;  4YXM A;  2XGW A;  3PZA A;  3Q4N A;  3UOI A;  3E1L A;  3ISF A;  5HJH A;  3KA9 A;  2CHI A;  1LKM A;  3F35 A;  3NOZ X;  1JYB A;  1DVB A;  3C21 A;  2C2J A;  3BVK A;  1ZS3 A;  3UOF A;  1TKP A;  2V2R A;  3KA6 A;  3PW8 C;  4RC6 B;  4RC8 A;  2CLU A;  3SE1 A;  1S3Q A;  4EVD A;  5LBH A;  4WJG 4;  3PWQ C;  1Z6O M;  3BVF A;  4XKT A;  3PVR B;  3RAV A;  3E1M A;  3QHC A;  1N1Q A;  3R2H A;  4ML5 A;  1FHA A;  5E2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...