1EUMA

Crystal structure of the e.coli ferritin ecftna
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
161
structure length
161
Chain Sequence
LKPEMIEKLNEQMNLELYSSLLYQQMSAWCSYHTFEGAAAFLRRHAQEEMTHMQRLFDYLTDTGNLPRINTVESPFAEYSSLDELFQETYKHEQLITQKINELAHAAMTNQDYPTFNFLQWYVSEQHEEEKLFKSIIDKLSLAGKSGEGLYFIDKELSTLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords FERRITIN 1
publication title The high-resolution X-ray crystallographic structure of the ferritin (EcFtnA) of Escherichia coli; comparison with human H ferritin (HuHF) and the structures of the Fe(3+) and Zn(2+) derivatives.
pubmed doi rcsb
source organism Escherichia coli
total genus 79
structure length 161
sequence length 161
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2000-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1eumA00
4TOAA 3BVFA 4ETRA 4XGSA 1JKVA 5K53A 2V2LA 3FI6A 4E6KA 3UOFA 1JREA 1TK6A 3KA9A 4DI0A 4LPNA 1BG7A 1RCIA 1NFVA 4ZKHA 2FZFA 3QB9A 1R03A 2YW7A 2JD70 2VXIA 1KRQA 4AM2A 3ISFA 3NP2X 4QUWA 2CF7A 3A9QA 3E1NA 3PVRA 4ZTTA 4R42A 5C6FA 5GN8B 2CHIA 5HQOA 3A68A 4MN9A 2FKZA 4II4A 2JD80 2JD60 4RC5A 1RCCA 3KXUA 3RD0A 1SOFA 2OC5A 3Q4RA 2FG4A 4CVTA 2V2RA 3PWFA 2UX1A 4DE6A 5HJHA 4AM4A 5JKMG 2XJOA 3PVTB 1IERA 2CHPA 3F39A 3QHCA 1XZ1A 2ZURX 3OGHA 5K52A 1RYTA 3BVLA 2CEIA 3PW1A 1NF4A 1JI5A 1QYBA 4TOFA 4DYUA 3R2LA 4LQHA 3EZUA 4LPJA 2FL0A 2WLAA 2V2SA 1MOJA 4PG1A 4LQJA 3KA8A 4ZLWA 2VZBA 5D8PA 2Z5QA 3EGMA 2V2MA 2VXXA 3AF9X 4MUDA 4MKUA 4M33A 3E6RA 4IWKA 3O7RA 2GS4A 4LYXA 2G4HA 4IWJA 2ZA7A 4LQNA 1S3QA 2ZG9X 4CVRA 2ZA8A 4U3GA 1F30A 1N1QA 3R2RA 4DZ0A 2C2JA 5LBHA 2W0OA 2V2PA 3R2KA 4ERUA 4TO9A 5D8OA 4EVBA 3BVEA 1Z4AA 3IQ1A 1VJXA 3BT5A 3UNOA 3WVUA 4RC7B 3R2OA 5GU2X 3AF7X 3WVVA 1MFRA 3Q4OA 2BJYA 1H96A 2Y3QA 3E1QA 3F36A 4LPMA 2IY4A 4ISMA 1AEWA 3BVKA 1JTSA 3KA3A 2YW6A 2CN7A 3PVRB 3MPSA 1GWGA 5FFDA 1VLGA 4PGIA 5JKLA 3ISEA 4MJYA 4II4B 1JGCA 4RC5B 2GYDA 5AXSA 3T9JA 3IS8A 1RCEA 3PZAA 4TW3A 2WTLA 4ISPA 1B71A 3RAVA 2XJMA 3E1LA 1XZ3A 2ZA6A 5E1UA 1JKUA 1JI4A 4TODA 5D8YA 5CMQA 3QVDA 1LKMA 4CVPA 4YKHA 3F37A 4ITWA 3KX9A 3Q4QA 3KA4A 3PW1B 4Z3BA 4PG0A 4LQVA 3ES3A 4CVSA 3SE1A 2CIHA 4ZMCA 3Q4NA 3F38A 4A25A 2ZG7X 4TOBA 3RBCA 5LG8A 3GE4A 1LB3A 1J30A 3R2MA 4ZL6A 1VEQA 1S30A 4DYYA 3F34A 2Z90A 1YV1A 2CLBA 2F7NA 2BK6A 5J8WA 4TOEA 3VNXA 2HR5A 4ZL5A 3BVIA 3NOZX 4KVRA 5ERKA 3RE7A 1SQ3A 3F35A 4ZJKA 3ERZA 3SIDA 2V2NA 3GHQA 3KA6A 5E2DA 4RC6A 5JKLG 3NP0X 1QGHA 5CZUA 1OTKA 2WLUA 3PWQA 3PVYA 5GU0X 5FFEA 2C6RA 3AK9A 2V15A 4EVDA 3AJQA 3EZ0A 2RBDA 1LKPA 3AK8A 4KVSA 1RCDA 2C41A 1VELA 2V2OA 1FHAA 1EUMA 4LYUA 3E1MA 1DPSA 2FJCA 4Y08A 4CMYV 1JYBA 5J9VA 4REUA 2GYQA 4IXKA 3WVWA 1HRSA 5LG2A 1BFRA 1TJOA 2XKQA 1O9RA 2C2UA 3PWQC 2FFXJ 3E2CA 3TA8A 3PW8A 3QHBA 3FVBA 3R2HA 1O9IA 2QQYA 4AM5A 4RC8A 5GU3X 3F32A 1TKOA 5FFAA 4CYBA 3WNWA 4RC7A 3IS7A 1F33A 4TOGA 4DASA 5I4JA 5FEJA 4PGKA 3SH6A 3R2SA 4CMYA 3GVYA 2BKCA 4OYNA 3OJ5A 3FSEA 2BW1A 4Z5SA 3SHXA 1L8IA 5HJFA 3E6SA 1Z6OA 2C2FA 3PW8C 1LKOA 5D8SA 1ZS3A 5J93A 1RCGA 1L8HA 2ZG8X 2V2IA 4ZKXA 4DYXA 4ITTA 2CN6A 2Z5RA 1YUZA 2YJKA 2XJNA 2IB0A 4ML5A 2FHAA 2YJJA 1JIGA 4CY9A 4MY7A 1YUXA 3U90A 4CYAA 2QF9A 2OH3A 5GN8A 5FFCA 4XKUA 1BCFA 1TKPA 3AF8X 2FG8A 4XKSA 3UOIA 5J8SA 4RC6B 1DATA 4M35A 5GOUA 3KWOA 1S2ZA 3HIUA 2HTNA 1NNQA 5FFBA 3PVYB 5ERJA 3O7SA 3HL1A 3PVTA 3BKNA 2XGWA 5GU1X 3RGDA 2Z5PA 3E1JA 3H7GA 2Z6MA 5IX6A 4P18A 2V2JA 5D8QA 4M32A 4TOCA 1IESA 1Z6OM 1ZUJA 4KVQA 4TOHA 5LS9A 2D5KA 1VEIA 2X170 2IU2A 5JACA 3QZ3A 4DYZA 2PYBA 4XKTA 3AJPA 4EVEA 1UMNA 3F33A 5D8RA 5D8XA 5CMRA 1NF6A 2ITBA 3E1PA 5JKMA 1DVBA 3AJOA 3QD8A 4EVCA 3E1OA 2CLUA 4ZKWA 4M34A 1UVHA
chains in the Genus database with same CATH superfamily
4TOAA 3N6OA 3BVFA 4ETRA 4XGSA 2V8UA 1JKVA 5K53A 2V2LA 3FI6A 4E6KA 2CWLA 3UOFA 1JREA 1TK6A 3KA9A 4DI0A 4LPNA 1BG7A 1RCIA 1NFVA 4ZKHA 2FZFA 3QB9A 1R03A 2YW7A 2JD70 2VXIA 1KRQA 4AM2A 3ISFA 3NP2X 4QUWA 2CF7A 3A9QA 3E1NA 3PVRA 4ZTTA 2WWXB 4R42A 4WJG4 5C6FA 5GN8B 2CHIA 5HQOA 3A68A 4MN9A 2FKZA 4II4A 2JD80 2JD60 4RC5A 1RCCA 3L0MA 3KXUA 3RD0A 1SOFA 2OC5A 3Q4RA 2FG4A 4CVTA 2V2RA 3PWFA 3FRSA 2UX1A 4DE6A 5HJHA 4AM4A 5JKMG 2XJOA 3PVTB 1IERA 2CHPA 3F39A 3KHKA 3QHCA 1XZ1A 2ZURX 3OGHA 5K52A 1RYTA 3BVLA 2CEIA 3PW1A 1NF4A 1JI5A 1QYBA 4TOFA 4DYUA 3R2LA 4LQHA 3JZ9A 3EZUA 2FL0A 2WLAA 4LPJA 2V2SA 1MOJA 4PG1A 3C1ZA 4LQJA 3KA8A 4ZLWA 2VZBA 5D8PA 2Z5QA 3EGMA 2V2MA 2VXXA 3AF9X 4MUDA 2AR0A 4MKUA 5JDOB 4YVZA 4M33A 3E6RA 4IWKA 3O7RA 2GS4A 4LYXA 2G4HA 4IWJA 2ZA7A 4LQNA 1S3QA 2ZG9X 2MGYA 4CVRA 2ZA8A 4U3GA 1F30A 1N1QA 3R2RA 4DZ0A 2C2JA 5LBHA 2W0OA 3LKDA 2V2PA 4X0JA 3R2KA 4ERUA 4TO9A 5D8OA 4EVBA 3BVEA 1Z4AA 3IQ1A 1VJXA 3BT5A 3UNOA 3WVUA 4RC7B 3R2OA 5GU2X 3AF7X 3WVVA 3GGYA 1MFRA 3Q4OA 4KXRB 2BJYA 3VVAA 1H96A 2N02A 2Y3QA 3E1QA 3F36A 4LPMA 2IY4A 3JZAB 4ISMA 1AEWA 3BVKA 1JTSA 3KA3A 2YW6A 2CN7A 3PVRB 3FRRA 3MPSA 1GWGA 5FFDA 1VLGA 4PGIA 4E40A 5JKLA 3ISEA 4W4KB 4MJYA 4II4B 1JGCA 4RC5B 3GGZA 5HU6D 2GYDA 5AXSA 3T9JA 3IS8A 1RCEA 3PZAA 4TW3A 2WTLA 4ISPA 1B71A 3RAVA 2XJMA 4YXMA 3W54A 3E1LA 1XZ3A 2ZA6A 5E1UA 1JKUA 1JI4A 4TODA 5D8YA 5CMQA 3QVDA 1LKMA 4CVPA 4YKHA 3F37A 4ITWA 3KX9A 3Q4QA 3KA4A 3PW1B 4Z3BA 4PG0A 4LQVA 3ES3A 3C23A 4CVSA 3DBYA 3SE1A 2CIHA 4ZMCA 3Q4NA 3F38A 4A25A 2ZG7X 4TOBA 3RBCA 5LG8A 3GE4A 1LB3A 1J30A 3R2MA 4ZL6A 1VEQA 1S30A 2V8TA 4DYYA 3F34A 2Z90A 1YV1A 2CLBA 2F7NA 2BK6A 5J8WA 4TOEA 3VNXA 2HR5A 4ZL5A 3BVIA 3NOZX 4KVRA 5ERKA 3RE7A 1SQ3A 3F35A 4ZJKA 3ERZA 3SIDA 2V2NA 3GHQA 3KA6A 5E2DA 4RC6A 5JKLG 3NP0X 1QGHA 5CZUA 1OTKA 2WLUA 3PWQA 3PVYA 5GU0X 5FFEA 2C6RA 3AK9A 2V15A 4EVDA 3AJQA 3EZ0A 2RBDA 3VV9A 1LKPA 3AK8A 4KVSA 2G38B 1RCDA 2C41A 1VELA 2V2OA 1FHAA 1EUMA 4LYUA 3E1MA 1DPSA 2FJCA 4Y08A 4CMYV 1JYBA 5J9VA 4REUA 4W4LB 2GYQA 4IXKA 3M6JA 3WVWA 1HRSA 5LG2A 1BFRA 1TJOA 2XKQA 1O9RA 2C2UA 3PWQC 2FFXJ 3E2CA 3TA8A 3PW8A 3QHBA 3FVBA 3R2HA 1O9IA 2QQYA 4AM5A 3C21A 4RC8A 5GU3X 3F32A 1TKOA 5FFAA 4CYBA 3WNWA 4RC7A 3IS7A 1F33A 4TOGA 4DASA 5I4JA 5FEJA 4PGKA 3SH6A 3R2SA 4CMYA 3GVYA 2BKCA 4OYNA 3OJ5A 3FSEA 2BW1A 4Z5SA 3SHXA 1L8IA 5HJFA 3E6SA 1Z6OA 2C2FA 3PW8C 1LKOA 3KDQA 5D8SA 3D19A 1ZS3A 5J93A 1RCGA 1L8HA 2ZG8X 2V2IA 4ZKXA 4DYXA 4ITTA 2Y44A 2CN6A 2Z5RA 1YUZA 2YJKA 2XJNA 2IB0A 2FHAA 2YJJA 4ML5A 1JIGA 4CY9A 4MY7A 1YUXA 3U90A 4CYAA 2QF9A 2OH3A 5GN8A 5FFCA 4XKUA 1BCFA 1TKPA 3AF8X 2FG8A 4XKSA 3UOIA 3V3KB 4YXJA 5J8SA 4RC6B 1DATA 4M35A 5GOUA 3KWOA 1S2ZA 3HIUA 2HTNA 1NNQA 5FFBA 3PVYB 5ERJA 3O7SA 3HL1A 3PVTA 3BKNA 3UFBA 2XGWA 5GU1X 3RGDA 2Z5PA 3E1JA 3H7GA 2Z6MA 5IX6A 4P18A 2V2JA 5D8QA 4M32A 4MXPA 4TOCA 1IESA 1Z6OM 1ZUJA 4KVQA 4TOHA 5LS9A 2D5KA 1VEIA 2X170 2IU2A 5JACA 3QZ3A 4DYZA 2PYBA 5JDOA 2OKCA 4XKTA 3AJPA 4EVEA 1UMNA 3F33A 3C1YA 5D8RA 5D8XA 5CMRA 1NF6A 2ITBA 3E1PA 5JKMA 1DVBA 3AJOA 3QD8A 4EVCA 3E1OA 2CLUA 4ZKWA 4M34A 1UVHA
chains in the Genus database with same CATH topology
4TOAA 3N6OA 3BVFA 4ETRA 4XGSA 2V8UA 1JKVA 5K53A 2V2LA 3FI6A 4E6KA 2CWLA 3UOFA 1JREA 1TK6A 3KA9A 4DI0A 4LPNA 1BG7A 1RCIA 1NFVA 4ZKHA 2FZFA 3QB9A 1R03A 2YW7A 2JD70 2VXIA 1KRQA 4AM2A 3ISFA 3NP2X 4QUWA 2CF7A 3A9QA 3E1NA 3PVRA 4ZTTA 2WWXB 4R42A 4WJG4 5C6FA 5GN8B 2CHIA 5HQOA 3A68A 4MN9A 2FKZA 4II4A 2JD80 2JD60 4RC5A 1RCCA 3L0MA 3KXUA 3RD0A 1SOFA 2OC5A 3Q4RA 2FG4A 4CVTA 2V2RA 3PWFA 3FRSA 2UX1A 4DE6A 5HJHA 4AM4A 5JKMG 2XJOA 3PVTB 1IERA 2CHPA 3F39A 3KHKA 3QHCA 1XZ1A 2ZURX 3OGHA 5K52A 1RYTA 3BVLA 2CEIA 3PW1A 1NF4A 1JI5A 1QYBA 4TOFA 4DYUA 3R2LA 4LQHA 3JZ9A 3EZUA 2FL0A 2WLAA 4LPJA 2V2SA 1MOJA 4PG1A 3C1ZA 4LQJA 3KA8A 4ZLWA 2VZBA 5D8PA 2Z5QA 3EGMA 2V2MA 2VXXA 3AF9X 4MUDA 2AR0A 4MKUA 5JDOB 4YVZA 4M33A 3E6RA 4IWKA 3O7RA 2GS4A 4LYXA 2G4HA 4IWJA 2ZA7A 4LQNA 1S3QA 2ZG9X 2MGYA 4CVRA 2ZA8A 4U3GA 1F30A 1N1QA 3R2RA 4DZ0A 2C2JA 5LBHA 2W0OA 3LKDA 2V2PA 4X0JA 3R2KA 4ERUA 4TO9A 5D8OA 4EVBA 3BVEA 1Z4AA 3IQ1A 1VJXA 3BT5A 3UNOA 3WVUA 4RC7B 3R2OA 5GU2X 3AF7X 3WVVA 3GGYA 1MFRA 3Q4OA 4KXRB 2BJYA 3VVAA 1H96A 2N02A 2Y3QA 3E1QA 3F36A 4LPMA 2IY4A 3JZAB 4ISMA 1AEWA 3BVKA 1JTSA 3KA3A 2YW6A 2CN7A 3PVRB 3FRRA 3MPSA 1GWGA 5FFDA 1VLGA 4PGIA 4E40A 5JKLA 3ISEA 4W4KB 4MJYA 4II4B 1JGCA 4RC5B 3GGZA 5HU6D 2GYDA 5AXSA 3T9JA 3IS8A 1RCEA 3PZAA 4TW3A 2WTLA 4ISPA 1B71A 3RAVA 2XJMA 4YXMA 3W54A 3E1LA 1XZ3A 2ZA6A 5E1UA 1JKUA 1JI4A 4TODA 5D8YA 5CMQA 3QVDA 1LKMA 4CVPA 4YKHA 3F37A 4ITWA 3KX9A 3Q4QA 3KA4A 3PW1B 4Z3BA 4PG0A 4LQVA 3ES3A 3C23A 4CVSA 3DBYA 3SE1A 2CIHA 4ZMCA 3Q4NA 3F38A 4A25A 2ZG7X 4TOBA 3RBCA 5LG8A 3GE4A 1LB3A 1J30A 3R2MA 4ZL6A 1VEQA 1S30A 2V8TA 4DYYA 3F34A 2Z90A 1YV1A 2CLBA 2F7NA 2BK6A 5J8WA 4TOEA 3VNXA 2HR5A 4ZL5A 3BVIA 3NOZX 4KVRA 5ERKA 3RE7A 1SQ3A 3F35A 4ZJKA 3ERZA 3SIDA 2V2NA 3GHQA 3KA6A 5E2DA 4RC6A 5JKLG 3NP0X 1QGHA 5CZUA 1OTKA 2WLUA 3PWQA 3PVYA 5GU0X 5FFEA 2C6RA 3AK9A 2V15A 4EVDA 3AJQA 3EZ0A 2RBDA 3VV9A 1LKPA 3AK8A 4KVSA 2G38B 1RCDA 2C41A 1VELA 2V2OA 1FHAA 1EUMA 4LYUA 3E1MA 1DPSA 2FJCA 4Y08A 4CMYV 1JYBA 5J9VA 4REUA 4W4LB 2GYQA 4IXKA 3M6JA 3WVWA 1HRSA 5LG2A 1BFRA 1TJOA 2XKQA 1O9RA 2C2UA 3PWQC 2FFXJ 3E2CA 3TA8A 3PW8A 3QHBA 3FVBA 3R2HA 1O9IA 2QQYA 4AM5A 3C21A 4RC8A 5GU3X 3F32A 1TKOA 5FFAA 4CYBA 3WNWA 4RC7A 3IS7A 1F33A 4TOGA 4DASA 5I4JA 5FEJA 4PGKA 3SH6A 3R2SA 4CMYA 3GVYA 2BKCA 4OYNA 3OJ5A 3FSEA 2BW1A 4Z5SA 3SHXA 1L8IA 5HJFA 3E6SA 1Z6OA 2C2FA 3PW8C 1LKOA 3KDQA 5D8SA 3D19A 1ZS3A 5J93A 1RCGA 1L8HA 2ZG8X 2V2IA 4ZKXA 4DYXA 4ITTA 2Y44A 2CN6A 2Z5RA 1YUZA 2YJKA 2XJNA 2IB0A 2FHAA 2YJJA 4ML5A 1JIGA 4CY9A 4MY7A 1YUXA 3U90A 4CYAA 2QF9A 2OH3A 5GN8A 5FFCA 4XKUA 1BCFA 1TKPA 3AF8X 2FG8A 4XKSA 3UOIA 3V3KB 4YXJA 5J8SA 4RC6B 1DATA 4M35A 5GOUA 3KWOA 1S2ZA 3HIUA 2HTNA 1NNQA 5FFBA 3PVYB 5ERJA 3O7SA 3HL1A 3PVTA 3BKNA 3UFBA 2XGWA 5GU1X 3RGDA 2Z5PA 3E1JA 3H7GA 2Z6MA 5IX6A 4P18A 2V2JA 5D8QA 4M32A 4MXPA 4TOCA 1IESA 1Z6OM 1ZUJA 4KVQA 4TOHA 5LS9A 2D5KA 1VEIA 2X170 2IU2A 5JACA 3QZ3A 4DYZA 2PYBA 5JDOA 2OKCA 4XKTA 3AJPA 4EVEA 1UMNA 3F33A 3C1YA 5D8RA 5D8XA 5CMRA 1NF6A 2ITBA 3E1PA 5JKMA 1DVBA 3AJOA 3QD8A 4EVCA 3E1OA 2CLUA 4ZKWA 4M34A 1UVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TOA A;  3BVF A;  4ETR A;  4XGS A;  1JKV A;  5K53 A;  2V2L A;  3FI6 A;  4E6K A;  3UOF A;  1JRE A;  1TK6 A;  3KA9 A;  4DI0 A;  4LPN A;  1BG7 A;  1RCI A;  1NFV A;  4ZKH A;  2FZF A;  3QB9 A;  1R03 A;  2YW7 A;  2JD7 0;  2VXI A;  1KRQ A;  4AM2 A;  3ISF A;  3NP2 X;  4QUW A;  2CF7 A;  3A9Q A;  3E1N A;  3PVR A;  4ZTT A;  4R42 A;  5C6F A;  5GN8 B;  2CHI A;  5HQO A;  3A68 A;  4MN9 A;  2FKZ A;  4II4 A;  2JD8 0;  2JD6 0;  4RC5 A;  1RCC A;  3KXU A;  3RD0 A;  1SOF A;  2OC5 A;  3Q4R A;  2FG4 A;  4CVT A;  2V2R A;  3PWF A;  2UX1 A;  4DE6 A;  5HJH A;  4AM4 A;  5JKM G;  2XJO A;  3PVT B;  1IER A;  2CHP A;  3F39 A;  3QHC A;  1XZ1 A;  2ZUR X;  3OGH A;  5K52 A;  1RYT A;  3BVL A;  2CEI A;  3PW1 A;  1NF4 A;  1JI5 A;  1QYB A;  4TOF A;  4DYU A;  3R2L A;  4LQH A;  3EZU A;  4LPJ A;  2FL0 A;  2WLA A;  2V2S A;  1MOJ A;  4PG1 A;  4LQJ A;  3KA8 A;  4ZLW A;  2VZB A;  5D8P A;  2Z5Q A;  3EGM A;  2V2M A;  2VXX A;  3AF9 X;  4MUD A;  4MKU A;  4M33 A;  3E6R A;  4IWK A;  3O7R A;  2GS4 A;  4LYX A;  2G4H A;  4IWJ A;  2ZA7 A;  4LQN A;  1S3Q A;  2ZG9 X;  4CVR A;  2ZA8 A;  4U3G A;  1F30 A;  1N1Q A;  3R2R A;  4DZ0 A;  2C2J A;  5LBH A;  2W0O A;  2V2P A;  3R2K A;  4ERU A;  4TO9 A;  5D8O A;  4EVB A;  3BVE A;  1Z4A A;  3IQ1 A;  1VJX A;  3BT5 A;  3UNO A;  3WVU A;  4RC7 B;  3R2O A;  5GU2 X;  3AF7 X;  3WVV A;  1MFR A;  3Q4O A;  2BJY A;  1H96 A;  2Y3Q A;  3E1Q A;  3F36 A;  4LPM A;  2IY4 A;  4ISM A;  1AEW A;  3BVK A;  1JTS A;  3KA3 A;  2YW6 A;  2CN7 A;  3PVR B;  3MPS A;  1GWG A;  5FFD A;  1VLG A;  4PGI A;  5JKL A;  3ISE A;  4MJY A;  4II4 B;  1JGC A;  4RC5 B;  2GYD A;  5AXS A;  3T9J A;  3IS8 A;  1RCE A;  3PZA A;  4TW3 A;  2WTL A;  4ISP A;  1B71 A;  3RAV A;  2XJM A;  3E1L A;  1XZ3 A;  2ZA6 A;  5E1U A;  1JKU A;  1JI4 A;  4TOD A;  5D8Y A;  5CMQ A;  3QVD A;  1LKM A;  4CVP A;  4YKH A;  3F37 A;  4ITW A;  3KX9 A;  3Q4Q A;  3KA4 A;  3PW1 B;  4Z3B A;  4PG0 A;  4LQV A;  3ES3 A;  4CVS A;  3SE1 A;  2CIH A;  4ZMC A;  3Q4N A;  3F38 A;  4A25 A;  2ZG7 X;  4TOB A;  3RBC A;  5LG8 A;  3GE4 A;  1LB3 A;  1J30 A;  3R2M A;  4ZL6 A;  1VEQ A;  1S30 A;  4DYY A;  3F34 A;  2Z90 A;  1YV1 A;  2CLB A;  2F7N A;  2BK6 A;  5J8W A;  4TOE A;  3VNX A;  2HR5 A;  4ZL5 A;  3BVI A;  3NOZ X;  4KVR A;  5ERK A;  3RE7 A;  1SQ3 A;  3F35 A;  4ZJK A;  3ERZ A;  3SID A;  2V2N A;  3GHQ A;  3KA6 A;  5E2D A;  4RC6 A;  5JKL G;  3NP0 X;  1QGH A;  5CZU A;  1OTK A;  2WLU A;  3PWQ A;  3PVY A;  5GU0 X;  5FFE A;  2C6R A;  3AK9 A;  2V15 A;  4EVD A;  3AJQ A;  3EZ0 A;  2RBD A;  1LKP A;  3AK8 A;  4KVS A;  1RCD A;  2C41 A;  1VEL A;  2V2O A;  1FHA A;  1EUM A;  4LYU A;  3E1M A;  1DPS A;  2FJC A;  4Y08 A;  4CMY V;  1JYB A;  5J9V A;  4REU A;  2GYQ A;  4IXK A;  3WVW A;  1HRS A;  5LG2 A;  1BFR A;  1TJO A;  2XKQ A;  1O9R A;  2C2U A;  3PWQ C;  2FFX J;  3E2C A;  3TA8 A;  3PW8 A;  3QHB A;  3FVB A;  3R2H A;  1O9I A;  2QQY A;  4AM5 A;  4RC8 A;  5GU3 X;  3F32 A;  1TKO A;  5FFA A;  4CYB A;  3WNW A;  4RC7 A;  3IS7 A;  1F33 A;  4TOG A;  4DAS A;  5I4J A;  5FEJ A;  4PGK A;  3SH6 A;  3R2S A;  4CMY A;  3GVY A;  2BKC A;  4OYN A;  3OJ5 A;  3FSE A;  2BW1 A;  4Z5S A;  3SHX A;  1L8I A;  5HJF A;  3E6S A;  1Z6O A;  2C2F A;  3PW8 C;  1LKO A;  5D8S A;  1ZS3 A;  5J93 A;  1RCG A;  1L8H A;  2ZG8 X;  2V2I A;  4ZKX A;  4DYX A;  4ITT A;  2CN6 A;  2Z5R A;  1YUZ A;  2YJK A;  2XJN A;  2IB0 A;  4ML5 A;  2FHA A;  2YJJ A;  1JIG A;  4CY9 A;  4MY7 A;  1YUX A;  3U90 A;  4CYA A;  2QF9 A;  2OH3 A;  5GN8 A;  5FFC A;  4XKU A;  1BCF A;  1TKP A;  3AF8 X;  2FG8 A;  4XKS A;  3UOI A;  5J8S A;  4RC6 B;  1DAT A;  4M35 A;  5GOU A;  3KWO A;  1S2Z A;  3HIU A;  2HTN A;  1NNQ A;  5FFB A;  3PVY B;  5ERJ A;  3O7S A;  3HL1 A;  3PVT A;  3BKN A;  2XGW A;  5GU1 X;  3RGD A;  2Z5P A;  3E1J A;  3H7G A;  2Z6M A;  5IX6 A;  4P18 A;  2V2J A;  5D8Q A;  4M32 A;  4TOC A;  1IES A;  1Z6O M;  1ZUJ A;  4KVQ A;  4TOH A;  5LS9 A;  2D5K A;  1VEI A;  2X17 0;  2IU2 A;  5JAC A;  3QZ3 A;  4DYZ A;  2PYB A;  4XKT A;  3AJP A;  4EVE A;  1UMN A;  3F33 A;  5D8R A;  5D8X A;  5CMR A;  1NF6 A;  2ITB A;  3E1P A;  5JKM A;  1DVB A;  3AJO A;  3QD8 A;  4EVC A;  3E1O A;  2CLU A;  4ZKW A;  4M34 A;  1UVH A; 
#chains in the Genus database with same CATH topology
 4TOA A;  3N6O A;  3BVF A;  4ETR A;  4XGS A;  2V8U A;  1JKV A;  5K53 A;  2V2L A;  3FI6 A;  4E6K A;  2CWL A;  3UOF A;  1JRE A;  1TK6 A;  3KA9 A;  4DI0 A;  4LPN A;  1BG7 A;  1RCI A;  1NFV A;  4ZKH A;  2FZF A;  3QB9 A;  1R03 A;  2YW7 A;  2JD7 0;  2VXI A;  1KRQ A;  4AM2 A;  3ISF A;  3NP2 X;  4QUW A;  2CF7 A;  3A9Q A;  3E1N A;  3PVR A;  4ZTT A;  2WWX B;  4R42 A;  4WJG 4;  5C6F A;  5GN8 B;  2CHI A;  5HQO A;  3A68 A;  4MN9 A;  2FKZ A;  4II4 A;  2JD8 0;  2JD6 0;  4RC5 A;  1RCC A;  3L0M A;  3KXU A;  3RD0 A;  1SOF A;  2OC5 A;  3Q4R A;  2FG4 A;  4CVT A;  2V2R A;  3PWF A;  3FRS A;  2UX1 A;  4DE6 A;  5HJH A;  4AM4 A;  5JKM G;  2XJO A;  3PVT B;  1IER A;  2CHP A;  3F39 A;  3KHK A;  3QHC A;  1XZ1 A;  2ZUR X;  3OGH A;  5K52 A;  1RYT A;  3BVL A;  2CEI A;  3PW1 A;  1NF4 A;  1JI5 A;  1QYB A;  4TOF A;  4DYU A;  3R2L A;  4LQH A;  3JZ9 A;  3EZU A;  2FL0 A;  2WLA A;  4LPJ A;  2V2S A;  1MOJ A;  4PG1 A;  3C1Z A;  4LQJ A;  3KA8 A;  4ZLW A;  2VZB A;  5D8P A;  2Z5Q A;  3EGM A;  2V2M A;  2VXX A;  3AF9 X;  4MUD A;  2AR0 A;  4MKU A;  5JDO B;  4YVZ A;  4M33 A;  3E6R A;  4IWK A;  3O7R A;  2GS4 A;  4LYX A;  2G4H A;  4IWJ A;  2ZA7 A;  4LQN A;  1S3Q A;  2ZG9 X;  2MGY A;  4CVR A;  2ZA8 A;  4U3G A;  1F30 A;  1N1Q A;  3R2R A;  4DZ0 A;  2C2J A;  5LBH A;  2W0O A;  3LKD A;  2V2P A;  4X0J A;  3R2K A;  4ERU A;  4TO9 A;  5D8O A;  4EVB A;  3BVE A;  1Z4A A;  3IQ1 A;  1VJX A;  3BT5 A;  3UNO A;  3WVU A;  4RC7 B;  3R2O A;  5GU2 X;  3AF7 X;  3WVV A;  3GGY A;  1MFR A;  3Q4O A;  4KXR B;  2BJY A;  3VVA A;  1H96 A;  2N02 A;  2Y3Q A;  3E1Q A;  3F36 A;  4LPM A;  2IY4 A;  3JZA B;  4ISM A;  1AEW A;  3BVK A;  1JTS A;  3KA3 A;  2YW6 A;  2CN7 A;  3PVR B;  3FRR A;  3MPS A;  1GWG A;  5FFD A;  1VLG A;  4PGI A;  4E40 A;  5JKL A;  3ISE A;  4W4K B;  4MJY A;  4II4 B;  1JGC A;  4RC5 B;  3GGZ A;  5HU6 D;  2GYD A;  5AXS A;  3T9J A;  3IS8 A;  1RCE A;  3PZA A;  4TW3 A;  2WTL A;  4ISP A;  1B71 A;  3RAV A;  2XJM A;  4YXM A;  3W54 A;  3E1L A;  1XZ3 A;  2ZA6 A;  5E1U A;  1JKU A;  1JI4 A;  4TOD A;  5D8Y A;  5CMQ A;  3QVD A;  1LKM A;  4CVP A;  4YKH A;  3F37 A;  4ITW A;  3KX9 A;  3Q4Q A;  3KA4 A;  3PW1 B;  4Z3B A;  4PG0 A;  4LQV A;  3ES3 A;  3C23 A;  4CVS A;  3DBY A;  3SE1 A;  2CIH A;  4ZMC A;  3Q4N A;  3F38 A;  4A25 A;  2ZG7 X;  4TOB A;  3RBC A;  5LG8 A;  3GE4 A;  1LB3 A;  1J30 A;  3R2M A;  4ZL6 A;  1VEQ A;  1S30 A;  2V8T A;  4DYY A;  3F34 A;  2Z90 A;  1YV1 A;  2CLB A;  2F7N A;  2BK6 A;  5J8W A;  4TOE A;  3VNX A;  2HR5 A;  4ZL5 A;  3BVI A;  3NOZ X;  4KVR A;  5ERK A;  3RE7 A;  1SQ3 A;  3F35 A;  4ZJK A;  3ERZ A;  3SID A;  2V2N A;  3GHQ A;  3KA6 A;  5E2D A;  4RC6 A;  5JKL G;  3NP0 X;  1QGH A;  5CZU A;  1OTK A;  2WLU A;  3PWQ A;  3PVY A;  5GU0 X;  5FFE A;  2C6R A;  3AK9 A;  2V15 A;  4EVD A;  3AJQ A;  3EZ0 A;  2RBD A;  3VV9 A;  1LKP A;  3AK8 A;  4KVS A;  2G38 B;  1RCD A;  2C41 A;  1VEL A;  2V2O A;  1FHA A;  1EUM A;  4LYU A;  3E1M A;  1DPS A;  2FJC A;  4Y08 A;  4CMY V;  1JYB A;  5J9V A;  4REU A;  4W4L B;  2GYQ A;  4IXK A;  3M6J A;  3WVW A;  1HRS A;  5LG2 A;  1BFR A;  1TJO A;  2XKQ A;  1O9R A;  2C2U A;  3PWQ C;  2FFX J;  3E2C A;  3TA8 A;  3PW8 A;  3QHB A;  3FVB A;  3R2H A;  1O9I A;  2QQY A;  4AM5 A;  3C21 A;  4RC8 A;  5GU3 X;  3F32 A;  1TKO A;  5FFA A;  4CYB A;  3WNW A;  4RC7 A;  3IS7 A;  1F33 A;  4TOG A;  4DAS A;  5I4J A;  5FEJ A;  4PGK A;  3SH6 A;  3R2S A;  4CMY A;  3GVY A;  2BKC A;  4OYN A;  3OJ5 A;  3FSE A;  2BW1 A;  4Z5S A;  3SHX A;  1L8I A;  5HJF A;  3E6S A;  1Z6O A;  2C2F A;  3PW8 C;  1LKO A;  3KDQ A;  5D8S A;  3D19 A;  1ZS3 A;  5J93 A;  1RCG A;  1L8H A;  2ZG8 X;  2V2I A;  4ZKX A;  4DYX A;  4ITT A;  2Y44 A;  2CN6 A;  2Z5R A;  1YUZ A;  2YJK A;  2XJN A;  2IB0 A;  2FHA A;  2YJJ A;  4ML5 A;  1JIG A;  4CY9 A;  4MY7 A;  1YUX A;  3U90 A;  4CYA A;  2QF9 A;  2OH3 A;  5GN8 A;  5FFC A;  4XKU A;  1BCF A;  1TKP A;  3AF8 X;  2FG8 A;  4XKS A;  3UOI A;  3V3K B;  4YXJ A;  5J8S A;  4RC6 B;  1DAT A;  4M35 A;  5GOU A;  3KWO A;  1S2Z A;  3HIU A;  2HTN A;  1NNQ A;  5FFB A;  3PVY B;  5ERJ A;  3O7S A;  3HL1 A;  3PVT A;  3BKN A;  3UFB A;  2XGW A;  5GU1 X;  3RGD A;  2Z5P A;  3E1J A;  3H7G A;  2Z6M A;  5IX6 A;  4P18 A;  2V2J A;  5D8Q A;  4M32 A;  4MXP A;  4TOC A;  1IES A;  1Z6O M;  1ZUJ A;  4KVQ A;  4TOH A;  5LS9 A;  2D5K A;  1VEI A;  2X17 0;  2IU2 A;  5JAC A;  3QZ3 A;  4DYZ A;  2PYB A;  5JDO A;  2OKC A;  4XKT A;  3AJP A;  4EVE A;  1UMN A;  3F33 A;  3C1Y A;  5D8R A;  5D8X A;  5CMR A;  1NF6 A;  2ITB A;  3E1P A;  5JKM A;  1DVB A;  3AJO A;  3QD8 A;  4EVC A;  3E1O A;  2CLU A;  4ZKW A;  4M34 A;  1UVH A; 
#chains in the Genus database with same CATH homology
 4TOA A;  3N6O A;  3BVF A;  4ETR A;  4XGS A;  2V8U A;  1JKV A;  5K53 A;  2V2L A;  3FI6 A;  4E6K A;  2CWL A;  3UOF A;  1JRE A;  1TK6 A;  3KA9 A;  4DI0 A;  4LPN A;  1BG7 A;  1RCI A;  1NFV A;  4ZKH A;  2FZF A;  3QB9 A;  1R03 A;  2YW7 A;  2JD7 0;  2VXI A;  1KRQ A;  4AM2 A;  3ISF A;  3NP2 X;  4QUW A;  2CF7 A;  3A9Q A;  3E1N A;  3PVR A;  4ZTT A;  2WWX B;  4R42 A;  4WJG 4;  5C6F A;  5GN8 B;  2CHI A;  5HQO A;  3A68 A;  4MN9 A;  2FKZ A;  4II4 A;  2JD8 0;  2JD6 0;  4RC5 A;  1RCC A;  3L0M A;  3KXU A;  3RD0 A;  1SOF A;  2OC5 A;  3Q4R A;  2FG4 A;  4CVT A;  2V2R A;  3PWF A;  3FRS A;  2UX1 A;  4DE6 A;  5HJH A;  4AM4 A;  5JKM G;  2XJO A;  3PVT B;  1IER A;  2CHP A;  3F39 A;  3KHK A;  3QHC A;  1XZ1 A;  2ZUR X;  3OGH A;  5K52 A;  1RYT A;  3BVL A;  2CEI A;  3PW1 A;  1NF4 A;  1JI5 A;  1QYB A;  4TOF A;  4DYU A;  3R2L A;  4LQH A;  3JZ9 A;  3EZU A;  2FL0 A;  2WLA A;  4LPJ A;  2V2S A;  1MOJ A;  4PG1 A;  3C1Z A;  4LQJ A;  3KA8 A;  4ZLW A;  2VZB A;  5D8P A;  2Z5Q A;  3EGM A;  2V2M A;  2VXX A;  3AF9 X;  4MUD A;  2AR0 A;  4MKU A;  5JDO B;  4YVZ A;  4M33 A;  3E6R A;  4IWK A;  3O7R A;  2GS4 A;  4LYX A;  2G4H A;  4IWJ A;  2ZA7 A;  4LQN A;  1S3Q A;  2ZG9 X;  2MGY A;  4CVR A;  2ZA8 A;  4U3G A;  1F30 A;  1N1Q A;  3R2R A;  4DZ0 A;  2C2J A;  5LBH A;  2W0O A;  3LKD A;  2V2P A;  4X0J A;  3R2K A;  4ERU A;  4TO9 A;  5D8O A;  4EVB A;  3BVE A;  1Z4A A;  3IQ1 A;  1VJX A;  3BT5 A;  3UNO A;  3WVU A;  4RC7 B;  3R2O A;  5GU2 X;  3AF7 X;  3WVV A;  3GGY A;  1MFR A;  3Q4O A;  4KXR B;  2BJY A;  3VVA A;  1H96 A;  2N02 A;  2Y3Q A;  3E1Q A;  3F36 A;  4LPM A;  2IY4 A;  3JZA B;  4ISM A;  1AEW A;  3BVK A;  1JTS A;  3KA3 A;  2YW6 A;  2CN7 A;  3PVR B;  3FRR A;  3MPS A;  1GWG A;  5FFD A;  1VLG A;  4PGI A;  4E40 A;  5JKL A;  3ISE A;  4W4K B;  4MJY A;  4II4 B;  1JGC A;  4RC5 B;  3GGZ A;  5HU6 D;  2GYD A;  5AXS A;  3T9J A;  3IS8 A;  1RCE A;  3PZA A;  4TW3 A;  2WTL A;  4ISP A;  1B71 A;  3RAV A;  2XJM A;  4YXM A;  3W54 A;  3E1L A;  1XZ3 A;  2ZA6 A;  5E1U A;  1JKU A;  1JI4 A;  4TOD A;  5D8Y A;  5CMQ A;  3QVD A;  1LKM A;  4CVP A;  4YKH A;  3F37 A;  4ITW A;  3KX9 A;  3Q4Q A;  3KA4 A;  3PW1 B;  4Z3B A;  4PG0 A;  4LQV A;  3ES3 A;  3C23 A;  4CVS A;  3DBY A;  3SE1 A;  2CIH A;  4ZMC A;  3Q4N A;  3F38 A;  4A25 A;  2ZG7 X;  4TOB A;  3RBC A;  5LG8 A;  3GE4 A;  1LB3 A;  1J30 A;  3R2M A;  4ZL6 A;  1VEQ A;  1S30 A;  2V8T A;  4DYY A;  3F34 A;  2Z90 A;  1YV1 A;  2CLB A;  2F7N A;  2BK6 A;  5J8W A;  4TOE A;  3VNX A;  2HR5 A;  4ZL5 A;  3BVI A;  3NOZ X;  4KVR A;  5ERK A;  3RE7 A;  1SQ3 A;  3F35 A;  4ZJK A;  3ERZ A;  3SID A;  2V2N A;  3GHQ A;  3KA6 A;  5E2D A;  4RC6 A;  5JKL G;  3NP0 X;  1QGH A;  5CZU A;  1OTK A;  2WLU A;  3PWQ A;  3PVY A;  5GU0 X;  5FFE A;  2C6R A;  3AK9 A;  2V15 A;  4EVD A;  3AJQ A;  3EZ0 A;  2RBD A;  3VV9 A;  1LKP A;  3AK8 A;  4KVS A;  2G38 B;  1RCD A;  2C41 A;  1VEL A;  2V2O A;  1FHA A;  1EUM A;  4LYU A;  3E1M A;  1DPS A;  2FJC A;  4Y08 A;  4CMY V;  1JYB A;  5J9V A;  4REU A;  4W4L B;  2GYQ A;  4IXK A;  3M6J A;  3WVW A;  1HRS A;  5LG2 A;  1BFR A;  1TJO A;  2XKQ A;  1O9R A;  2C2U A;  3PWQ C;  2FFX J;  3E2C A;  3TA8 A;  3PW8 A;  3QHB A;  3FVB A;  3R2H A;  1O9I A;  2QQY A;  4AM5 A;  3C21 A;  4RC8 A;  5GU3 X;  3F32 A;  1TKO A;  5FFA A;  4CYB A;  3WNW A;  4RC7 A;  3IS7 A;  1F33 A;  4TOG A;  4DAS A;  5I4J A;  5FEJ A;  4PGK A;  3SH6 A;  3R2S A;  4CMY A;  3GVY A;  2BKC A;  4OYN A;  3OJ5 A;  3FSE A;  2BW1 A;  4Z5S A;  3SHX A;  1L8I A;  5HJF A;  3E6S A;  1Z6O A;  2C2F A;  3PW8 C;  1LKO A;  3KDQ A;  5D8S A;  3D19 A;  1ZS3 A;  5J93 A;  1RCG A;  1L8H A;  2ZG8 X;  2V2I A;  4ZKX A;  4DYX A;  4ITT A;  2Y44 A;  2CN6 A;  2Z5R A;  1YUZ A;  2YJK A;  2XJN A;  2IB0 A;  2FHA A;  2YJJ A;  4ML5 A;  1JIG A;  4CY9 A;  4MY7 A;  1YUX A;  3U90 A;  4CYA A;  2QF9 A;  2OH3 A;  5GN8 A;  5FFC A;  4XKU A;  1BCF A;  1TKP A;  3AF8 X;  2FG8 A;  4XKS A;  3UOI A;  3V3K B;  4YXJ A;  5J8S A;  4RC6 B;  1DAT A;  4M35 A;  5GOU A;  3KWO A;  1S2Z A;  3HIU A;  2HTN A;  1NNQ A;  5FFB A;  3PVY B;  5ERJ A;  3O7S A;  3HL1 A;  3PVT A;  3BKN A;  3UFB A;  2XGW A;  5GU1 X;  3RGD A;  2Z5P A;  3E1J A;  3H7G A;  2Z6M A;  5IX6 A;  4P18 A;  2V2J A;  5D8Q A;  4M32 A;  4MXP A;  4TOC A;  1IES A;  1Z6O M;  1ZUJ A;  4KVQ A;  4TOH A;  5LS9 A;  2D5K A;  1VEI A;  2X17 0;  2IU2 A;  5JAC A;  3QZ3 A;  4DYZ A;  2PYB A;  5JDO A;  2OKC A;  4XKT A;  3AJP A;  4EVE A;  1UMN A;  3F33 A;  3C1Y A;  5D8R A;  5D8X A;  5CMR A;  1NF6 A;  2ITB A;  3E1P A;  5JKM A;  1DVB A;  3AJO A;  3QD8 A;  4EVC A;  3E1O A;  2CLU A;  4ZKW A;  4M34 A;  1UVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...