3PVYB

The phenylacetyl-coa monooxygenase paaac subcomplex with coenzyme a
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
238
structure length
238
Chain Sequence
SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAINKLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVFAGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylacetic acid degradation protein paaA
publication title Structural and Functional Studies of the Escherichia coli Phenylacetyl-CoA Monooxygenase Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 98
structure length 238
sequence length 238
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pvyB00
2WTLA 5J93A 3BVKA 1MFRA 5GN8A 4A25A 4AM2A 2F7NA 5GU0X 3OGHA 2YJJA 4CVPA 5D8QA 4U3GA 3BVEA 1NF6A 2GS4A 5D8RA 3E6RA 4ZLWA 4II4B 2VXIA 3AJQA 4LPNA 4RC7B 3Q4OA 2BJYA 4MUDA 3IS7A 2V2NA 5GU2X 3BT5A 1TKPA 2Z5PA 5D8PA 3SH6A 2XKQA 3QD8A 3KA3A 2CHIA 4ZJKA 1GWGA 4IXKA 3QHCA 4TO9A 2V2SA 3ES3A 5GOUA 5HJHA 4RC6B 3ERZA 4IWJA 2Z90A 1LKPA 4M34A 3EZ0A 3E2CA 4Z5SA 2HTNA 4DYUA 3F34A 1QYBA 4EVDA 2OC5A 3F32A 4II4A 2VXXA 4RC7A 2JD70 3IS8A 4LPMA 2CHPA 4ISMA 1F33A 2CIHA 3E1MA 4CMYV 3F36A 2V2IA 4CMYA 5GN8B 3R2KA 3R2HA 1NF4A 2CEIA 1VEQA 3IQ1A 5J9VA 4ITWA 4TW3A 2CN7A 4DYYA 4XKTA 3ISEA 4MY7A 4LQVA 4RC6A 3H7GA 3F38A 1EUMA 1JI4A 3RE7A 2ZG8X 1IESA 5LG8A 4EVBA 3R2OA 3RD0A 3ISFA 5LBHA 1Z6OA 2ZURX 5ERKA 3PZAA 2FL0A 3WNWA 1Z6OM 2FJCA 3NP2X 3T9JA 1BCFA 1VELA 5FEJA 4YKHA 3GVYA 3TA8A 4DE6A 2D5KA 3KA6A 1XZ1A 1YV1A 2RBDA 4LQHA 3KWOA 3O7RA 1JGCA 4ETRA 4ZMCA 3VNXA 1HRSA 2JD60 5AXSA 2G4HA 3AK8A 1RCDA 5FFAA 4LPJA 2XGWA 4LYUA 4CVRA 1MOJA 2C2FA 5CZUA 1F30A 3AF8X 3R2LA 4CY9A 4TOGA 4PGKA 4ZKXA 4IWKA 3KA4A 2Z5RA 2W0OA 1VJXA 5CMQA 4CYAA 4XGSA 2CLUA 1UMNA 2OH3A 5JKLA 3PVTB 5C6FA 3KXUA 5D8YA 4XKUA 5JKLG 2QQYA 5LG2A 2V2JA 2YJKA 2X170 1ZS3A 2ZG7X 1DVBA 2ZA7A 2FZFA 4M35A 4LYXA 1L8IA 3UNOA 5E2DA 2CN6A 2YW7A 2CF7A 4DASA 4TOFA 1VEIA 3BKNA 4ZKWA 5I4JA 1TK6A 4TOCA 4TOAA 5K52A 4REUA 3PWQA 4DYZA 4ISPA 3F37A 4KVRA 2C2JA 3E6SA 2IU2A 4ZL5A 1BG7A 2IB0A 3E1NA 1J30A 2WLUA 5K53A 3KX9A 5LS9A 3PVRB 2YW6A 1JI5A 1DPSA 3PVTA 1LKMA 2C2UA 4M32A 3OJ5A 5JKMA 5FFCA 1TKOA 5E1UA 2CLBA 3PW8A 3PWFA 2BKCA 4AM5A 3GHQA 1ZUJA 2V2LA 1H96A 2HR5A 3Q4RA 5JKMG 4R42A 3WVVA 3BVIA 2ZG9X 3MPSA 3Q4QA 2GYDA 2C41A 1JYBA 5D8XA 1O9IA 3KA9A 3AF7X 2FKZA 1R03A 1L8HA 4TODA 4M33A 2VZBA 2XJMA 3A9QA 2ITBA 1B71A 3PVRA 2FG8A 2FHAA 5GU3X 2BK6A 1DATA 2V2PA 1S3QA 5FFBA 1JTSA 5HQOA 4MKUA 3EGMA 3R2MA 4PG1A 4RC5B 1RCCA 2XJNA 2FG4A 3Q4NA 4QUWA 2Y3QA 4Z3BA 4ZKHA 5FFDA 3U90A 4AM4A 4OYNA 4MJYA 2XJOA 1JKVA 4XKSA 2QF9A 2PYBA 3PW1B 3PVYB 3E1OA 3AK9A 1UVHA 3E1PA 3O7SA 4ZTTA 2BW1A 1N1QA 4EVCA 1TJOA 3PWQC 2FFXJ 3WVUA 3KA8A 4ITTA 1SQ3A 3WVWA 4KVQA 1JREA 4ZL6A 3FSEA 5HJFA 4TOBA 5D8SA 4CVSA 2ZA6A 3QVDA 4LQJA 3UOFA 2JD80 3QB9A 4LQNA 1S2ZA 3F39A 1RCIA 1IERA 2ZA8A 4P18A 4RC8A 4EVEA 5J8SA 4E6KA 4RC5A 2V15A 1NNQA 2V2RA 3FVBA 3GE4A 2Z5QA 3PW8C 5FFEA 3HL1A 4TOHA 3AJPA 1OTKA 3RGDA 3NOZX 1YUXA 3NP0X 3R2RA 4DI0A 3FI6A 3AF9X 1S30A 4ERUA 1RYTA 1AEWA 4MN9A 5ERJA 3SE1A 4DYXA 3QHBA 3RAVA 3RBCA 3PVYA 2IY4A 3PW1A 5CMRA 4CYBA 2C6RA 3UOIA 1KRQA 1RCEA 1Z4AA 2Z6MA 4PG0A 4ML5A 1RCGA 2V2MA 3E1LA 3HIUA 3E1QA 1YUZA 1JKUA 1BFRA 3SHXA 1NFVA 2V2OA 4Y08A 4CVTA 3BVLA 3EZUA 5GU1X 4PGIA 3A68A 4TOEA 3F35A 1XZ3A 1FHAA 3E1JA 1LB3A 3SIDA 2UX1A 1LKOA 3AJOA 2WLAA 1JIGA 5JACA 3QZ3A 1O9RA 1QGHA 3BVFA 4DZ0A 5D8OA 1VLGA 5IX6A 1SOFA 3R2SA 4KVSA 3F33A 2GYQA 5J8WA
chains in the Genus database with same CATH superfamily
2WTLA 5J93A 3BVKA 1MFRA 5GN8A 4W4LB 4A25A 4AM2A 2F7NA 5GU0X 3OGHA 2YJJA 4CVPA 5D8QA 4U3GA 3BVEA 1NF6A 2GS4A 5D8RA 3E6RA 4ZLWA 4II4B 2VXIA 3AJQA 3C1YA 4LPNA 4RC7B 3Q4OA 2BJYA 4MUDA 3IS7A 2V2NA 3D19A 5GU2X 3BT5A 1TKPA 2Z5PA 5D8PA 3SH6A 2XKQA 3QD8A 3KA3A 2CHIA 4ZJKA 3JZAB 1GWGA 4IXKA 3QHCA 4TO9A 3GGYA 2V2SA 3ES3A 5GOUA 5HJHA 4RC6B 3W54A 3ERZA 4IWJA 2Z90A 1LKPA 4M34A 3EZ0A 3E2CA 4Z5SA 2HTNA 3L0MA 4DYUA 3F34A 5HU6D 4X0JA 1QYBA 4EVDA 2OC5A 3M6JA 3F32A 4II4A 2VXXA 3FRRA 4RC7A 2OKCA 2JD70 3IS8A 4LPMA 2CHPA 4ISMA 1F33A 2CIHA 3E1MA 4CMYV 3F36A 2V2IA 4CMYA 5GN8B 3R2KA 3R2HA 1NF4A 4YXJA 2V8TA 2CEIA 1VEQA 3IQ1A 5J9VA 4ITWA 4TW3A 2CN7A 4DYYA 4XKTA 3ISEA 4MY7A 4LQVA 4RC6A 3H7GA 3F38A 1EUMA 1JI4A 3RE7A 2ZG8X 1IESA 5LG8A 4EVBA 3R2OA 3RD0A 3ISFA 5LBHA 1Z6OA 2ZURX 5ERKA 3PZAA 2FL0A 3WNWA 1Z6OM 2FJCA 3NP2X 3T9JA 1BCFA 1VELA 5FEJA 4YKHA 3GVYA 3TA8A 4DE6A 2D5KA 3KA6A 1XZ1A 1YV1A 2RBDA 4LQHA 3KWOA 3O7RA 1JGCA 4ETRA 4ZMCA 3V3KB 3VNXA 1HRSA 2JD60 5AXSA 2G4HA 3AK8A 1RCDA 5FFAA 4LPJA 2XGWA 4LYUA 4CVRA 4WJG4 1MOJA 2C2FA 5CZUA 1F30A 3AF8X 3R2LA 4CY9A 4TOGA 4PGKA 4ZKXA 4IWKA 3KA4A 2Z5RA 2W0OA 1VJXA 5CMQA 4CYAA 4XGSA 2CLUA 1UMNA 2OH3A 5JKLA 3KDQA 3PVTB 5C6FA 3KXUA 5D8YA 4XKUA 5JKLG 2QQYA 5LG2A 4W4KB 2V2JA 2YJKA 2X170 1ZS3A 2ZG7X 1DVBA 2ZA7A 2FZFA 4M35A 4LYXA 1L8IA 2N02A 3UNOA 5E2DA 2CN6A 2CWLA 2YW7A 3C23A 2CF7A 4DASA 4TOFA 1VEIA 3BKNA 4ZKWA 5I4JA 1TK6A 4TOCA 4TOAA 5K52A 4KXRB 4REUA 3PWQA 4DYZA 4ISPA 3F37A 4YXMA 4KVRA 2C2JA 3E6SA 2IU2A 4ZL5A 1BG7A 2IB0A 3E1NA 1J30A 2WLUA 5K53A 3KX9A 5JDOB 5LS9A 3PVRB 2AR0A 2YW6A 3KHKA 1JI5A 1DPSA 3PVTA 1LKMA 2C2UA 4M32A 3OJ5A 5JKMA 5FFCA 1TKOA 5E1UA 3VV9A 2CLBA 3PW8A 3PWFA 3JZ9A 2BKCA 4AM5A 3GHQA 1ZUJA 2V2LA 1H96A 2HR5A 3Q4RA 5JKMG 4R42A 3WVVA 3BVIA 2ZG9X 3MPSA 3Q4QA 2GYDA 2C41A 1JYBA 2G38B 5D8XA 1O9IA 3KA9A 3AF7X 2Y44A 2FKZA 3FRSA 1R03A 1L8HA 4TODA 4M33A 2VZBA 2WWXB 5JDOA 2XJMA 3A9QA 2ITBA 1B71A 3PVRA 2FG8A 2FHAA 5GU3X 2BK6A 1DATA 2V2PA 3UFBA 1S3QA 5FFBA 1JTSA 5HQOA 4MKUA 3EGMA 3R2MA 4PG1A 4RC5B 1RCCA 2XJNA 2FG4A 3Q4NA 4QUWA 2Y3QA 4Z3BA 4ZKHA 5FFDA 3U90A 4AM4A 4OYNA 4MJYA 3VVAA 2XJOA 1JKVA 4XKSA 2QF9A 2PYBA 3PW1B 3PVYB 3E1OA 3AK9A 1UVHA 3E1PA 3O7SA 4ZTTA 2BW1A 1N1QA 4EVCA 1TJOA 3C21A 3PWQC 2FFXJ 3WVUA 3KA8A 4ITTA 1SQ3A 3WVWA 4KVQA 1JREA 4ZL6A 3FSEA 5HJFA 4TOBA 5D8SA 4CVSA 2ZA6A 3QVDA 4LQJA 3UOFA 2JD80 3QB9A 4LQNA 1S2ZA 3F39A 1RCIA 1IERA 2ZA8A 4P18A 4RC8A 4EVEA 5J8SA 3N6OA 4E6KA 4RC5A 2V15A 1NNQA 2V2RA 3FVBA 3GE4A 2Z5QA 3PW8C 5FFEA 3HL1A 4TOHA 3AJPA 1OTKA 3RGDA 3NOZX 1YUXA 3GGZA 3NP0X 3R2RA 4DI0A 4YVZA 3FI6A 3AF9X 1S30A 2MGYA 4ERUA 1RYTA 1AEWA 4MN9A 5ERJA 3SE1A 4DYXA 3QHBA 3RAVA 3RBCA 3C1ZA 3PVYA 2IY4A 3PW1A 5CMRA 4CYBA 2C6RA 3LKDA 3UOIA 1KRQA 4E40A 1RCEA 1Z4AA 2Z6MA 4PG0A 4ML5A 1RCGA 2V2MA 3E1LA 2V8UA 3HIUA 3E1QA 1YUZA 1JKUA 1BFRA 3SHXA 1NFVA 2V2OA 4Y08A 4CVTA 3BVLA 3EZUA 5GU1X 4PGIA 3A68A 4TOEA 3F35A 1XZ3A 1FHAA 3E1JA 3DBYA 1LB3A 3SIDA 2UX1A 1LKOA 3AJOA 4MXPA 2WLAA 1JIGA 5JACA 3QZ3A 1O9RA 1QGHA 3BVFA 4DZ0A 5D8OA 1VLGA 5IX6A 1SOFA 3R2SA 4KVSA 3F33A 2GYQA 5J8WA
chains in the Genus database with same CATH topology
2WTLA 5J93A 3BVKA 1MFRA 5GN8A 4W4LB 4A25A 4AM2A 2F7NA 5GU0X 3OGHA 2YJJA 4CVPA 5D8QA 4U3GA 3BVEA 1NF6A 2GS4A 5D8RA 3E6RA 4ZLWA 4II4B 2VXIA 3AJQA 3C1YA 4LPNA 4RC7B 3Q4OA 2BJYA 4MUDA 3IS7A 2V2NA 3D19A 5GU2X 3BT5A 1TKPA 2Z5PA 5D8PA 3SH6A 2XKQA 3QD8A 3KA3A 2CHIA 4ZJKA 3JZAB 1GWGA 4IXKA 3QHCA 4TO9A 3GGYA 2V2SA 3ES3A 5GOUA 5HJHA 4RC6B 3W54A 3ERZA 4IWJA 2Z90A 1LKPA 4M34A 3EZ0A 3E2CA 4Z5SA 2HTNA 3L0MA 4DYUA 3F34A 5HU6D 4X0JA 1QYBA 4EVDA 2OC5A 3M6JA 3F32A 4II4A 2VXXA 3FRRA 4RC7A 2OKCA 2JD70 3IS8A 4LPMA 2CHPA 4ISMA 1F33A 2CIHA 3E1MA 4CMYV 3F36A 2V2IA 4CMYA 5GN8B 3R2KA 3R2HA 1NF4A 4YXJA 2V8TA 2CEIA 1VEQA 3IQ1A 5J9VA 4ITWA 4TW3A 2CN7A 4DYYA 4XKTA 3ISEA 4MY7A 4LQVA 4RC6A 3H7GA 3F38A 1EUMA 1JI4A 3RE7A 2ZG8X 1IESA 5LG8A 4EVBA 3R2OA 3RD0A 3ISFA 5LBHA 1Z6OA 2ZURX 5ERKA 3PZAA 2FL0A 3WNWA 1Z6OM 2FJCA 3NP2X 3T9JA 1BCFA 1VELA 5FEJA 4YKHA 3GVYA 3TA8A 4DE6A 2D5KA 3KA6A 1XZ1A 1YV1A 2RBDA 4LQHA 3KWOA 3O7RA 1JGCA 4ETRA 4ZMCA 3V3KB 3VNXA 1HRSA 2JD60 5AXSA 2G4HA 3AK8A 1RCDA 5FFAA 4LPJA 2XGWA 4LYUA 4CVRA 4WJG4 1MOJA 2C2FA 5CZUA 1F30A 3AF8X 3R2LA 4CY9A 4TOGA 4PGKA 4ZKXA 4IWKA 3KA4A 2Z5RA 2W0OA 1VJXA 5CMQA 4CYAA 4XGSA 2CLUA 1UMNA 2OH3A 5JKLA 3KDQA 3PVTB 5C6FA 3KXUA 5D8YA 4XKUA 5JKLG 2QQYA 5LG2A 4W4KB 2V2JA 2YJKA 2X170 1ZS3A 2ZG7X 1DVBA 2ZA7A 2FZFA 4M35A 4LYXA 1L8IA 2N02A 3UNOA 5E2DA 2CN6A 2CWLA 2YW7A 3C23A 2CF7A 4DASA 4TOFA 1VEIA 3BKNA 4ZKWA 5I4JA 1TK6A 4TOCA 4TOAA 5K52A 4KXRB 4REUA 3PWQA 4DYZA 4ISPA 3F37A 4YXMA 4KVRA 2C2JA 3E6SA 2IU2A 4ZL5A 1BG7A 2IB0A 3E1NA 1J30A 2WLUA 5K53A 3KX9A 5JDOB 5LS9A 3PVRB 2AR0A 2YW6A 3KHKA 1JI5A 1DPSA 3PVTA 1LKMA 2C2UA 4M32A 3OJ5A 5JKMA 5FFCA 1TKOA 5E1UA 3VV9A 2CLBA 3PW8A 3PWFA 3JZ9A 2BKCA 4AM5A 3GHQA 1ZUJA 2V2LA 1H96A 2HR5A 3Q4RA 5JKMG 4R42A 3WVVA 3BVIA 2ZG9X 3MPSA 3Q4QA 2GYDA 2C41A 1JYBA 2G38B 5D8XA 1O9IA 3KA9A 3AF7X 2Y44A 2FKZA 3FRSA 1R03A 1L8HA 4TODA 4M33A 2VZBA 2WWXB 5JDOA 2XJMA 3A9QA 2ITBA 1B71A 3PVRA 2FG8A 2FHAA 5GU3X 2BK6A 1DATA 2V2PA 3UFBA 1S3QA 5FFBA 1JTSA 5HQOA 4MKUA 3EGMA 3R2MA 4PG1A 4RC5B 1RCCA 2XJNA 2FG4A 3Q4NA 4QUWA 2Y3QA 4Z3BA 4ZKHA 5FFDA 3U90A 4AM4A 4OYNA 4MJYA 3VVAA 2XJOA 1JKVA 4XKSA 2QF9A 2PYBA 3PW1B 3PVYB 3E1OA 3AK9A 1UVHA 3E1PA 3O7SA 4ZTTA 2BW1A 1N1QA 4EVCA 1TJOA 3C21A 3PWQC 2FFXJ 3WVUA 3KA8A 4ITTA 1SQ3A 3WVWA 4KVQA 1JREA 4ZL6A 3FSEA 5HJFA 4TOBA 5D8SA 4CVSA 2ZA6A 3QVDA 4LQJA 3UOFA 2JD80 3QB9A 4LQNA 1S2ZA 3F39A 1RCIA 1IERA 2ZA8A 4P18A 4RC8A 4EVEA 5J8SA 3N6OA 4E6KA 4RC5A 2V15A 1NNQA 2V2RA 3FVBA 3GE4A 2Z5QA 3PW8C 5FFEA 3HL1A 4TOHA 3AJPA 1OTKA 3RGDA 3NOZX 1YUXA 3GGZA 3NP0X 3R2RA 4DI0A 4YVZA 3FI6A 3AF9X 1S30A 2MGYA 4ERUA 1RYTA 1AEWA 4MN9A 5ERJA 3SE1A 4DYXA 3QHBA 3RAVA 3RBCA 3C1ZA 3PVYA 2IY4A 3PW1A 5CMRA 4CYBA 2C6RA 3LKDA 3UOIA 1KRQA 4E40A 1RCEA 1Z4AA 2Z6MA 4PG0A 4ML5A 1RCGA 2V2MA 3E1LA 2V8UA 3HIUA 3E1QA 1YUZA 1JKUA 1BFRA 3SHXA 1NFVA 2V2OA 4Y08A 4CVTA 3BVLA 3EZUA 5GU1X 4PGIA 3A68A 4TOEA 3F35A 1XZ3A 1FHAA 3E1JA 3DBYA 1LB3A 3SIDA 2UX1A 1LKOA 3AJOA 4MXPA 2WLAA 1JIGA 5JACA 3QZ3A 1O9RA 1QGHA 3BVFA 4DZ0A 5D8OA 1VLGA 5IX6A 1SOFA 3R2SA 4KVSA 3F33A 2GYQA 5J8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WTL A;  5J93 A;  3BVK A;  1MFR A;  5GN8 A;  4A25 A;  4AM2 A;  2F7N A;  5GU0 X;  3OGH A;  2YJJ A;  4CVP A;  5D8Q A;  4U3G A;  3BVE A;  1NF6 A;  2GS4 A;  5D8R A;  3E6R A;  4ZLW A;  4II4 B;  2VXI A;  3AJQ A;  4LPN A;  4RC7 B;  3Q4O A;  2BJY A;  4MUD A;  3IS7 A;  2V2N A;  5GU2 X;  3BT5 A;  1TKP A;  2Z5P A;  5D8P A;  3SH6 A;  2XKQ A;  3QD8 A;  3KA3 A;  2CHI A;  4ZJK A;  1GWG A;  4IXK A;  3QHC A;  4TO9 A;  2V2S A;  3ES3 A;  5GOU A;  5HJH A;  4RC6 B;  3ERZ A;  4IWJ A;  2Z90 A;  1LKP A;  4M34 A;  3EZ0 A;  3E2C A;  4Z5S A;  2HTN A;  4DYU A;  3F34 A;  1QYB A;  4EVD A;  2OC5 A;  3F32 A;  4II4 A;  2VXX A;  4RC7 A;  2JD7 0;  3IS8 A;  4LPM A;  2CHP A;  4ISM A;  1F33 A;  2CIH A;  3E1M A;  4CMY V;  3F36 A;  2V2I A;  4CMY A;  5GN8 B;  3R2K A;  3R2H A;  1NF4 A;  2CEI A;  1VEQ A;  3IQ1 A;  5J9V A;  4ITW A;  4TW3 A;  2CN7 A;  4DYY A;  4XKT A;  3ISE A;  4MY7 A;  4LQV A;  4RC6 A;  3H7G A;  3F38 A;  1EUM A;  1JI4 A;  3RE7 A;  2ZG8 X;  1IES A;  5LG8 A;  4EVB A;  3R2O A;  3RD0 A;  3ISF A;  5LBH A;  1Z6O A;  2ZUR X;  5ERK A;  3PZA A;  2FL0 A;  3WNW A;  1Z6O M;  2FJC A;  3NP2 X;  3T9J A;  1BCF A;  1VEL A;  5FEJ A;  4YKH A;  3GVY A;  3TA8 A;  4DE6 A;  2D5K A;  3KA6 A;  1XZ1 A;  1YV1 A;  2RBD A;  4LQH A;  3KWO A;  3O7R A;  1JGC A;  4ETR A;  4ZMC A;  3VNX A;  1HRS A;  2JD6 0;  5AXS A;  2G4H A;  3AK8 A;  1RCD A;  5FFA A;  4LPJ A;  2XGW A;  4LYU A;  4CVR A;  1MOJ A;  2C2F A;  5CZU A;  1F30 A;  3AF8 X;  3R2L A;  4CY9 A;  4TOG A;  4PGK A;  4ZKX A;  4IWK A;  3KA4 A;  2Z5R A;  2W0O A;  1VJX A;  5CMQ A;  4CYA A;  4XGS A;  2CLU A;  1UMN A;  2OH3 A;  5JKL A;  3PVT B;  5C6F A;  3KXU A;  5D8Y A;  4XKU A;  5JKL G;  2QQY A;  5LG2 A;  2V2J A;  2YJK A;  2X17 0;  1ZS3 A;  2ZG7 X;  1DVB A;  2ZA7 A;  2FZF A;  4M35 A;  4LYX A;  1L8I A;  3UNO A;  5E2D A;  2CN6 A;  2YW7 A;  2CF7 A;  4DAS A;  4TOF A;  1VEI A;  3BKN A;  4ZKW A;  5I4J A;  1TK6 A;  4TOC A;  4TOA A;  5K52 A;  4REU A;  3PWQ A;  4DYZ A;  4ISP A;  3F37 A;  4KVR A;  2C2J A;  3E6S A;  2IU2 A;  4ZL5 A;  1BG7 A;  2IB0 A;  3E1N A;  1J30 A;  2WLU A;  5K53 A;  3KX9 A;  5LS9 A;  3PVR B;  2YW6 A;  1JI5 A;  1DPS A;  3PVT A;  1LKM A;  2C2U A;  4M32 A;  3OJ5 A;  5JKM A;  5FFC A;  1TKO A;  5E1U A;  2CLB A;  3PW8 A;  3PWF A;  2BKC A;  4AM5 A;  3GHQ A;  1ZUJ A;  2V2L A;  1H96 A;  2HR5 A;  3Q4R A;  5JKM G;  4R42 A;  3WVV A;  3BVI A;  2ZG9 X;  3MPS A;  3Q4Q A;  2GYD A;  2C41 A;  1JYB A;  5D8X A;  1O9I A;  3KA9 A;  3AF7 X;  2FKZ A;  1R03 A;  1L8H A;  4TOD A;  4M33 A;  2VZB A;  2XJM A;  3A9Q A;  2ITB A;  1B71 A;  3PVR A;  2FG8 A;  2FHA A;  5GU3 X;  2BK6 A;  1DAT A;  2V2P A;  1S3Q A;  5FFB A;  1JTS A;  5HQO A;  4MKU A;  3EGM A;  3R2M A;  4PG1 A;  4RC5 B;  1RCC A;  2XJN A;  2FG4 A;  3Q4N A;  4QUW A;  2Y3Q A;  4Z3B A;  4ZKH A;  5FFD A;  3U90 A;  4AM4 A;  4OYN A;  4MJY A;  2XJO A;  1JKV A;  4XKS A;  2QF9 A;  2PYB A;  3PW1 B;  3PVY B;  3E1O A;  3AK9 A;  1UVH A;  3E1P A;  3O7S A;  4ZTT A;  2BW1 A;  1N1Q A;  4EVC A;  1TJO A;  3PWQ C;  2FFX J;  3WVU A;  3KA8 A;  4ITT A;  1SQ3 A;  3WVW A;  4KVQ A;  1JRE A;  4ZL6 A;  3FSE A;  5HJF A;  4TOB A;  5D8S A;  4CVS A;  2ZA6 A;  3QVD A;  4LQJ A;  3UOF A;  2JD8 0;  3QB9 A;  4LQN A;  1S2Z A;  3F39 A;  1RCI A;  1IER A;  2ZA8 A;  4P18 A;  4RC8 A;  4EVE A;  5J8S A;  4E6K A;  4RC5 A;  2V15 A;  1NNQ A;  2V2R A;  3FVB A;  3GE4 A;  2Z5Q A;  3PW8 C;  5FFE A;  3HL1 A;  4TOH A;  3AJP A;  1OTK A;  3RGD A;  3NOZ X;  1YUX A;  3NP0 X;  3R2R A;  4DI0 A;  3FI6 A;  3AF9 X;  1S30 A;  4ERU A;  1RYT A;  1AEW A;  4MN9 A;  5ERJ A;  3SE1 A;  4DYX A;  3QHB A;  3RAV A;  3RBC A;  3PVY A;  2IY4 A;  3PW1 A;  5CMR A;  4CYB A;  2C6R A;  3UOI A;  1KRQ A;  1RCE A;  1Z4A A;  2Z6M A;  4PG0 A;  4ML5 A;  1RCG A;  2V2M A;  3E1L A;  3HIU A;  3E1Q A;  1YUZ A;  1JKU A;  1BFR A;  3SHX A;  1NFV A;  2V2O A;  4Y08 A;  4CVT A;  3BVL A;  3EZU A;  5GU1 X;  4PGI A;  3A68 A;  4TOE A;  3F35 A;  1XZ3 A;  1FHA A;  3E1J A;  1LB3 A;  3SID A;  2UX1 A;  1LKO A;  3AJO A;  2WLA A;  1JIG A;  5JAC A;  3QZ3 A;  1O9R A;  1QGH A;  3BVF A;  4DZ0 A;  5D8O A;  1VLG A;  5IX6 A;  1SOF A;  3R2S A;  4KVS A;  3F33 A;  2GYQ A;  5J8W A; 
#chains in the Genus database with same CATH topology
 2WTL A;  5J93 A;  3BVK A;  1MFR A;  5GN8 A;  4W4L B;  4A25 A;  4AM2 A;  2F7N A;  5GU0 X;  3OGH A;  2YJJ A;  4CVP A;  5D8Q A;  4U3G A;  3BVE A;  1NF6 A;  2GS4 A;  5D8R A;  3E6R A;  4ZLW A;  4II4 B;  2VXI A;  3AJQ A;  3C1Y A;  4LPN A;  4RC7 B;  3Q4O A;  2BJY A;  4MUD A;  3IS7 A;  2V2N A;  3D19 A;  5GU2 X;  3BT5 A;  1TKP A;  2Z5P A;  5D8P A;  3SH6 A;  2XKQ A;  3QD8 A;  3KA3 A;  2CHI A;  4ZJK A;  3JZA B;  1GWG A;  4IXK A;  3QHC A;  4TO9 A;  3GGY A;  2V2S A;  3ES3 A;  5GOU A;  5HJH A;  4RC6 B;  3W54 A;  3ERZ A;  4IWJ A;  2Z90 A;  1LKP A;  4M34 A;  3EZ0 A;  3E2C A;  4Z5S A;  2HTN A;  3L0M A;  4DYU A;  3F34 A;  5HU6 D;  4X0J A;  1QYB A;  4EVD A;  2OC5 A;  3M6J A;  3F32 A;  4II4 A;  2VXX A;  3FRR A;  4RC7 A;  2OKC A;  2JD7 0;  3IS8 A;  4LPM A;  2CHP A;  4ISM A;  1F33 A;  2CIH A;  3E1M A;  4CMY V;  3F36 A;  2V2I A;  4CMY A;  5GN8 B;  3R2K A;  3R2H A;  1NF4 A;  4YXJ A;  2V8T A;  2CEI A;  1VEQ A;  3IQ1 A;  5J9V A;  4ITW A;  4TW3 A;  2CN7 A;  4DYY A;  4XKT A;  3ISE A;  4MY7 A;  4LQV A;  4RC6 A;  3H7G A;  3F38 A;  1EUM A;  1JI4 A;  3RE7 A;  2ZG8 X;  1IES A;  5LG8 A;  4EVB A;  3R2O A;  3RD0 A;  3ISF A;  5LBH A;  1Z6O A;  2ZUR X;  5ERK A;  3PZA A;  2FL0 A;  3WNW A;  1Z6O M;  2FJC A;  3NP2 X;  3T9J A;  1BCF A;  1VEL A;  5FEJ A;  4YKH A;  3GVY A;  3TA8 A;  4DE6 A;  2D5K A;  3KA6 A;  1XZ1 A;  1YV1 A;  2RBD A;  4LQH A;  3KWO A;  3O7R A;  1JGC A;  4ETR A;  4ZMC A;  3V3K B;  3VNX A;  1HRS A;  2JD6 0;  5AXS A;  2G4H A;  3AK8 A;  1RCD A;  5FFA A;  4LPJ A;  2XGW A;  4LYU A;  4CVR A;  4WJG 4;  1MOJ A;  2C2F A;  5CZU A;  1F30 A;  3AF8 X;  3R2L A;  4CY9 A;  4TOG A;  4PGK A;  4ZKX A;  4IWK A;  3KA4 A;  2Z5R A;  2W0O A;  1VJX A;  5CMQ A;  4CYA A;  4XGS A;  2CLU A;  1UMN A;  2OH3 A;  5JKL A;  3KDQ A;  3PVT B;  5C6F A;  3KXU A;  5D8Y A;  4XKU A;  5JKL G;  2QQY A;  5LG2 A;  4W4K B;  2V2J A;  2YJK A;  2X17 0;  1ZS3 A;  2ZG7 X;  1DVB A;  2ZA7 A;  2FZF A;  4M35 A;  4LYX A;  1L8I A;  2N02 A;  3UNO A;  5E2D A;  2CN6 A;  2CWL A;  2YW7 A;  3C23 A;  2CF7 A;  4DAS A;  4TOF A;  1VEI A;  3BKN A;  4ZKW A;  5I4J A;  1TK6 A;  4TOC A;  4TOA A;  5K52 A;  4KXR B;  4REU A;  3PWQ A;  4DYZ A;  4ISP A;  3F37 A;  4YXM A;  4KVR A;  2C2J A;  3E6S A;  2IU2 A;  4ZL5 A;  1BG7 A;  2IB0 A;  3E1N A;  1J30 A;  2WLU A;  5K53 A;  3KX9 A;  5JDO B;  5LS9 A;  3PVR B;  2AR0 A;  2YW6 A;  3KHK A;  1JI5 A;  1DPS A;  3PVT A;  1LKM A;  2C2U A;  4M32 A;  3OJ5 A;  5JKM A;  5FFC A;  1TKO A;  5E1U A;  3VV9 A;  2CLB A;  3PW8 A;  3PWF A;  3JZ9 A;  2BKC A;  4AM5 A;  3GHQ A;  1ZUJ A;  2V2L A;  1H96 A;  2HR5 A;  3Q4R A;  5JKM G;  4R42 A;  3WVV A;  3BVI A;  2ZG9 X;  3MPS A;  3Q4Q A;  2GYD A;  2C41 A;  1JYB A;  2G38 B;  5D8X A;  1O9I A;  3KA9 A;  3AF7 X;  2Y44 A;  2FKZ A;  3FRS A;  1R03 A;  1L8H A;  4TOD A;  4M33 A;  2VZB A;  2WWX B;  5JDO A;  2XJM A;  3A9Q A;  2ITB A;  1B71 A;  3PVR A;  2FG8 A;  2FHA A;  5GU3 X;  2BK6 A;  1DAT A;  2V2P A;  3UFB A;  1S3Q A;  5FFB A;  1JTS A;  5HQO A;  4MKU A;  3EGM A;  3R2M A;  4PG1 A;  4RC5 B;  1RCC A;  2XJN A;  2FG4 A;  3Q4N A;  4QUW A;  2Y3Q A;  4Z3B A;  4ZKH A;  5FFD A;  3U90 A;  4AM4 A;  4OYN A;  4MJY A;  3VVA A;  2XJO A;  1JKV A;  4XKS A;  2QF9 A;  2PYB A;  3PW1 B;  3PVY B;  3E1O A;  3AK9 A;  1UVH A;  3E1P A;  3O7S A;  4ZTT A;  2BW1 A;  1N1Q A;  4EVC A;  1TJO A;  3C21 A;  3PWQ C;  2FFX J;  3WVU A;  3KA8 A;  4ITT A;  1SQ3 A;  3WVW A;  4KVQ A;  1JRE A;  4ZL6 A;  3FSE A;  5HJF A;  4TOB A;  5D8S A;  4CVS A;  2ZA6 A;  3QVD A;  4LQJ A;  3UOF A;  2JD8 0;  3QB9 A;  4LQN A;  1S2Z A;  3F39 A;  1RCI A;  1IER A;  2ZA8 A;  4P18 A;  4RC8 A;  4EVE A;  5J8S A;  3N6O A;  4E6K A;  4RC5 A;  2V15 A;  1NNQ A;  2V2R A;  3FVB A;  3GE4 A;  2Z5Q A;  3PW8 C;  5FFE A;  3HL1 A;  4TOH A;  3AJP A;  1OTK A;  3RGD A;  3NOZ X;  1YUX A;  3GGZ A;  3NP0 X;  3R2R A;  4DI0 A;  4YVZ A;  3FI6 A;  3AF9 X;  1S30 A;  2MGY A;  4ERU A;  1RYT A;  1AEW A;  4MN9 A;  5ERJ A;  3SE1 A;  4DYX A;  3QHB A;  3RAV A;  3RBC A;  3C1Z A;  3PVY A;  2IY4 A;  3PW1 A;  5CMR A;  4CYB A;  2C6R A;  3LKD A;  3UOI A;  1KRQ A;  4E40 A;  1RCE A;  1Z4A A;  2Z6M A;  4PG0 A;  4ML5 A;  1RCG A;  2V2M A;  3E1L A;  2V8U A;  3HIU A;  3E1Q A;  1YUZ A;  1JKU A;  1BFR A;  3SHX A;  1NFV A;  2V2O A;  4Y08 A;  4CVT A;  3BVL A;  3EZU A;  5GU1 X;  4PGI A;  3A68 A;  4TOE A;  3F35 A;  1XZ3 A;  1FHA A;  3E1J A;  3DBY A;  1LB3 A;  3SID A;  2UX1 A;  1LKO A;  3AJO A;  4MXP A;  2WLA A;  1JIG A;  5JAC A;  3QZ3 A;  1O9R A;  1QGH A;  3BVF A;  4DZ0 A;  5D8O A;  1VLG A;  5IX6 A;  1SOF A;  3R2S A;  4KVS A;  3F33 A;  2GYQ A;  5J8W A; 
#chains in the Genus database with same CATH homology
 2WTL A;  5J93 A;  3BVK A;  1MFR A;  5GN8 A;  4W4L B;  4A25 A;  4AM2 A;  2F7N A;  5GU0 X;  3OGH A;  2YJJ A;  4CVP A;  5D8Q A;  4U3G A;  3BVE A;  1NF6 A;  2GS4 A;  5D8R A;  3E6R A;  4ZLW A;  4II4 B;  2VXI A;  3AJQ A;  3C1Y A;  4LPN A;  4RC7 B;  3Q4O A;  2BJY A;  4MUD A;  3IS7 A;  2V2N A;  3D19 A;  5GU2 X;  3BT5 A;  1TKP A;  2Z5P A;  5D8P A;  3SH6 A;  2XKQ A;  3QD8 A;  3KA3 A;  2CHI A;  4ZJK A;  3JZA B;  1GWG A;  4IXK A;  3QHC A;  4TO9 A;  3GGY A;  2V2S A;  3ES3 A;  5GOU A;  5HJH A;  4RC6 B;  3W54 A;  3ERZ A;  4IWJ A;  2Z90 A;  1LKP A;  4M34 A;  3EZ0 A;  3E2C A;  4Z5S A;  2HTN A;  3L0M A;  4DYU A;  3F34 A;  5HU6 D;  4X0J A;  1QYB A;  4EVD A;  2OC5 A;  3M6J A;  3F32 A;  4II4 A;  2VXX A;  3FRR A;  4RC7 A;  2OKC A;  2JD7 0;  3IS8 A;  4LPM A;  2CHP A;  4ISM A;  1F33 A;  2CIH A;  3E1M A;  4CMY V;  3F36 A;  2V2I A;  4CMY A;  5GN8 B;  3R2K A;  3R2H A;  1NF4 A;  4YXJ A;  2V8T A;  2CEI A;  1VEQ A;  3IQ1 A;  5J9V A;  4ITW A;  4TW3 A;  2CN7 A;  4DYY A;  4XKT A;  3ISE A;  4MY7 A;  4LQV A;  4RC6 A;  3H7G A;  3F38 A;  1EUM A;  1JI4 A;  3RE7 A;  2ZG8 X;  1IES A;  5LG8 A;  4EVB A;  3R2O A;  3RD0 A;  3ISF A;  5LBH A;  1Z6O A;  2ZUR X;  5ERK A;  3PZA A;  2FL0 A;  3WNW A;  1Z6O M;  2FJC A;  3NP2 X;  3T9J A;  1BCF A;  1VEL A;  5FEJ A;  4YKH A;  3GVY A;  3TA8 A;  4DE6 A;  2D5K A;  3KA6 A;  1XZ1 A;  1YV1 A;  2RBD A;  4LQH A;  3KWO A;  3O7R A;  1JGC A;  4ETR A;  4ZMC A;  3V3K B;  3VNX A;  1HRS A;  2JD6 0;  5AXS A;  2G4H A;  3AK8 A;  1RCD A;  5FFA A;  4LPJ A;  2XGW A;  4LYU A;  4CVR A;  4WJG 4;  1MOJ A;  2C2F A;  5CZU A;  1F30 A;  3AF8 X;  3R2L A;  4CY9 A;  4TOG A;  4PGK A;  4ZKX A;  4IWK A;  3KA4 A;  2Z5R A;  2W0O A;  1VJX A;  5CMQ A;  4CYA A;  4XGS A;  2CLU A;  1UMN A;  2OH3 A;  5JKL A;  3KDQ A;  3PVT B;  5C6F A;  3KXU A;  5D8Y A;  4XKU A;  5JKL G;  2QQY A;  5LG2 A;  4W4K B;  2V2J A;  2YJK A;  2X17 0;  1ZS3 A;  2ZG7 X;  1DVB A;  2ZA7 A;  2FZF A;  4M35 A;  4LYX A;  1L8I A;  2N02 A;  3UNO A;  5E2D A;  2CN6 A;  2CWL A;  2YW7 A;  3C23 A;  2CF7 A;  4DAS A;  4TOF A;  1VEI A;  3BKN A;  4ZKW A;  5I4J A;  1TK6 A;  4TOC A;  4TOA A;  5K52 A;  4KXR B;  4REU A;  3PWQ A;  4DYZ A;  4ISP A;  3F37 A;  4YXM A;  4KVR A;  2C2J A;  3E6S A;  2IU2 A;  4ZL5 A;  1BG7 A;  2IB0 A;  3E1N A;  1J30 A;  2WLU A;  5K53 A;  3KX9 A;  5JDO B;  5LS9 A;  3PVR B;  2AR0 A;  2YW6 A;  3KHK A;  1JI5 A;  1DPS A;  3PVT A;  1LKM A;  2C2U A;  4M32 A;  3OJ5 A;  5JKM A;  5FFC A;  1TKO A;  5E1U A;  3VV9 A;  2CLB A;  3PW8 A;  3PWF A;  3JZ9 A;  2BKC A;  4AM5 A;  3GHQ A;  1ZUJ A;  2V2L A;  1H96 A;  2HR5 A;  3Q4R A;  5JKM G;  4R42 A;  3WVV A;  3BVI A;  2ZG9 X;  3MPS A;  3Q4Q A;  2GYD A;  2C41 A;  1JYB A;  2G38 B;  5D8X A;  1O9I A;  3KA9 A;  3AF7 X;  2Y44 A;  2FKZ A;  3FRS A;  1R03 A;  1L8H A;  4TOD A;  4M33 A;  2VZB A;  2WWX B;  5JDO A;  2XJM A;  3A9Q A;  2ITB A;  1B71 A;  3PVR A;  2FG8 A;  2FHA A;  5GU3 X;  2BK6 A;  1DAT A;  2V2P A;  3UFB A;  1S3Q A;  5FFB A;  1JTS A;  5HQO A;  4MKU A;  3EGM A;  3R2M A;  4PG1 A;  4RC5 B;  1RCC A;  2XJN A;  2FG4 A;  3Q4N A;  4QUW A;  2Y3Q A;  4Z3B A;  4ZKH A;  5FFD A;  3U90 A;  4AM4 A;  4OYN A;  4MJY A;  3VVA A;  2XJO A;  1JKV A;  4XKS A;  2QF9 A;  2PYB A;  3PW1 B;  3PVY B;  3E1O A;  3AK9 A;  1UVH A;  3E1P A;  3O7S A;  4ZTT A;  2BW1 A;  1N1Q A;  4EVC A;  1TJO A;  3C21 A;  3PWQ C;  2FFX J;  3WVU A;  3KA8 A;  4ITT A;  1SQ3 A;  3WVW A;  4KVQ A;  1JRE A;  4ZL6 A;  3FSE A;  5HJF A;  4TOB A;  5D8S A;  4CVS A;  2ZA6 A;  3QVD A;  4LQJ A;  3UOF A;  2JD8 0;  3QB9 A;  4LQN A;  1S2Z A;  3F39 A;  1RCI A;  1IER A;  2ZA8 A;  4P18 A;  4RC8 A;  4EVE A;  5J8S A;  3N6O A;  4E6K A;  4RC5 A;  2V15 A;  1NNQ A;  2V2R A;  3FVB A;  3GE4 A;  2Z5Q A;  3PW8 C;  5FFE A;  3HL1 A;  4TOH A;  3AJP A;  1OTK A;  3RGD A;  3NOZ X;  1YUX A;  3GGZ A;  3NP0 X;  3R2R A;  4DI0 A;  4YVZ A;  3FI6 A;  3AF9 X;  1S30 A;  2MGY A;  4ERU A;  1RYT A;  1AEW A;  4MN9 A;  5ERJ A;  3SE1 A;  4DYX A;  3QHB A;  3RAV A;  3RBC A;  3C1Z A;  3PVY A;  2IY4 A;  3PW1 A;  5CMR A;  4CYB A;  2C6R A;  3LKD A;  3UOI A;  1KRQ A;  4E40 A;  1RCE A;  1Z4A A;  2Z6M A;  4PG0 A;  4ML5 A;  1RCG A;  2V2M A;  3E1L A;  2V8U A;  3HIU A;  3E1Q A;  1YUZ A;  1JKU A;  1BFR A;  3SHX A;  1NFV A;  2V2O A;  4Y08 A;  4CVT A;  3BVL A;  3EZU A;  5GU1 X;  4PGI A;  3A68 A;  4TOE A;  3F35 A;  1XZ3 A;  1FHA A;  3E1J A;  3DBY A;  1LB3 A;  3SID A;  2UX1 A;  1LKO A;  3AJO A;  4MXP A;  2WLA A;  1JIG A;  5JAC A;  3QZ3 A;  1O9R A;  1QGH A;  3BVF A;  4DZ0 A;  5D8O A;  1VLG A;  5IX6 A;  1SOF A;  3R2S A;  4KVS A;  3F33 A;  2GYQ A;  5J8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...