2X170

The x-ray structure of ferritin from pyrococcus furiosus loaded with ag(i)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
171
structure length
171
Chain Sequence
MLSERMLKALNDQLNRELYSAYLYFAMAAYFEDLGLEGFANWMKAQAEEEIGHALRFYNYIYDRNGRVELDEIPKPPKEWESPLKAFEAAYEHEKFISKSIYELAALAEEEKDYSTRAFLEWFINEQVEEEASVKKILDKLKFAKDSPQILFMLDKELSARAPKLPGLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords PUTATIVE FERRITIN HOMOLOG
publication title Silver Ion Incorporation and Nanoparticle Formation Inside the Cavity of Pyrococcus Furiosus Ferritin: Structural and Size-Distribution Analyses.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 65
structure length 171
sequence length 171
chains with identical sequence 1, 2, 3, 4, 5, 6, 7, 8, 9, G, H, I, J, K, L, M, N, O, P, Q, R, Y, Z
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2x17000
2C2JA 4CY9A 1JKVA 3PWFA 5FFBA 3PW1B 2FL0A 3PVTB 4R42A 3E1OA 2RBDA 3KA3A 4U3GA 4CVPA 1LKPA 3E1MA 3QZ3A 4LPJA 5D8QA 1SOFA 1DVBA 1YUXA 2QQYA 5LG2A 5LS9A 5GU1X 4E6KA 1S2ZA 3R2SA 4ZLWA 2W0OA 1KRQA 3NOZX 3PVYA 3OJ5A 4XKTA 3PZAA 2WLUA 4DZ0A 1LKMA 5K52A 4TOCA 2FJCA 3F39A 3UNOA 3OGHA 1TKPA 5JKMG 3E1JA 5D8YA 2C6RA 2D5KA 2YJKA 1BCFA 3F33A 1DPSA 2CLUA 3QB9A 5HQOA 2Z5PA 2OC5A 2FG8A 5JKMA 2ZURX 4TOAA 5D8OA 4CMYA 4Z5SA 4TOEA 2BK6A 3BKNA 3AK9A 2ZG7X 3H7GA 1JKUA 3IS8A 5IX6A 1Z6OA 4CVTA 1S30A 4CMYV 3O7SA 2FZFA 3PVRB 5E2DA 5C6FA 4ZKHA 5K53A 1BFRA 2X170 3EGMA 4MY7A 5I4JA 2YW6A 1VEQA 1OTKA 3BVIA 4IWKA 4RC8A 5FEJA 3WVUA 2XJNA 1TJOA 2Z5RA 3HL1A 3PWQA 3BVKA 4PGIA 4Y08A 2V15A 4TO9A 3R2KA 2G4HA 2C41A 4EVCA 2Z6MA 3BT5A 3VNXA 3AJOA 2BW1A 3E1PA 1L8IA 5CMRA 2HTNA 2IU2A 2BJYA 3BVFA 1ZS3A 1N1QA 2V2JA 1RCIA 2YJJA 1DATA 5AXSA 3NP2X 3E1NA 5D8SA 3E1QA 4IWJA 4KVSA 4EVEA 3R2HA 5ERJA 2C2FA 1O9IA 1XZ1A 4LPMA 3GE4A 4RC5B 4TOGA 4DE6A 4DYZA 1RCEA 3RGDA 2CN7A 2JD60 3MPSA 4RC7A 2CF7A 4IXKA 3KWOA 2JD80 4PG1A 5GN8B 4ZKXA 5CMQA 1J30A 1RCDA 1S3QA 5GU3X 4RC6B 2CHIA 2OH3A 3F36A 5GU0X 2HR5A 3R2RA 4II4B 4TODA 3F34A 4LQNA 1NF6A 1NF4A 1JREA 1QGHA 3WVVA 3ISFA 2V2RA 2PYBA 4ML5A 1Z4AA 5E1UA 3PW1A 2C2UA 4P18A 3PVTA 1MOJA 2ITBA 4RC5A 3PW8C 4MUDA 3WNWA 5CZUA 1VEIA 3UOIA 3F32A 1SQ3A 3FSEA 3AJQA 2VXIA 1LKOA 2WLAA 4ERUA 2XJMA 4TOBA 4PGKA 2FFXJ 1TK6A 2GYQA 4ISMA 2BKCA 1QYBA 3GVYA 3R2LA 3AK8A 2FG4A 3U90A 5JKLA 3GHQA 3AJPA 4LQVA 3SHXA 5LG8A 4XKSA 4ITTA 5LBHA 3BVEA 5J93A 4ZTTA 4M32A 3E1LA 5JACA 1YUZA 4ZJKA 1JIGA 4MJYA 3KA8A 4LYUA 1FHAA 1RCCA 4CYBA 1YV1A 5HJFA 4TOHA 5J8SA 1B71A 1VJXA 3HIUA 2F7NA 3RD0A 3ERZA 3WVWA 4LQJA 4ZKWA 4DI0A 3BVLA 4MKUA 3RBCA 2Z90A 1UMNA 4DYUA 1BG7A 4M33A 1F30A 2ZA7A 3F35A 5J9VA 4OYNA 3KA6A 3PVRA 4EVDA 3E6RA 3RAVA 1XZ3A 3F38A 3IS7A 3KXUA 1MFRA 3SH6A 3ES3A 3O7RA 4YKHA 3SIDA 1L8HA 2CN6A 4AM4A 5D8PA 5FFDA 4DYXA 1VLGA 4EVBA 2ZA8A 2GYDA 1UVHA 2VXXA 3E2CA 2CEIA 3Q4NA 5FFAA 3IQ1A 3SE1A 5J8WA 2V2PA 1RCGA 2FKZA 3A68A 4XKUA 2CHPA 2ZG8X 5D8XA 1R03A 4AM5A 5GOUA 3R2MA 2V2NA 4LQHA 5ERKA 3T9JA 1LB3A 4CYAA 4ZL6A 3PW8A 1H96A 3FI6A 2IB0A 2XKQA 3AF7X 3AF9X 1TKOA 3FVBA 1ZUJA 4ITWA 4KVRA 4AM2A 4Z3BA 3RE7A 3QHCA 2IY4A 4TOFA 3ISEA 5FFCA 4M35A 2XGWA 1JI4A 2CIHA 5JKLG 3EZ0A 4LYXA 3EZUA 3A9QA 5GN8A 4ZMCA 4PG0A 3QD8A 2FHAA 1F33A 4DASA 1IESA 1NNQA 4RC6A 3Q4QA 2V2SA 3TA8A 3UOFA 1Z6OM 1O9RA 2YW7A 2V2LA 4CVSA 2Y3QA 4II4A 2VZBA 1GWGA 2V2OA 1NFVA 3KA9A 3Q4RA 3F37A 3QVDA 2GS4A 3QHBA 1VELA 2UX1A 2ZG9X 2V2MA 3NP0X 1AEWA 4QUWA 4DYYA 1JGCA 4RC7B 1HRSA 4MN9A 1RYTA 2Z5QA 4XGSA 2CLBA 5D8RA 5HJHA 2XJOA 2ZA6A 1JTSA 1EUMA 4ISPA 3AF8X 3E6SA 3PWQC 4KVQA 2QF9A 3Q4OA 2JD70 1JYBA 2V2IA 4TW3A 3PVYB 4ETRA 1IERA 3R2OA 4LPNA 5GU2X 4A25A 2WTLA 4M34A 4ZL5A 4REUA 4CVRA 1JI5A 5FFEA 3KA4A 3KX9A
chains in the Genus database with same CATH superfamily
5HU6D 2C2JA 4CY9A 1JKVA 3PWFA 5FFBA 2V8UA 3PW1B 2FL0A 3PVTB 4R42A 3E1OA 2RBDA 3KA3A 4U3GA 4CVPA 1LKPA 3E1MA 3QZ3A 4W4LB 4LPJA 5D8QA 1SOFA 1DVBA 1YUXA 2QQYA 5LG2A 5LS9A 5GU1X 4E6KA 1S2ZA 3R2SA 4ZLWA 2W0OA 1KRQA 3NOZX 3PVYA 3OJ5A 4XKTA 3PZAA 2WLUA 4DZ0A 1LKMA 5K52A 5JDOB 4TOCA 2FJCA 3F39A 3UNOA 3OGHA 1TKPA 5JKMG 3E1JA 5D8YA 2C6RA 2D5KA 2YJKA 1BCFA 3F33A 1DPSA 2CLUA 3QB9A 5HQOA 2Z5PA 2OC5A 2FG8A 5JKMA 2ZURX 4TOAA 5D8OA 4CMYA 4Z5SA 4TOEA 2BK6A 3BKNA 3AK9A 2ZG7X 3H7GA 1JKUA 3FRRA 3IS8A 5IX6A 1Z6OA 4CVTA 1S30A 4CMYV 3O7SA 2FZFA 3PVRB 5E2DA 5C6FA 4ZKHA 5K53A 1BFRA 2X170 3EGMA 3C1YA 4MY7A 5I4JA 2YW6A 1VEQA 4WJG4 5JDOA 1OTKA 3BVIA 4IWKA 4RC8A 5FEJA 3WVUA 2XJNA 1TJOA 2Z5RA 3HL1A 3PWQA 3BVKA 4PGIA 4Y08A 2V15A 4TO9A 3R2KA 2G4HA 2C41A 4EVCA 2Z6MA 3BT5A 3VNXA 3AJOA 2BW1A 3E1PA 1L8IA 5CMRA 2HTNA 3GGYA 2IU2A 2BJYA 3BVFA 1ZS3A 1N1QA 3FRSA 2V2JA 1RCIA 2YJJA 1DATA 5AXSA 3NP2X 2N02A 3E1NA 5D8SA 3GGZA 3E1QA 4IWJA 4KVSA 4EVEA 3R2HA 5ERJA 2C2FA 1O9IA 1XZ1A 4LPMA 3GE4A 4RC5B 4TOGA 4DE6A 4DYZA 1RCEA 3RGDA 2CN7A 2JD60 3MPSA 4RC7A 2CF7A 3C1ZA 4IXKA 3KWOA 2JD80 4PG1A 5GN8B 4ZKXA 4YXJA 5CMQA 1J30A 1RCDA 1S3QA 3D19A 3JZAB 3VV9A 5GU3X 4RC6B 2CHIA 2OH3A 3F36A 5GU0X 2HR5A 3R2RA 4II4B 4TODA 3F34A 4LQNA 1NF6A 1NF4A 1JREA 1QGHA 3WVVA 3ISFA 2V2RA 2PYBA 4ML5A 3KDQA 1Z4AA 5E1UA 3PW1A 2C2UA 4P18A 3PVTA 1MOJA 2ITBA 4RC5A 3PW8C 4MUDA 3C21A 3WNWA 5CZUA 1VEIA 3UOIA 3F32A 1SQ3A 3FSEA 3AJQA 2VXIA 1LKOA 2WLAA 4ERUA 2XJMA 4TOBA 4PGKA 2FFXJ 1TK6A 2GYQA 4ISMA 2BKCA 1QYBA 3GVYA 3R2LA 3AK8A 2FG4A 3U90A 5JKLA 3GHQA 3AJPA 4LQVA 3SHXA 5LG8A 4XKSA 4ITTA 4X0JA 5LBHA 3BVEA 5J93A 4ZTTA 4M32A 3E1LA 5JACA 1YUZA 4ZJKA 1JIGA 4MJYA 3KA8A 4LYUA 3N6OA 1FHAA 1RCCA 4CYBA 1YV1A 5HJFA 4TOHA 3LKDA 5J8SA 1B71A 1VJXA 3HIUA 2F7NA 3RD0A 3ERZA 3WVWA 4LQJA 4ZKWA 4DI0A 3BVLA 2AR0A 4MKUA 3RBCA 2Z90A 1UMNA 4DYUA 1BG7A 4M33A 1F30A 2ZA7A 3F35A 4E40A 5J9VA 4OYNA 3KA6A 3PVRA 4EVDA 3E6RA 3RAVA 1XZ3A 3F38A 3IS7A 3KXUA 1MFRA 3SH6A 3ES3A 3O7RA 4YKHA 3SIDA 1L8HA 2CN6A 2V8TA 4YVZA 4AM4A 4KXRB 5D8PA 5FFDA 4DYXA 1VLGA 4EVBA 2ZA8A 2GYDA 1UVHA 4MXPA 2VXXA 3E2CA 3M6JA 2CEIA 3Q4NA 5FFAA 3IQ1A 3SE1A 2CWLA 5J8WA 2V2PA 1RCGA 2FKZA 3A68A 4XKUA 2CHPA 2ZG8X 5D8XA 1R03A 4AM5A 2MGYA 5GOUA 3R2MA 3JZ9A 2V2NA 4LQHA 5ERKA 3T9JA 1LB3A 4CYAA 4ZL6A 3PW8A 3C23A 1H96A 3FI6A 2IB0A 2XKQA 3AF7X 3AF9X 1TKOA 3FVBA 1ZUJA 4ITWA 4KVRA 4AM2A 4Z3BA 3RE7A 3QHCA 2IY4A 4TOFA 3ISEA 5FFCA 2OKCA 4M35A 2XGWA 3L0MA 2Y44A 1JI4A 2CIHA 5JKLG 3EZ0A 4LYXA 2G38B 3EZUA 3A9QA 5GN8A 4ZMCA 4W4KB 4PG0A 3QD8A 2FHAA 1F33A 4DASA 1IESA 1NNQA 4RC6A 3Q4QA 2V2SA 3TA8A 3UOFA 1Z6OM 3KHKA 1O9RA 2YW7A 2V2LA 4CVSA 2Y3QA 4II4A 2VZBA 1GWGA 3V3KB 2V2OA 1NFVA 3KA9A 3Q4RA 3VVAA 3F37A 3QVDA 2GS4A 3QHBA 1VELA 2UX1A 2ZG9X 2V2MA 3NP0X 1AEWA 4QUWA 3DBYA 4DYYA 1JGCA 4RC7B 1HRSA 4MN9A 1RYTA 3UFBA 2Z5QA 4XGSA 2CLBA 5D8RA 5HJHA 2XJOA 2ZA6A 3W54A 1JTSA 1EUMA 4ISPA 3AF8X 3E6SA 3PWQC 4KVQA 2QF9A 3Q4OA 2WWXB 2JD70 1JYBA 2V2IA 4TW3A 3PVYB 4ETRA 1IERA 3R2OA 4LPNA 5GU2X 4A25A 2WTLA 4M34A 4ZL5A 4REUA 4YXMA 4CVRA 1JI5A 5FFEA 3KA4A 3KX9A
chains in the Genus database with same CATH topology
5HU6D 2C2JA 4CY9A 1JKVA 3PWFA 5FFBA 2V8UA 3PW1B 2FL0A 3PVTB 4R42A 3E1OA 2RBDA 3KA3A 4U3GA 4CVPA 1LKPA 3E1MA 3QZ3A 4W4LB 4LPJA 5D8QA 1SOFA 1DVBA 1YUXA 2QQYA 5LG2A 5LS9A 5GU1X 4E6KA 1S2ZA 3R2SA 4ZLWA 2W0OA 1KRQA 3NOZX 3PVYA 3OJ5A 4XKTA 3PZAA 2WLUA 4DZ0A 1LKMA 5K52A 5JDOB 4TOCA 2FJCA 3F39A 3UNOA 3OGHA 1TKPA 5JKMG 3E1JA 5D8YA 2C6RA 2D5KA 2YJKA 1BCFA 3F33A 1DPSA 2CLUA 3QB9A 5HQOA 2Z5PA 2OC5A 2FG8A 5JKMA 2ZURX 4TOAA 5D8OA 4CMYA 4Z5SA 4TOEA 2BK6A 3BKNA 3AK9A 2ZG7X 3H7GA 1JKUA 3FRRA 3IS8A 5IX6A 1Z6OA 4CVTA 1S30A 4CMYV 3O7SA 2FZFA 3PVRB 5E2DA 5C6FA 4ZKHA 5K53A 1BFRA 2X170 3EGMA 3C1YA 4MY7A 5I4JA 2YW6A 1VEQA 4WJG4 5JDOA 1OTKA 3BVIA 4IWKA 4RC8A 5FEJA 3WVUA 2XJNA 1TJOA 2Z5RA 3HL1A 3PWQA 3BVKA 4PGIA 4Y08A 2V15A 4TO9A 3R2KA 2G4HA 2C41A 4EVCA 2Z6MA 3BT5A 3VNXA 3AJOA 2BW1A 3E1PA 1L8IA 5CMRA 2HTNA 3GGYA 2IU2A 2BJYA 3BVFA 1ZS3A 1N1QA 3FRSA 2V2JA 1RCIA 2YJJA 1DATA 5AXSA 3NP2X 2N02A 3E1NA 5D8SA 3GGZA 3E1QA 4IWJA 4KVSA 4EVEA 3R2HA 5ERJA 2C2FA 1O9IA 1XZ1A 4LPMA 3GE4A 4RC5B 4TOGA 4DE6A 4DYZA 1RCEA 3RGDA 2CN7A 2JD60 3MPSA 4RC7A 2CF7A 3C1ZA 4IXKA 3KWOA 2JD80 4PG1A 5GN8B 4ZKXA 4YXJA 5CMQA 1J30A 1RCDA 1S3QA 3D19A 3JZAB 3VV9A 5GU3X 4RC6B 2CHIA 2OH3A 3F36A 5GU0X 2HR5A 3R2RA 4II4B 4TODA 3F34A 4LQNA 1NF6A 1NF4A 1JREA 1QGHA 3WVVA 3ISFA 2V2RA 2PYBA 4ML5A 3KDQA 1Z4AA 5E1UA 3PW1A 2C2UA 4P18A 3PVTA 1MOJA 2ITBA 4RC5A 3PW8C 4MUDA 3C21A 3WNWA 5CZUA 1VEIA 3UOIA 3F32A 1SQ3A 3FSEA 3AJQA 2VXIA 1LKOA 2WLAA 4ERUA 2XJMA 4TOBA 4PGKA 2FFXJ 1TK6A 2GYQA 4ISMA 2BKCA 1QYBA 3GVYA 3R2LA 3AK8A 2FG4A 3U90A 5JKLA 3GHQA 3AJPA 4LQVA 3SHXA 5LG8A 4XKSA 4ITTA 4X0JA 5LBHA 3BVEA 5J93A 4ZTTA 4M32A 3E1LA 5JACA 1YUZA 4ZJKA 1JIGA 4MJYA 3KA8A 4LYUA 3N6OA 1FHAA 1RCCA 4CYBA 1YV1A 5HJFA 4TOHA 3LKDA 5J8SA 1B71A 1VJXA 3HIUA 2F7NA 3RD0A 3ERZA 3WVWA 4LQJA 4ZKWA 4DI0A 3BVLA 2AR0A 4MKUA 3RBCA 2Z90A 1UMNA 4DYUA 1BG7A 4M33A 1F30A 2ZA7A 3F35A 4E40A 5J9VA 4OYNA 3KA6A 3PVRA 4EVDA 3E6RA 3RAVA 1XZ3A 3F38A 3IS7A 3KXUA 1MFRA 3SH6A 3ES3A 3O7RA 4YKHA 3SIDA 1L8HA 2CN6A 2V8TA 4YVZA 4AM4A 4KXRB 5D8PA 5FFDA 4DYXA 1VLGA 4EVBA 2ZA8A 2GYDA 1UVHA 4MXPA 2VXXA 3E2CA 3M6JA 2CEIA 3Q4NA 5FFAA 3IQ1A 3SE1A 2CWLA 5J8WA 2V2PA 1RCGA 2FKZA 3A68A 4XKUA 2CHPA 2ZG8X 5D8XA 1R03A 4AM5A 2MGYA 5GOUA 3R2MA 3JZ9A 2V2NA 4LQHA 5ERKA 3T9JA 1LB3A 4CYAA 4ZL6A 3PW8A 3C23A 1H96A 3FI6A 2IB0A 2XKQA 3AF7X 3AF9X 1TKOA 3FVBA 1ZUJA 4ITWA 4KVRA 4AM2A 4Z3BA 3RE7A 3QHCA 2IY4A 4TOFA 3ISEA 5FFCA 2OKCA 4M35A 2XGWA 3L0MA 2Y44A 1JI4A 2CIHA 5JKLG 3EZ0A 4LYXA 2G38B 3EZUA 3A9QA 5GN8A 4ZMCA 4W4KB 4PG0A 3QD8A 2FHAA 1F33A 4DASA 1IESA 1NNQA 4RC6A 3Q4QA 2V2SA 3TA8A 3UOFA 1Z6OM 3KHKA 1O9RA 2YW7A 2V2LA 4CVSA 2Y3QA 4II4A 2VZBA 1GWGA 3V3KB 2V2OA 1NFVA 3KA9A 3Q4RA 3VVAA 3F37A 3QVDA 2GS4A 3QHBA 1VELA 2UX1A 2ZG9X 2V2MA 3NP0X 1AEWA 4QUWA 3DBYA 4DYYA 1JGCA 4RC7B 1HRSA 4MN9A 1RYTA 3UFBA 2Z5QA 4XGSA 2CLBA 5D8RA 5HJHA 2XJOA 2ZA6A 3W54A 1JTSA 1EUMA 4ISPA 3AF8X 3E6SA 3PWQC 4KVQA 2QF9A 3Q4OA 2WWXB 2JD70 1JYBA 2V2IA 4TW3A 3PVYB 4ETRA 1IERA 3R2OA 4LPNA 5GU2X 4A25A 2WTLA 4M34A 4ZL5A 4REUA 4YXMA 4CVRA 1JI5A 5FFEA 3KA4A 3KX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2J A;  4CY9 A;  1JKV A;  3PWF A;  5FFB A;  3PW1 B;  2FL0 A;  3PVT B;  4R42 A;  3E1O A;  2RBD A;  3KA3 A;  4U3G A;  4CVP A;  1LKP A;  3E1M A;  3QZ3 A;  4LPJ A;  5D8Q A;  1SOF A;  1DVB A;  1YUX A;  2QQY A;  5LG2 A;  5LS9 A;  5GU1 X;  4E6K A;  1S2Z A;  3R2S A;  4ZLW A;  2W0O A;  1KRQ A;  3NOZ X;  3PVY A;  3OJ5 A;  4XKT A;  3PZA A;  2WLU A;  4DZ0 A;  1LKM A;  5K52 A;  4TOC A;  2FJC A;  3F39 A;  3UNO A;  3OGH A;  1TKP A;  5JKM G;  3E1J A;  5D8Y A;  2C6R A;  2D5K A;  2YJK A;  1BCF A;  3F33 A;  1DPS A;  2CLU A;  3QB9 A;  5HQO A;  2Z5P A;  2OC5 A;  2FG8 A;  5JKM A;  2ZUR X;  4TOA A;  5D8O A;  4CMY A;  4Z5S A;  4TOE A;  2BK6 A;  3BKN A;  3AK9 A;  2ZG7 X;  3H7G A;  1JKU A;  3IS8 A;  5IX6 A;  1Z6O A;  4CVT A;  1S30 A;  4CMY V;  3O7S A;  2FZF A;  3PVR B;  5E2D A;  5C6F A;  4ZKH A;  5K53 A;  1BFR A;  2X17 0;  3EGM A;  4MY7 A;  5I4J A;  2YW6 A;  1VEQ A;  1OTK A;  3BVI A;  4IWK A;  4RC8 A;  5FEJ A;  3WVU A;  2XJN A;  1TJO A;  2Z5R A;  3HL1 A;  3PWQ A;  3BVK A;  4PGI A;  4Y08 A;  2V15 A;  4TO9 A;  3R2K A;  2G4H A;  2C41 A;  4EVC A;  2Z6M A;  3BT5 A;  3VNX A;  3AJO A;  2BW1 A;  3E1P A;  1L8I A;  5CMR A;  2HTN A;  2IU2 A;  2BJY A;  3BVF A;  1ZS3 A;  1N1Q A;  2V2J A;  1RCI A;  2YJJ A;  1DAT A;  5AXS A;  3NP2 X;  3E1N A;  5D8S A;  3E1Q A;  4IWJ A;  4KVS A;  4EVE A;  3R2H A;  5ERJ A;  2C2F A;  1O9I A;  1XZ1 A;  4LPM A;  3GE4 A;  4RC5 B;  4TOG A;  4DE6 A;  4DYZ A;  1RCE A;  3RGD A;  2CN7 A;  2JD6 0;  3MPS A;  4RC7 A;  2CF7 A;  4IXK A;  3KWO A;  2JD8 0;  4PG1 A;  5GN8 B;  4ZKX A;  5CMQ A;  1J30 A;  1RCD A;  1S3Q A;  5GU3 X;  4RC6 B;  2CHI A;  2OH3 A;  3F36 A;  5GU0 X;  2HR5 A;  3R2R A;  4II4 B;  4TOD A;  3F34 A;  4LQN A;  1NF6 A;  1NF4 A;  1JRE A;  1QGH A;  3WVV A;  3ISF A;  2V2R A;  2PYB A;  4ML5 A;  1Z4A A;  5E1U A;  3PW1 A;  2C2U A;  4P18 A;  3PVT A;  1MOJ A;  2ITB A;  4RC5 A;  3PW8 C;  4MUD A;  3WNW A;  5CZU A;  1VEI A;  3UOI A;  3F32 A;  1SQ3 A;  3FSE A;  3AJQ A;  2VXI A;  1LKO A;  2WLA A;  4ERU A;  2XJM A;  4TOB A;  4PGK A;  2FFX J;  1TK6 A;  2GYQ A;  4ISM A;  2BKC A;  1QYB A;  3GVY A;  3R2L A;  3AK8 A;  2FG4 A;  3U90 A;  5JKL A;  3GHQ A;  3AJP A;  4LQV A;  3SHX A;  5LG8 A;  4XKS A;  4ITT A;  5LBH A;  3BVE A;  5J93 A;  4ZTT A;  4M32 A;  3E1L A;  5JAC A;  1YUZ A;  4ZJK A;  1JIG A;  4MJY A;  3KA8 A;  4LYU A;  1FHA A;  1RCC A;  4CYB A;  1YV1 A;  5HJF A;  4TOH A;  5J8S A;  1B71 A;  1VJX A;  3HIU A;  2F7N A;  3RD0 A;  3ERZ A;  3WVW A;  4LQJ A;  4ZKW A;  4DI0 A;  3BVL A;  4MKU A;  3RBC A;  2Z90 A;  1UMN A;  4DYU A;  1BG7 A;  4M33 A;  1F30 A;  2ZA7 A;  3F35 A;  5J9V A;  4OYN A;  3KA6 A;  3PVR A;  4EVD A;  3E6R A;  3RAV A;  1XZ3 A;  3F38 A;  3IS7 A;  3KXU A;  1MFR A;  3SH6 A;  3ES3 A;  3O7R A;  4YKH A;  3SID A;  1L8H A;  2CN6 A;  4AM4 A;  5D8P A;  5FFD A;  4DYX A;  1VLG A;  4EVB A;  2ZA8 A;  2GYD A;  1UVH A;  2VXX A;  3E2C A;  2CEI A;  3Q4N A;  5FFA A;  3IQ1 A;  3SE1 A;  5J8W A;  2V2P A;  1RCG A;  2FKZ A;  3A68 A;  4XKU A;  2CHP A;  2ZG8 X;  5D8X A;  1R03 A;  4AM5 A;  5GOU A;  3R2M A;  2V2N A;  4LQH A;  5ERK A;  3T9J A;  1LB3 A;  4CYA A;  4ZL6 A;  3PW8 A;  1H96 A;  3FI6 A;  2IB0 A;  2XKQ A;  3AF7 X;  3AF9 X;  1TKO A;  3FVB A;  1ZUJ A;  4ITW A;  4KVR A;  4AM2 A;  4Z3B A;  3RE7 A;  3QHC A;  2IY4 A;  4TOF A;  3ISE A;  5FFC A;  4M35 A;  2XGW A;  1JI4 A;  2CIH A;  5JKL G;  3EZ0 A;  4LYX A;  3EZU A;  3A9Q A;  5GN8 A;  4ZMC A;  4PG0 A;  3QD8 A;  2FHA A;  1F33 A;  4DAS A;  1IES A;  1NNQ A;  4RC6 A;  3Q4Q A;  2V2S A;  3TA8 A;  3UOF A;  1Z6O M;  1O9R A;  2YW7 A;  2V2L A;  4CVS A;  2Y3Q A;  4II4 A;  2VZB A;  1GWG A;  2V2O A;  1NFV A;  3KA9 A;  3Q4R A;  3F37 A;  3QVD A;  2GS4 A;  3QHB A;  1VEL A;  2UX1 A;  2ZG9 X;  2V2M A;  3NP0 X;  1AEW A;  4QUW A;  4DYY A;  1JGC A;  4RC7 B;  1HRS A;  4MN9 A;  1RYT A;  2Z5Q A;  4XGS A;  2CLB A;  5D8R A;  5HJH A;  2XJO A;  2ZA6 A;  1JTS A;  1EUM A;  4ISP A;  3AF8 X;  3E6S A;  3PWQ C;  4KVQ A;  2QF9 A;  3Q4O A;  2JD7 0;  1JYB A;  2V2I A;  4TW3 A;  3PVY B;  4ETR A;  1IER A;  3R2O A;  4LPN A;  5GU2 X;  4A25 A;  2WTL A;  4M34 A;  4ZL5 A;  4REU A;  4CVR A;  1JI5 A;  5FFE A;  3KA4 A;  3KX9 A; 
#chains in the Genus database with same CATH topology
 5HU6 D;  2C2J A;  4CY9 A;  1JKV A;  3PWF A;  5FFB A;  2V8U A;  3PW1 B;  2FL0 A;  3PVT B;  4R42 A;  3E1O A;  2RBD A;  3KA3 A;  4U3G A;  4CVP A;  1LKP A;  3E1M A;  3QZ3 A;  4W4L B;  4LPJ A;  5D8Q A;  1SOF A;  1DVB A;  1YUX A;  2QQY A;  5LG2 A;  5LS9 A;  5GU1 X;  4E6K A;  1S2Z A;  3R2S A;  4ZLW A;  2W0O A;  1KRQ A;  3NOZ X;  3PVY A;  3OJ5 A;  4XKT A;  3PZA A;  2WLU A;  4DZ0 A;  1LKM A;  5K52 A;  5JDO B;  4TOC A;  2FJC A;  3F39 A;  3UNO A;  3OGH A;  1TKP A;  5JKM G;  3E1J A;  5D8Y A;  2C6R A;  2D5K A;  2YJK A;  1BCF A;  3F33 A;  1DPS A;  2CLU A;  3QB9 A;  5HQO A;  2Z5P A;  2OC5 A;  2FG8 A;  5JKM A;  2ZUR X;  4TOA A;  5D8O A;  4CMY A;  4Z5S A;  4TOE A;  2BK6 A;  3BKN A;  3AK9 A;  2ZG7 X;  3H7G A;  1JKU A;  3FRR A;  3IS8 A;  5IX6 A;  1Z6O A;  4CVT A;  1S30 A;  4CMY V;  3O7S A;  2FZF A;  3PVR B;  5E2D A;  5C6F A;  4ZKH A;  5K53 A;  1BFR A;  2X17 0;  3EGM A;  3C1Y A;  4MY7 A;  5I4J A;  2YW6 A;  1VEQ A;  4WJG 4;  5JDO A;  1OTK A;  3BVI A;  4IWK A;  4RC8 A;  5FEJ A;  3WVU A;  2XJN A;  1TJO A;  2Z5R A;  3HL1 A;  3PWQ A;  3BVK A;  4PGI A;  4Y08 A;  2V15 A;  4TO9 A;  3R2K A;  2G4H A;  2C41 A;  4EVC A;  2Z6M A;  3BT5 A;  3VNX A;  3AJO A;  2BW1 A;  3E1P A;  1L8I A;  5CMR A;  2HTN A;  3GGY A;  2IU2 A;  2BJY A;  3BVF A;  1ZS3 A;  1N1Q A;  3FRS A;  2V2J A;  1RCI A;  2YJJ A;  1DAT A;  5AXS A;  3NP2 X;  2N02 A;  3E1N A;  5D8S A;  3GGZ A;  3E1Q A;  4IWJ A;  4KVS A;  4EVE A;  3R2H A;  5ERJ A;  2C2F A;  1O9I A;  1XZ1 A;  4LPM A;  3GE4 A;  4RC5 B;  4TOG A;  4DE6 A;  4DYZ A;  1RCE A;  3RGD A;  2CN7 A;  2JD6 0;  3MPS A;  4RC7 A;  2CF7 A;  3C1Z A;  4IXK A;  3KWO A;  2JD8 0;  4PG1 A;  5GN8 B;  4ZKX A;  4YXJ A;  5CMQ A;  1J30 A;  1RCD A;  1S3Q A;  3D19 A;  3JZA B;  3VV9 A;  5GU3 X;  4RC6 B;  2CHI A;  2OH3 A;  3F36 A;  5GU0 X;  2HR5 A;  3R2R A;  4II4 B;  4TOD A;  3F34 A;  4LQN A;  1NF6 A;  1NF4 A;  1JRE A;  1QGH A;  3WVV A;  3ISF A;  2V2R A;  2PYB A;  4ML5 A;  3KDQ A;  1Z4A A;  5E1U A;  3PW1 A;  2C2U A;  4P18 A;  3PVT A;  1MOJ A;  2ITB A;  4RC5 A;  3PW8 C;  4MUD A;  3C21 A;  3WNW A;  5CZU A;  1VEI A;  3UOI A;  3F32 A;  1SQ3 A;  3FSE A;  3AJQ A;  2VXI A;  1LKO A;  2WLA A;  4ERU A;  2XJM A;  4TOB A;  4PGK A;  2FFX J;  1TK6 A;  2GYQ A;  4ISM A;  2BKC A;  1QYB A;  3GVY A;  3R2L A;  3AK8 A;  2FG4 A;  3U90 A;  5JKL A;  3GHQ A;  3AJP A;  4LQV A;  3SHX A;  5LG8 A;  4XKS A;  4ITT A;  4X0J A;  5LBH A;  3BVE A;  5J93 A;  4ZTT A;  4M32 A;  3E1L A;  5JAC A;  1YUZ A;  4ZJK A;  1JIG A;  4MJY A;  3KA8 A;  4LYU A;  3N6O A;  1FHA A;  1RCC A;  4CYB A;  1YV1 A;  5HJF A;  4TOH A;  3LKD A;  5J8S A;  1B71 A;  1VJX A;  3HIU A;  2F7N A;  3RD0 A;  3ERZ A;  3WVW A;  4LQJ A;  4ZKW A;  4DI0 A;  3BVL A;  2AR0 A;  4MKU A;  3RBC A;  2Z90 A;  1UMN A;  4DYU A;  1BG7 A;  4M33 A;  1F30 A;  2ZA7 A;  3F35 A;  4E40 A;  5J9V A;  4OYN A;  3KA6 A;  3PVR A;  4EVD A;  3E6R A;  3RAV A;  1XZ3 A;  3F38 A;  3IS7 A;  3KXU A;  1MFR A;  3SH6 A;  3ES3 A;  3O7R A;  4YKH A;  3SID A;  1L8H A;  2CN6 A;  2V8T A;  4YVZ A;  4AM4 A;  4KXR B;  5D8P A;  5FFD A;  4DYX A;  1VLG A;  4EVB A;  2ZA8 A;  2GYD A;  1UVH A;  4MXP A;  2VXX A;  3E2C A;  3M6J A;  2CEI A;  3Q4N A;  5FFA A;  3IQ1 A;  3SE1 A;  2CWL A;  5J8W A;  2V2P A;  1RCG A;  2FKZ A;  3A68 A;  4XKU A;  2CHP A;  2ZG8 X;  5D8X A;  1R03 A;  4AM5 A;  2MGY A;  5GOU A;  3R2M A;  3JZ9 A;  2V2N A;  4LQH A;  5ERK A;  3T9J A;  1LB3 A;  4CYA A;  4ZL6 A;  3PW8 A;  3C23 A;  1H96 A;  3FI6 A;  2IB0 A;  2XKQ A;  3AF7 X;  3AF9 X;  1TKO A;  3FVB A;  1ZUJ A;  4ITW A;  4KVR A;  4AM2 A;  4Z3B A;  3RE7 A;  3QHC A;  2IY4 A;  4TOF A;  3ISE A;  5FFC A;  2OKC A;  4M35 A;  2XGW A;  3L0M A;  2Y44 A;  1JI4 A;  2CIH A;  5JKL G;  3EZ0 A;  4LYX A;  2G38 B;  3EZU A;  3A9Q A;  5GN8 A;  4ZMC A;  4W4K B;  4PG0 A;  3QD8 A;  2FHA A;  1F33 A;  4DAS A;  1IES A;  1NNQ A;  4RC6 A;  3Q4Q A;  2V2S A;  3TA8 A;  3UOF A;  1Z6O M;  3KHK A;  1O9R A;  2YW7 A;  2V2L A;  4CVS A;  2Y3Q A;  4II4 A;  2VZB A;  1GWG A;  3V3K B;  2V2O A;  1NFV A;  3KA9 A;  3Q4R A;  3VVA A;  3F37 A;  3QVD A;  2GS4 A;  3QHB A;  1VEL A;  2UX1 A;  2ZG9 X;  2V2M A;  3NP0 X;  1AEW A;  4QUW A;  3DBY A;  4DYY A;  1JGC A;  4RC7 B;  1HRS A;  4MN9 A;  1RYT A;  3UFB A;  2Z5Q A;  4XGS A;  2CLB A;  5D8R A;  5HJH A;  2XJO A;  2ZA6 A;  3W54 A;  1JTS A;  1EUM A;  4ISP A;  3AF8 X;  3E6S A;  3PWQ C;  4KVQ A;  2QF9 A;  3Q4O A;  2WWX B;  2JD7 0;  1JYB A;  2V2I A;  4TW3 A;  3PVY B;  4ETR A;  1IER A;  3R2O A;  4LPN A;  5GU2 X;  4A25 A;  2WTL A;  4M34 A;  4ZL5 A;  4REU A;  4YXM A;  4CVR A;  1JI5 A;  5FFE A;  3KA4 A;  3KX9 A; 
#chains in the Genus database with same CATH homology
 5HU6 D;  2C2J A;  4CY9 A;  1JKV A;  3PWF A;  5FFB A;  2V8U A;  3PW1 B;  2FL0 A;  3PVT B;  4R42 A;  3E1O A;  2RBD A;  3KA3 A;  4U3G A;  4CVP A;  1LKP A;  3E1M A;  3QZ3 A;  4W4L B;  4LPJ A;  5D8Q A;  1SOF A;  1DVB A;  1YUX A;  2QQY A;  5LG2 A;  5LS9 A;  5GU1 X;  4E6K A;  1S2Z A;  3R2S A;  4ZLW A;  2W0O A;  1KRQ A;  3NOZ X;  3PVY A;  3OJ5 A;  4XKT A;  3PZA A;  2WLU A;  4DZ0 A;  1LKM A;  5K52 A;  5JDO B;  4TOC A;  2FJC A;  3F39 A;  3UNO A;  3OGH A;  1TKP A;  5JKM G;  3E1J A;  5D8Y A;  2C6R A;  2D5K A;  2YJK A;  1BCF A;  3F33 A;  1DPS A;  2CLU A;  3QB9 A;  5HQO A;  2Z5P A;  2OC5 A;  2FG8 A;  5JKM A;  2ZUR X;  4TOA A;  5D8O A;  4CMY A;  4Z5S A;  4TOE A;  2BK6 A;  3BKN A;  3AK9 A;  2ZG7 X;  3H7G A;  1JKU A;  3FRR A;  3IS8 A;  5IX6 A;  1Z6O A;  4CVT A;  1S30 A;  4CMY V;  3O7S A;  2FZF A;  3PVR B;  5E2D A;  5C6F A;  4ZKH A;  5K53 A;  1BFR A;  2X17 0;  3EGM A;  3C1Y A;  4MY7 A;  5I4J A;  2YW6 A;  1VEQ A;  4WJG 4;  5JDO A;  1OTK A;  3BVI A;  4IWK A;  4RC8 A;  5FEJ A;  3WVU A;  2XJN A;  1TJO A;  2Z5R A;  3HL1 A;  3PWQ A;  3BVK A;  4PGI A;  4Y08 A;  2V15 A;  4TO9 A;  3R2K A;  2G4H A;  2C41 A;  4EVC A;  2Z6M A;  3BT5 A;  3VNX A;  3AJO A;  2BW1 A;  3E1P A;  1L8I A;  5CMR A;  2HTN A;  3GGY A;  2IU2 A;  2BJY A;  3BVF A;  1ZS3 A;  1N1Q A;  3FRS A;  2V2J A;  1RCI A;  2YJJ A;  1DAT A;  5AXS A;  3NP2 X;  2N02 A;  3E1N A;  5D8S A;  3GGZ A;  3E1Q A;  4IWJ A;  4KVS A;  4EVE A;  3R2H A;  5ERJ A;  2C2F A;  1O9I A;  1XZ1 A;  4LPM A;  3GE4 A;  4RC5 B;  4TOG A;  4DE6 A;  4DYZ A;  1RCE A;  3RGD A;  2CN7 A;  2JD6 0;  3MPS A;  4RC7 A;  2CF7 A;  3C1Z A;  4IXK A;  3KWO A;  2JD8 0;  4PG1 A;  5GN8 B;  4ZKX A;  4YXJ A;  5CMQ A;  1J30 A;  1RCD A;  1S3Q A;  3D19 A;  3JZA B;  3VV9 A;  5GU3 X;  4RC6 B;  2CHI A;  2OH3 A;  3F36 A;  5GU0 X;  2HR5 A;  3R2R A;  4II4 B;  4TOD A;  3F34 A;  4LQN A;  1NF6 A;  1NF4 A;  1JRE A;  1QGH A;  3WVV A;  3ISF A;  2V2R A;  2PYB A;  4ML5 A;  3KDQ A;  1Z4A A;  5E1U A;  3PW1 A;  2C2U A;  4P18 A;  3PVT A;  1MOJ A;  2ITB A;  4RC5 A;  3PW8 C;  4MUD A;  3C21 A;  3WNW A;  5CZU A;  1VEI A;  3UOI A;  3F32 A;  1SQ3 A;  3FSE A;  3AJQ A;  2VXI A;  1LKO A;  2WLA A;  4ERU A;  2XJM A;  4TOB A;  4PGK A;  2FFX J;  1TK6 A;  2GYQ A;  4ISM A;  2BKC A;  1QYB A;  3GVY A;  3R2L A;  3AK8 A;  2FG4 A;  3U90 A;  5JKL A;  3GHQ A;  3AJP A;  4LQV A;  3SHX A;  5LG8 A;  4XKS A;  4ITT A;  4X0J A;  5LBH A;  3BVE A;  5J93 A;  4ZTT A;  4M32 A;  3E1L A;  5JAC A;  1YUZ A;  4ZJK A;  1JIG A;  4MJY A;  3KA8 A;  4LYU A;  3N6O A;  1FHA A;  1RCC A;  4CYB A;  1YV1 A;  5HJF A;  4TOH A;  3LKD A;  5J8S A;  1B71 A;  1VJX A;  3HIU A;  2F7N A;  3RD0 A;  3ERZ A;  3WVW A;  4LQJ A;  4ZKW A;  4DI0 A;  3BVL A;  2AR0 A;  4MKU A;  3RBC A;  2Z90 A;  1UMN A;  4DYU A;  1BG7 A;  4M33 A;  1F30 A;  2ZA7 A;  3F35 A;  4E40 A;  5J9V A;  4OYN A;  3KA6 A;  3PVR A;  4EVD A;  3E6R A;  3RAV A;  1XZ3 A;  3F38 A;  3IS7 A;  3KXU A;  1MFR A;  3SH6 A;  3ES3 A;  3O7R A;  4YKH A;  3SID A;  1L8H A;  2CN6 A;  2V8T A;  4YVZ A;  4AM4 A;  4KXR B;  5D8P A;  5FFD A;  4DYX A;  1VLG A;  4EVB A;  2ZA8 A;  2GYD A;  1UVH A;  4MXP A;  2VXX A;  3E2C A;  3M6J A;  2CEI A;  3Q4N A;  5FFA A;  3IQ1 A;  3SE1 A;  2CWL A;  5J8W A;  2V2P A;  1RCG A;  2FKZ A;  3A68 A;  4XKU A;  2CHP A;  2ZG8 X;  5D8X A;  1R03 A;  4AM5 A;  2MGY A;  5GOU A;  3R2M A;  3JZ9 A;  2V2N A;  4LQH A;  5ERK A;  3T9J A;  1LB3 A;  4CYA A;  4ZL6 A;  3PW8 A;  3C23 A;  1H96 A;  3FI6 A;  2IB0 A;  2XKQ A;  3AF7 X;  3AF9 X;  1TKO A;  3FVB A;  1ZUJ A;  4ITW A;  4KVR A;  4AM2 A;  4Z3B A;  3RE7 A;  3QHC A;  2IY4 A;  4TOF A;  3ISE A;  5FFC A;  2OKC A;  4M35 A;  2XGW A;  3L0M A;  2Y44 A;  1JI4 A;  2CIH A;  5JKL G;  3EZ0 A;  4LYX A;  2G38 B;  3EZU A;  3A9Q A;  5GN8 A;  4ZMC A;  4W4K B;  4PG0 A;  3QD8 A;  2FHA A;  1F33 A;  4DAS A;  1IES A;  1NNQ A;  4RC6 A;  3Q4Q A;  2V2S A;  3TA8 A;  3UOF A;  1Z6O M;  3KHK A;  1O9R A;  2YW7 A;  2V2L A;  4CVS A;  2Y3Q A;  4II4 A;  2VZB A;  1GWG A;  3V3K B;  2V2O A;  1NFV A;  3KA9 A;  3Q4R A;  3VVA A;  3F37 A;  3QVD A;  2GS4 A;  3QHB A;  1VEL A;  2UX1 A;  2ZG9 X;  2V2M A;  3NP0 X;  1AEW A;  4QUW A;  3DBY A;  4DYY A;  1JGC A;  4RC7 B;  1HRS A;  4MN9 A;  1RYT A;  3UFB A;  2Z5Q A;  4XGS A;  2CLB A;  5D8R A;  5HJH A;  2XJO A;  2ZA6 A;  3W54 A;  1JTS A;  1EUM A;  4ISP A;  3AF8 X;  3E6S A;  3PWQ C;  4KVQ A;  2QF9 A;  3Q4O A;  2WWX B;  2JD7 0;  1JYB A;  2V2I A;  4TW3 A;  3PVY B;  4ETR A;  1IER A;  3R2O A;  4LPN A;  5GU2 X;  4A25 A;  2WTL A;  4M34 A;  4ZL5 A;  4REU A;  4YXM A;  4CVR A;  1JI5 A;  5FFE A;  3KA4 A;  3KX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...