2VZBA

A dodecameric thioferritin in the bacterial domain, characterization of the bacterioferritin-related protein from bacteroides fragilis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
168
structure length
168
Chain Sequence
AKESVKILQGKLDVKSLIDQLNAALSEEWLAYYQYWVGALVVEGAMRADVQGEFEEHAEEERHHAQLIADRIIELEGVPVLDPKKWFELARCKYDSPTAFDSVSLLNQNVSSERCAILRYQEIANFTNGKDYTTCDIAKHILAEEEEHEQDLQDYLTDIARMKESFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords PUTATIVE BACTERIOFERRITIN-RELATED PROTEIN
publication title Characterization of the Bacteroides Fragilis Bfr Gene Product Identifies a Bacterial Dps-Like Protein and Suggests Evolutionary Links in the Ferritin Superfamily.
pubmed doi rcsb
source organism Bacteroides fragilis
total genus 74
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2vzbA00
5K52A 1DATA 1VELA 1H96A 3O7SA 2Z6MA 2F7NA 3OJ5A 1JIGA 1RCDA 5JKLG 2C2UA 1NNQA 3WVUA 1F33A 2CLBA 3R2RA 3R2OA 2GS4A 3R2KA 1XZ3A 2V2PA 4CMYA 4DZ0A 3SHXA 2V2RA 3ISEA 1TKOA 3E6SA 3PW8A 2XJOA 3PW1B 2CN6A 3KX9A 2JD70 4CVSA 4ITTA 1J30A 3NOZX 2FJCA 3AF8X 3TA8A 4TOAA 2YW7A 3Q4QA 3RGDA 4LQNA 4RC7A 4PGIA 4ZKWA 4EVCA 1Z6OA 4ISPA 4PG1A 2JD80 2BK6A 4MKUA 1RCEA 3E1MA 3E1OA 4YKHA 3R2SA 1GWGA 5HJFA 4LYUA 4RC8A 3PWQC 3AF7X 4ZMCA 3A68A 5JKMG 2CHIA 3KXUA 4EVEA 5LS9A 4REUA 3BVIA 3R2HA 3PW1A 1JI4A 2IU2A 4M35A 4ZKXA 1N1QA 2CLUA 3F32A 5LBHA 2VXXA 3KWOA 5J93A 3OGHA 2IY4A 1IERA 2PYBA 1VLGA 4TOBA 1S2ZA 1KRQA 3QB9A 3HIUA 4LPNA 3F38A 4M32A 4QUWA 3E2CA 1NF6A 2C2FA 5D8QA 4PG0A 2WLAA 2RBDA 5ERJA 5JKLA 1QYBA 3F37A 3NP0X 1DPSA 2ZG7X 4CYBA 4Z5SA 2V2SA 2V2MA 3ES3A 4CY9A 3R2LA 3AJPA 1RCCA 5D8YA 1O9IA 1ZUJA 2OC5A 3EGMA 2D5KA 3E1NA 2FG4A 1S30A 3KA9A 5HJHA 2ZA6A 2ZG9X 4LPMA 2V2OA 5FEJA 2CEIA 4IWJA 3SE1A 4TW3A 4TOEA 2BW1A 3KA8A 3PVRA 1LKPA 2IB0A 2JD60 3PVTB 3E1PA 4AM2A 2CHPA 2C6RA 1BCFA 4MN9A 3BVEA 3BVFA 3WVVA 1DVBA 3PVYB 3QZ3A 4DYUA 1YUZA 5JKMA 4TO9A 3E1LA 4Y08A 1JREA 3GE4A 5FFAA 3Q4OA 1JI5A 5IX6A 4DASA 1AEWA 5GU0X 3T9JA 3FI6A 4U3GA 1YUXA 3E1JA 4OYNA 1LKMA 2XGWA 5E1UA 1JTSA 3H7GA 5K53A 4TOGA 2V2NA 5D8SA 4KVSA 1MFRA 1L8IA 5GOUA 4XKSA 3WVWA 2FL0A 3RBCA 3PVTA 1NFVA 2YJKA 1TJOA 4TODA 5GU2X 1VEQA 3HL1A 2FG8A 3PVYA 1ZS3A 2CIHA 3MPSA 2VZBA 1LB3A 5D8PA 5CZUA 1S3QA 3KA3A 2Y3QA 4AM5A 3WNWA 3F35A 5J8WA 4IXKA 3UOIA 3AJOA 2C2JA 2ZA7A 5AXSA 4ML5A 2WLUA 2V2IA 4LQJA 5FFCA 2V15A 3QVDA 5E2DA 3PVRB 3AF9X 5D8OA 4ETRA 5GU3X 5I4JA 3NP2X 2C41A 5LG8A 4M34A 4RC5B 1TK6A 4TOCA 4CVRA 1F30A 3PWFA 4ZTTA 4MJYA 2YJJA 5C6FA 4DYZA 1R03A 1RCGA 2Z5RA 3E1QA 1BFRA 3AK8A 3RE7A 1SQ3A 1NF4A 1JGCA 2Z90A 5J9VA 3RAVA 2G4HA 3FVBA 2CF7A 3AJQA 4ISMA 5D8XA 3IS7A 4DYXA 2GYDA 4RC6B 3PWQA 1RCIA 5CMRA 4M33A 5J8SA 2ZG8X 2XJNA 4ZJKA 3IS8A 3E6RA 2X170 2YW6A 4RC5A 4XKUA 1Z4AA 4PGKA 4ZKHA 3KA4A 5ERKA 3UOFA 4ZLWA 4DYYA 2FFXJ 3FSEA 5GN8B 1FHAA 3GHQA 3Q4NA 1LKOA 3VNXA 4CVTA 3Q4RA 3QD8A 2FZFA 2ZURX 2XKQA 4LYXA 1Z6OM 4MUDA 1IESA 4A25A 4LQHA 3UNOA 4EVDA 1L8HA 4RC6A 4P18A 3ISFA 1B71A 1SOFA 3U90A 1O9RA 1HRSA 1JKVA 4ITWA 4R42A 5FFEA 2Z5PA 4LQVA 4KVRA 1BG7A 3R2MA 1JKUA 4DE6A 3BVLA 3ERZA 2XJMA 1UMNA 2QQYA 3O7RA 3PW8C 3F34A 2FHAA 2FKZA 1EUMA 2BJYA 5GN8A 3RD0A 3PZAA 4TOFA 3BT5A 2BKCA 4II4B 3BVKA 1JYBA 2OH3A 4EVBA 4CYAA 3KA6A 2V2LA 2ITBA 2Z5QA 4CVPA 3IQ1A 4XKTA 5LG2A 4TOHA 3EZUA 3QHBA 1OTKA 4CMYV 4ZL5A 4XGSA 2UX1A 1VEIA 1UVHA 5CMQA 3GVYA 1TKPA 1QGHA 4AM4A 3SIDA 2HR5A 4Z3BA 5HQOA 3EZ0A 3F36A 4IWKA 4LPJA 2V2JA 1YV1A 3A9QA 2W0OA 1RYTA 2CN7A 4ERUA 2ZA8A 4DI0A 5JACA 4MY7A 4KVQA 3AK9A 4ZL6A 2GYQA 4II4A 3BKNA 1MOJA 3F33A 2QF9A 4E6KA 1XZ1A 2WTLA 2HTNA 5GU1X 3F39A 1VJXA 2VXIA 5FFBA 5D8RA 3SH6A 5FFDA 3QHCA 4RC7B
chains in the Genus database with same CATH superfamily
5K52A 1DATA 1VELA 1H96A 3O7SA 5HU6D 2Z6MA 2F7NA 3OJ5A 1JIGA 1RCDA 5JKLG 2C2UA 1NNQA 3WVUA 1F33A 2CLBA 3R2RA 3R2OA 2GS4A 3R2KA 1XZ3A 2V2PA 4CMYA 4DZ0A 3SHXA 2V2RA 3ISEA 1TKOA 3E6SA 3PW8A 2XJOA 3JZAB 3PW1B 2CN6A 3KX9A 2JD70 4CVSA 4ITTA 1J30A 3NOZX 2FJCA 3AF8X 3TA8A 4TOAA 2YW7A 3Q4QA 3RGDA 4LQNA 2MGYA 4RC7A 4PGIA 4ZKWA 4EVCA 1Z6OA 4ISPA 4PG1A 2JD80 2BK6A 4MKUA 1RCEA 3E1MA 3E1OA 4YKHA 3R2SA 1GWGA 5HJFA 4LYUA 4RC8A 3PWQC 3AF7X 4ZMCA 3A68A 5JKMG 2CHIA 3KXUA 4EVEA 5LS9A 4REUA 2OKCA 3LKDA 3BVIA 3R2HA 3PW1A 1JI4A 2IU2A 4X0JA 2Y44A 4M35A 4ZKXA 1N1QA 3FRSA 2CLUA 3F32A 5LBHA 2VXXA 3KWOA 5J93A 3OGHA 2IY4A 1IERA 2PYBA 1VLGA 4TOBA 1S2ZA 1KRQA 3QB9A 3HIUA 4LPNA 3F38A 4M32A 4QUWA 3E2CA 1NF6A 2C2FA 5D8QA 4PG0A 2WLAA 2RBDA 5ERJA 5JKLA 1QYBA 3F37A 3NP0X 1DPSA 2ZG7X 4CYBA 4Z5SA 2V2SA 2V2MA 3ES3A 4CY9A 3UFBA 3R2LA 3AJPA 1RCCA 5D8YA 1O9IA 1ZUJA 4W4LB 2OC5A 3EGMA 3VVAA 2D5KA 3E1NA 2FG4A 1S30A 3KA9A 5HJHA 2ZA6A 2ZG9X 4LPMA 3L0MA 2V2OA 5FEJA 2CEIA 4IWJA 3SE1A 4TW3A 4TOEA 2BW1A 3KA8A 3PVRA 1LKPA 2IB0A 2JD60 3PVTB 3E1PA 3N6OA 4AM2A 2CHPA 2C6RA 1BCFA 3BVEA 3BVFA 4MN9A 3WVVA 1DVBA 3PVYB 3QZ3A 4DYUA 1YUZA 5JKMA 4TO9A 3E1LA 4Y08A 1JREA 3GE4A 5FFAA 3Q4OA 1JI5A 5IX6A 4DASA 1AEWA 5GU0X 3T9JA 3FI6A 4U3GA 1YUXA 3E1JA 4OYNA 1LKMA 2XGWA 5E1UA 1JTSA 3W54A 3H7GA 5K53A 4TOGA 2V2NA 5D8SA 4KVSA 1MFRA 1L8IA 5GOUA 4XKSA 3WVWA 3D19A 2FL0A 3RBCA 3PVTA 1NFVA 2YJKA 1TJOA 4TODA 5GU2X 1VEQA 3HL1A 2FG8A 3PVYA 1ZS3A 2CIHA 3MPSA 2WWXB 2VZBA 1LB3A 5D8PA 5CZUA 1S3QA 3KA3A 2Y3QA 4AM5A 3WNWA 3C23A 3F35A 5J8WA 2CWLA 4IXKA 3UOIA 3AJOA 2C2JA 2ZA7A 5AXSA 4ML5A 2WLUA 2V2IA 4LQJA 5FFCA 2V15A 4MXPA 3QVDA 5E2DA 3PVRB 3AF9X 5D8OA 4ETRA 5GU3X 5I4JA 3VV9A 3NP2X 2C41A 5LG8A 4YVZA 4M34A 4RC5B 3C1ZA 5JDOB 1TK6A 4TOCA 4CVRA 1F30A 3PWFA 4ZTTA 4MJYA 2YJJA 5C6FA 4DYZA 1R03A 3V3KB 1RCGA 2Z5RA 3E1QA 1BFRA 3AK8A 3RE7A 1SQ3A 1NF4A 1JGCA 2Z90A 5J9VA 3RAVA 2G4HA 3FVBA 2CF7A 3AJQA 3GGZA 4ISMA 5D8XA 3IS7A 4DYXA 2GYDA 2G38B 4RC6B 3PWQA 1RCIA 5CMRA 4M33A 5J8SA 2ZG8X 2XJNA 4ZJKA 3IS8A 2AR0A 3E6RA 2X170 2YW6A 4E40A 4RC5A 3FRRA 5JDOA 4XKUA 3JZ9A 2V8TA 4KXRB 3KHKA 1Z4AA 3C21A 4PGKA 4ZKHA 3KA4A 5ERKA 3UOFA 4ZLWA 4DYYA 2FFXJ 3FSEA 5GN8B 1FHAA 3GHQA 3Q4NA 1LKOA 3VNXA 4W4KB 4CVTA 3Q4RA 3QD8A 2FZFA 2ZURX 2XKQA 4LYXA 1Z6OM 4MUDA 1IESA 3DBYA 4LQHA 3UNOA 4A25A 1L8HA 4EVDA 4RC6A 4P18A 3ISFA 1B71A 1SOFA 3U90A 1O9RA 1HRSA 1JKVA 4ITWA 4R42A 5FFEA 2Z5PA 4LQVA 4KVRA 1BG7A 3R2MA 1JKUA 4DE6A 3BVLA 3ERZA 2XJMA 1UMNA 2V8UA 2QQYA 3O7RA 3PW8C 3F34A 2FHAA 2FKZA 1EUMA 2BJYA 5GN8A 3RD0A 3PZAA 4TOFA 4YXJA 3BT5A 2BKCA 4II4B 3BVKA 1JYBA 2OH3A 4EVBA 4CYAA 3KA6A 2V2LA 2ITBA 2Z5QA 4CVPA 3IQ1A 4XKTA 5LG2A 4TOHA 3EZUA 3QHBA 1OTKA 4CMYV 4ZL5A 4YXMA 4XGSA 2UX1A 1VEIA 1UVHA 5CMQA 2N02A 3GVYA 1TKPA 1QGHA 4AM4A 3SIDA 2HR5A 4Z3BA 5HQOA 4WJG4 3EZ0A 3F36A 4IWKA 4LPJA 2V2JA 1YV1A 3A9QA 2W0OA 1RYTA 2CN7A 3M6JA 4ERUA 2ZA8A 4DI0A 5JACA 4MY7A 4KVQA 3AK9A 4ZL6A 2GYQA 4II4A 3BKNA 1MOJA 3F33A 3GGYA 2QF9A 4E6KA 3C1YA 3KDQA 1XZ1A 2WTLA 2HTNA 5GU1X 3F39A 1VJXA 2VXIA 5FFBA 5D8RA 3SH6A 5FFDA 3QHCA 4RC7B
chains in the Genus database with same CATH topology
5K52A 1DATA 1VELA 1H96A 3O7SA 5HU6D 2Z6MA 2F7NA 3OJ5A 1JIGA 1RCDA 5JKLG 2C2UA 1NNQA 3WVUA 1F33A 2CLBA 3R2RA 3R2OA 2GS4A 3R2KA 1XZ3A 2V2PA 4CMYA 4DZ0A 3SHXA 2V2RA 3ISEA 1TKOA 3E6SA 3PW8A 2XJOA 3JZAB 3PW1B 2CN6A 3KX9A 2JD70 4CVSA 4ITTA 1J30A 3NOZX 2FJCA 3AF8X 3TA8A 4TOAA 2YW7A 3Q4QA 3RGDA 4LQNA 2MGYA 4RC7A 4PGIA 4ZKWA 4EVCA 1Z6OA 4ISPA 4PG1A 2JD80 2BK6A 4MKUA 1RCEA 3E1MA 3E1OA 4YKHA 3R2SA 1GWGA 5HJFA 4LYUA 4RC8A 3PWQC 3AF7X 4ZMCA 3A68A 5JKMG 2CHIA 3KXUA 4EVEA 5LS9A 4REUA 2OKCA 3LKDA 3BVIA 3R2HA 3PW1A 1JI4A 2IU2A 4X0JA 2Y44A 4M35A 4ZKXA 1N1QA 3FRSA 2CLUA 3F32A 5LBHA 2VXXA 3KWOA 5J93A 3OGHA 2IY4A 1IERA 2PYBA 1VLGA 4TOBA 1S2ZA 1KRQA 3QB9A 3HIUA 4LPNA 3F38A 4M32A 4QUWA 3E2CA 1NF6A 2C2FA 5D8QA 4PG0A 2WLAA 2RBDA 5ERJA 5JKLA 1QYBA 3F37A 3NP0X 1DPSA 2ZG7X 4CYBA 4Z5SA 2V2SA 2V2MA 3ES3A 4CY9A 3UFBA 3R2LA 3AJPA 1RCCA 5D8YA 1O9IA 1ZUJA 4W4LB 2OC5A 3EGMA 3VVAA 2D5KA 3E1NA 2FG4A 1S30A 3KA9A 5HJHA 2ZA6A 2ZG9X 4LPMA 3L0MA 2V2OA 5FEJA 2CEIA 4IWJA 3SE1A 4TW3A 4TOEA 2BW1A 3KA8A 3PVRA 1LKPA 2IB0A 2JD60 3PVTB 3E1PA 3N6OA 4AM2A 2CHPA 2C6RA 1BCFA 3BVEA 3BVFA 4MN9A 3WVVA 1DVBA 3PVYB 3QZ3A 4DYUA 1YUZA 5JKMA 4TO9A 3E1LA 4Y08A 1JREA 3GE4A 5FFAA 3Q4OA 1JI5A 5IX6A 4DASA 1AEWA 5GU0X 3T9JA 3FI6A 4U3GA 1YUXA 3E1JA 4OYNA 1LKMA 2XGWA 5E1UA 1JTSA 3W54A 3H7GA 5K53A 4TOGA 2V2NA 5D8SA 4KVSA 1MFRA 1L8IA 5GOUA 4XKSA 3WVWA 3D19A 2FL0A 3RBCA 3PVTA 1NFVA 2YJKA 1TJOA 4TODA 5GU2X 1VEQA 3HL1A 2FG8A 3PVYA 1ZS3A 2CIHA 3MPSA 2WWXB 2VZBA 1LB3A 5D8PA 5CZUA 1S3QA 3KA3A 2Y3QA 4AM5A 3WNWA 3C23A 3F35A 5J8WA 2CWLA 4IXKA 3UOIA 3AJOA 2C2JA 2ZA7A 5AXSA 4ML5A 2WLUA 2V2IA 4LQJA 5FFCA 2V15A 4MXPA 3QVDA 5E2DA 3PVRB 3AF9X 5D8OA 4ETRA 5GU3X 5I4JA 3VV9A 3NP2X 2C41A 5LG8A 4YVZA 4M34A 4RC5B 3C1ZA 5JDOB 1TK6A 4TOCA 4CVRA 1F30A 3PWFA 4ZTTA 4MJYA 2YJJA 5C6FA 4DYZA 1R03A 3V3KB 1RCGA 2Z5RA 3E1QA 1BFRA 3AK8A 3RE7A 1SQ3A 1NF4A 1JGCA 2Z90A 5J9VA 3RAVA 2G4HA 3FVBA 2CF7A 3AJQA 3GGZA 4ISMA 5D8XA 3IS7A 4DYXA 2GYDA 2G38B 4RC6B 3PWQA 1RCIA 5CMRA 4M33A 5J8SA 2ZG8X 2XJNA 4ZJKA 3IS8A 2AR0A 3E6RA 2X170 2YW6A 4E40A 4RC5A 3FRRA 5JDOA 4XKUA 3JZ9A 2V8TA 4KXRB 3KHKA 1Z4AA 3C21A 4PGKA 4ZKHA 3KA4A 5ERKA 3UOFA 4ZLWA 4DYYA 2FFXJ 3FSEA 5GN8B 1FHAA 3GHQA 3Q4NA 1LKOA 3VNXA 4W4KB 4CVTA 3Q4RA 3QD8A 2FZFA 2ZURX 2XKQA 4LYXA 1Z6OM 4MUDA 1IESA 3DBYA 4LQHA 3UNOA 4A25A 1L8HA 4EVDA 4RC6A 4P18A 3ISFA 1B71A 1SOFA 3U90A 1O9RA 1HRSA 1JKVA 4ITWA 4R42A 5FFEA 2Z5PA 4LQVA 4KVRA 1BG7A 3R2MA 1JKUA 4DE6A 3BVLA 3ERZA 2XJMA 1UMNA 2V8UA 2QQYA 3O7RA 3PW8C 3F34A 2FHAA 2FKZA 1EUMA 2BJYA 5GN8A 3RD0A 3PZAA 4TOFA 4YXJA 3BT5A 2BKCA 4II4B 3BVKA 1JYBA 2OH3A 4EVBA 4CYAA 3KA6A 2V2LA 2ITBA 2Z5QA 4CVPA 3IQ1A 4XKTA 5LG2A 4TOHA 3EZUA 3QHBA 1OTKA 4CMYV 4ZL5A 4YXMA 4XGSA 2UX1A 1VEIA 1UVHA 5CMQA 2N02A 3GVYA 1TKPA 1QGHA 4AM4A 3SIDA 2HR5A 4Z3BA 5HQOA 4WJG4 3EZ0A 3F36A 4IWKA 4LPJA 2V2JA 1YV1A 3A9QA 2W0OA 1RYTA 2CN7A 3M6JA 4ERUA 2ZA8A 4DI0A 5JACA 4MY7A 4KVQA 3AK9A 4ZL6A 2GYQA 4II4A 3BKNA 1MOJA 3F33A 3GGYA 2QF9A 4E6KA 3C1YA 3KDQA 1XZ1A 2WTLA 2HTNA 5GU1X 3F39A 1VJXA 2VXIA 5FFBA 5D8RA 3SH6A 5FFDA 3QHCA 4RC7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K52 A;  1DAT A;  1VEL A;  1H96 A;  3O7S A;  2Z6M A;  2F7N A;  3OJ5 A;  1JIG A;  1RCD A;  5JKL G;  2C2U A;  1NNQ A;  3WVU A;  1F33 A;  2CLB A;  3R2R A;  3R2O A;  2GS4 A;  3R2K A;  1XZ3 A;  2V2P A;  4CMY A;  4DZ0 A;  3SHX A;  2V2R A;  3ISE A;  1TKO A;  3E6S A;  3PW8 A;  2XJO A;  3PW1 B;  2CN6 A;  3KX9 A;  2JD7 0;  4CVS A;  4ITT A;  1J30 A;  3NOZ X;  2FJC A;  3AF8 X;  3TA8 A;  4TOA A;  2YW7 A;  3Q4Q A;  3RGD A;  4LQN A;  4RC7 A;  4PGI A;  4ZKW A;  4EVC A;  1Z6O A;  4ISP A;  4PG1 A;  2JD8 0;  2BK6 A;  4MKU A;  1RCE A;  3E1M A;  3E1O A;  4YKH A;  3R2S A;  1GWG A;  5HJF A;  4LYU A;  4RC8 A;  3PWQ C;  3AF7 X;  4ZMC A;  3A68 A;  5JKM G;  2CHI A;  3KXU A;  4EVE A;  5LS9 A;  4REU A;  3BVI A;  3R2H A;  3PW1 A;  1JI4 A;  2IU2 A;  4M35 A;  4ZKX A;  1N1Q A;  2CLU A;  3F32 A;  5LBH A;  2VXX A;  3KWO A;  5J93 A;  3OGH A;  2IY4 A;  1IER A;  2PYB A;  1VLG A;  4TOB A;  1S2Z A;  1KRQ A;  3QB9 A;  3HIU A;  4LPN A;  3F38 A;  4M32 A;  4QUW A;  3E2C A;  1NF6 A;  2C2F A;  5D8Q A;  4PG0 A;  2WLA A;  2RBD A;  5ERJ A;  5JKL A;  1QYB A;  3F37 A;  3NP0 X;  1DPS A;  2ZG7 X;  4CYB A;  4Z5S A;  2V2S A;  2V2M A;  3ES3 A;  4CY9 A;  3R2L A;  3AJP A;  1RCC A;  5D8Y A;  1O9I A;  1ZUJ A;  2OC5 A;  3EGM A;  2D5K A;  3E1N A;  2FG4 A;  1S30 A;  3KA9 A;  5HJH A;  2ZA6 A;  2ZG9 X;  4LPM A;  2V2O A;  5FEJ A;  2CEI A;  4IWJ A;  3SE1 A;  4TW3 A;  4TOE A;  2BW1 A;  3KA8 A;  3PVR A;  1LKP A;  2IB0 A;  2JD6 0;  3PVT B;  3E1P A;  4AM2 A;  2CHP A;  2C6R A;  1BCF A;  4MN9 A;  3BVE A;  3BVF A;  3WVV A;  1DVB A;  3PVY B;  3QZ3 A;  4DYU A;  1YUZ A;  5JKM A;  4TO9 A;  3E1L A;  4Y08 A;  1JRE A;  3GE4 A;  5FFA A;  3Q4O A;  1JI5 A;  5IX6 A;  4DAS A;  1AEW A;  5GU0 X;  3T9J A;  3FI6 A;  4U3G A;  1YUX A;  3E1J A;  4OYN A;  1LKM A;  2XGW A;  5E1U A;  1JTS A;  3H7G A;  5K53 A;  4TOG A;  2V2N A;  5D8S A;  4KVS A;  1MFR A;  1L8I A;  5GOU A;  4XKS A;  3WVW A;  2FL0 A;  3RBC A;  3PVT A;  1NFV A;  2YJK A;  1TJO A;  4TOD A;  5GU2 X;  1VEQ A;  3HL1 A;  2FG8 A;  3PVY A;  1ZS3 A;  2CIH A;  3MPS A;  2VZB A;  1LB3 A;  5D8P A;  5CZU A;  1S3Q A;  3KA3 A;  2Y3Q A;  4AM5 A;  3WNW A;  3F35 A;  5J8W A;  4IXK A;  3UOI A;  3AJO A;  2C2J A;  2ZA7 A;  5AXS A;  4ML5 A;  2WLU A;  2V2I A;  4LQJ A;  5FFC A;  2V15 A;  3QVD A;  5E2D A;  3PVR B;  3AF9 X;  5D8O A;  4ETR A;  5GU3 X;  5I4J A;  3NP2 X;  2C41 A;  5LG8 A;  4M34 A;  4RC5 B;  1TK6 A;  4TOC A;  4CVR A;  1F30 A;  3PWF A;  4ZTT A;  4MJY A;  2YJJ A;  5C6F A;  4DYZ A;  1R03 A;  1RCG A;  2Z5R A;  3E1Q A;  1BFR A;  3AK8 A;  3RE7 A;  1SQ3 A;  1NF4 A;  1JGC A;  2Z90 A;  5J9V A;  3RAV A;  2G4H A;  3FVB A;  2CF7 A;  3AJQ A;  4ISM A;  5D8X A;  3IS7 A;  4DYX A;  2GYD A;  4RC6 B;  3PWQ A;  1RCI A;  5CMR A;  4M33 A;  5J8S A;  2ZG8 X;  2XJN A;  4ZJK A;  3IS8 A;  3E6R A;  2X17 0;  2YW6 A;  4RC5 A;  4XKU A;  1Z4A A;  4PGK A;  4ZKH A;  3KA4 A;  5ERK A;  3UOF A;  4ZLW A;  4DYY A;  2FFX J;  3FSE A;  5GN8 B;  1FHA A;  3GHQ A;  3Q4N A;  1LKO A;  3VNX A;  4CVT A;  3Q4R A;  3QD8 A;  2FZF A;  2ZUR X;  2XKQ A;  4LYX A;  1Z6O M;  4MUD A;  1IES A;  4A25 A;  4LQH A;  3UNO A;  4EVD A;  1L8H A;  4RC6 A;  4P18 A;  3ISF A;  1B71 A;  1SOF A;  3U90 A;  1O9R A;  1HRS A;  1JKV A;  4ITW A;  4R42 A;  5FFE A;  2Z5P A;  4LQV A;  4KVR A;  1BG7 A;  3R2M A;  1JKU A;  4DE6 A;  3BVL A;  3ERZ A;  2XJM A;  1UMN A;  2QQY A;  3O7R A;  3PW8 C;  3F34 A;  2FHA A;  2FKZ A;  1EUM A;  2BJY A;  5GN8 A;  3RD0 A;  3PZA A;  4TOF A;  3BT5 A;  2BKC A;  4II4 B;  3BVK A;  1JYB A;  2OH3 A;  4EVB A;  4CYA A;  3KA6 A;  2V2L A;  2ITB A;  2Z5Q A;  4CVP A;  3IQ1 A;  4XKT A;  5LG2 A;  4TOH A;  3EZU A;  3QHB A;  1OTK A;  4CMY V;  4ZL5 A;  4XGS A;  2UX1 A;  1VEI A;  1UVH A;  5CMQ A;  3GVY A;  1TKP A;  1QGH A;  4AM4 A;  3SID A;  2HR5 A;  4Z3B A;  5HQO A;  3EZ0 A;  3F36 A;  4IWK A;  4LPJ A;  2V2J A;  1YV1 A;  3A9Q A;  2W0O A;  1RYT A;  2CN7 A;  4ERU A;  2ZA8 A;  4DI0 A;  5JAC A;  4MY7 A;  4KVQ A;  3AK9 A;  4ZL6 A;  2GYQ A;  4II4 A;  3BKN A;  1MOJ A;  3F33 A;  2QF9 A;  4E6K A;  1XZ1 A;  2WTL A;  2HTN A;  5GU1 X;  3F39 A;  1VJX A;  2VXI A;  5FFB A;  5D8R A;  3SH6 A;  5FFD A;  3QHC A;  4RC7 B; 
#chains in the Genus database with same CATH topology
 5K52 A;  1DAT A;  1VEL A;  1H96 A;  3O7S A;  5HU6 D;  2Z6M A;  2F7N A;  3OJ5 A;  1JIG A;  1RCD A;  5JKL G;  2C2U A;  1NNQ A;  3WVU A;  1F33 A;  2CLB A;  3R2R A;  3R2O A;  2GS4 A;  3R2K A;  1XZ3 A;  2V2P A;  4CMY A;  4DZ0 A;  3SHX A;  2V2R A;  3ISE A;  1TKO A;  3E6S A;  3PW8 A;  2XJO A;  3JZA B;  3PW1 B;  2CN6 A;  3KX9 A;  2JD7 0;  4CVS A;  4ITT A;  1J30 A;  3NOZ X;  2FJC A;  3AF8 X;  3TA8 A;  4TOA A;  2YW7 A;  3Q4Q A;  3RGD A;  4LQN A;  2MGY A;  4RC7 A;  4PGI A;  4ZKW A;  4EVC A;  1Z6O A;  4ISP A;  4PG1 A;  2JD8 0;  2BK6 A;  4MKU A;  1RCE A;  3E1M A;  3E1O A;  4YKH A;  3R2S A;  1GWG A;  5HJF A;  4LYU A;  4RC8 A;  3PWQ C;  3AF7 X;  4ZMC A;  3A68 A;  5JKM G;  2CHI A;  3KXU A;  4EVE A;  5LS9 A;  4REU A;  2OKC A;  3LKD A;  3BVI A;  3R2H A;  3PW1 A;  1JI4 A;  2IU2 A;  4X0J A;  2Y44 A;  4M35 A;  4ZKX A;  1N1Q A;  3FRS A;  2CLU A;  3F32 A;  5LBH A;  2VXX A;  3KWO A;  5J93 A;  3OGH A;  2IY4 A;  1IER A;  2PYB A;  1VLG A;  4TOB A;  1S2Z A;  1KRQ A;  3QB9 A;  3HIU A;  4LPN A;  3F38 A;  4M32 A;  4QUW A;  3E2C A;  1NF6 A;  2C2F A;  5D8Q A;  4PG0 A;  2WLA A;  2RBD A;  5ERJ A;  5JKL A;  1QYB A;  3F37 A;  3NP0 X;  1DPS A;  2ZG7 X;  4CYB A;  4Z5S A;  2V2S A;  2V2M A;  3ES3 A;  4CY9 A;  3UFB A;  3R2L A;  3AJP A;  1RCC A;  5D8Y A;  1O9I A;  1ZUJ A;  4W4L B;  2OC5 A;  3EGM A;  3VVA A;  2D5K A;  3E1N A;  2FG4 A;  1S30 A;  3KA9 A;  5HJH A;  2ZA6 A;  2ZG9 X;  4LPM A;  3L0M A;  2V2O A;  5FEJ A;  2CEI A;  4IWJ A;  3SE1 A;  4TW3 A;  4TOE A;  2BW1 A;  3KA8 A;  3PVR A;  1LKP A;  2IB0 A;  2JD6 0;  3PVT B;  3E1P A;  3N6O A;  4AM2 A;  2CHP A;  2C6R A;  1BCF A;  3BVE A;  3BVF A;  4MN9 A;  3WVV A;  1DVB A;  3PVY B;  3QZ3 A;  4DYU A;  1YUZ A;  5JKM A;  4TO9 A;  3E1L A;  4Y08 A;  1JRE A;  3GE4 A;  5FFA A;  3Q4O A;  1JI5 A;  5IX6 A;  4DAS A;  1AEW A;  5GU0 X;  3T9J A;  3FI6 A;  4U3G A;  1YUX A;  3E1J A;  4OYN A;  1LKM A;  2XGW A;  5E1U A;  1JTS A;  3W54 A;  3H7G A;  5K53 A;  4TOG A;  2V2N A;  5D8S A;  4KVS A;  1MFR A;  1L8I A;  5GOU A;  4XKS A;  3WVW A;  3D19 A;  2FL0 A;  3RBC A;  3PVT A;  1NFV A;  2YJK A;  1TJO A;  4TOD A;  5GU2 X;  1VEQ A;  3HL1 A;  2FG8 A;  3PVY A;  1ZS3 A;  2CIH A;  3MPS A;  2WWX B;  2VZB A;  1LB3 A;  5D8P A;  5CZU A;  1S3Q A;  3KA3 A;  2Y3Q A;  4AM5 A;  3WNW A;  3C23 A;  3F35 A;  5J8W A;  2CWL A;  4IXK A;  3UOI A;  3AJO A;  2C2J A;  2ZA7 A;  5AXS A;  4ML5 A;  2WLU A;  2V2I A;  4LQJ A;  5FFC A;  2V15 A;  4MXP A;  3QVD A;  5E2D A;  3PVR B;  3AF9 X;  5D8O A;  4ETR A;  5GU3 X;  5I4J A;  3VV9 A;  3NP2 X;  2C41 A;  5LG8 A;  4YVZ A;  4M34 A;  4RC5 B;  3C1Z A;  5JDO B;  1TK6 A;  4TOC A;  4CVR A;  1F30 A;  3PWF A;  4ZTT A;  4MJY A;  2YJJ A;  5C6F A;  4DYZ A;  1R03 A;  3V3K B;  1RCG A;  2Z5R A;  3E1Q A;  1BFR A;  3AK8 A;  3RE7 A;  1SQ3 A;  1NF4 A;  1JGC A;  2Z90 A;  5J9V A;  3RAV A;  2G4H A;  3FVB A;  2CF7 A;  3AJQ A;  3GGZ A;  4ISM A;  5D8X A;  3IS7 A;  4DYX A;  2GYD A;  2G38 B;  4RC6 B;  3PWQ A;  1RCI A;  5CMR A;  4M33 A;  5J8S A;  2ZG8 X;  2XJN A;  4ZJK A;  3IS8 A;  2AR0 A;  3E6R A;  2X17 0;  2YW6 A;  4E40 A;  4RC5 A;  3FRR A;  5JDO A;  4XKU A;  3JZ9 A;  2V8T A;  4KXR B;  3KHK A;  1Z4A A;  3C21 A;  4PGK A;  4ZKH A;  3KA4 A;  5ERK A;  3UOF A;  4ZLW A;  4DYY A;  2FFX J;  3FSE A;  5GN8 B;  1FHA A;  3GHQ A;  3Q4N A;  1LKO A;  3VNX A;  4W4K B;  4CVT A;  3Q4R A;  3QD8 A;  2FZF A;  2ZUR X;  2XKQ A;  4LYX A;  1Z6O M;  4MUD A;  1IES A;  3DBY A;  4LQH A;  3UNO A;  4A25 A;  1L8H A;  4EVD A;  4RC6 A;  4P18 A;  3ISF A;  1B71 A;  1SOF A;  3U90 A;  1O9R A;  1HRS A;  1JKV A;  4ITW A;  4R42 A;  5FFE A;  2Z5P A;  4LQV A;  4KVR A;  1BG7 A;  3R2M A;  1JKU A;  4DE6 A;  3BVL A;  3ERZ A;  2XJM A;  1UMN A;  2V8U A;  2QQY A;  3O7R A;  3PW8 C;  3F34 A;  2FHA A;  2FKZ A;  1EUM A;  2BJY A;  5GN8 A;  3RD0 A;  3PZA A;  4TOF A;  4YXJ A;  3BT5 A;  2BKC A;  4II4 B;  3BVK A;  1JYB A;  2OH3 A;  4EVB A;  4CYA A;  3KA6 A;  2V2L A;  2ITB A;  2Z5Q A;  4CVP A;  3IQ1 A;  4XKT A;  5LG2 A;  4TOH A;  3EZU A;  3QHB A;  1OTK A;  4CMY V;  4ZL5 A;  4YXM A;  4XGS A;  2UX1 A;  1VEI A;  1UVH A;  5CMQ A;  2N02 A;  3GVY A;  1TKP A;  1QGH A;  4AM4 A;  3SID A;  2HR5 A;  4Z3B A;  5HQO A;  4WJG 4;  3EZ0 A;  3F36 A;  4IWK A;  4LPJ A;  2V2J A;  1YV1 A;  3A9Q A;  2W0O A;  1RYT A;  2CN7 A;  3M6J A;  4ERU A;  2ZA8 A;  4DI0 A;  5JAC A;  4MY7 A;  4KVQ A;  3AK9 A;  4ZL6 A;  2GYQ A;  4II4 A;  3BKN A;  1MOJ A;  3F33 A;  3GGY A;  2QF9 A;  4E6K A;  3C1Y A;  3KDQ A;  1XZ1 A;  2WTL A;  2HTN A;  5GU1 X;  3F39 A;  1VJX A;  2VXI A;  5FFB A;  5D8R A;  3SH6 A;  5FFD A;  3QHC A;  4RC7 B; 
#chains in the Genus database with same CATH homology
 5K52 A;  1DAT A;  1VEL A;  1H96 A;  3O7S A;  5HU6 D;  2Z6M A;  2F7N A;  3OJ5 A;  1JIG A;  1RCD A;  5JKL G;  2C2U A;  1NNQ A;  3WVU A;  1F33 A;  2CLB A;  3R2R A;  3R2O A;  2GS4 A;  3R2K A;  1XZ3 A;  2V2P A;  4CMY A;  4DZ0 A;  3SHX A;  2V2R A;  3ISE A;  1TKO A;  3E6S A;  3PW8 A;  2XJO A;  3JZA B;  3PW1 B;  2CN6 A;  3KX9 A;  2JD7 0;  4CVS A;  4ITT A;  1J30 A;  3NOZ X;  2FJC A;  3AF8 X;  3TA8 A;  4TOA A;  2YW7 A;  3Q4Q A;  3RGD A;  4LQN A;  2MGY A;  4RC7 A;  4PGI A;  4ZKW A;  4EVC A;  1Z6O A;  4ISP A;  4PG1 A;  2JD8 0;  2BK6 A;  4MKU A;  1RCE A;  3E1M A;  3E1O A;  4YKH A;  3R2S A;  1GWG A;  5HJF A;  4LYU A;  4RC8 A;  3PWQ C;  3AF7 X;  4ZMC A;  3A68 A;  5JKM G;  2CHI A;  3KXU A;  4EVE A;  5LS9 A;  4REU A;  2OKC A;  3LKD A;  3BVI A;  3R2H A;  3PW1 A;  1JI4 A;  2IU2 A;  4X0J A;  2Y44 A;  4M35 A;  4ZKX A;  1N1Q A;  3FRS A;  2CLU A;  3F32 A;  5LBH A;  2VXX A;  3KWO A;  5J93 A;  3OGH A;  2IY4 A;  1IER A;  2PYB A;  1VLG A;  4TOB A;  1S2Z A;  1KRQ A;  3QB9 A;  3HIU A;  4LPN A;  3F38 A;  4M32 A;  4QUW A;  3E2C A;  1NF6 A;  2C2F A;  5D8Q A;  4PG0 A;  2WLA A;  2RBD A;  5ERJ A;  5JKL A;  1QYB A;  3F37 A;  3NP0 X;  1DPS A;  2ZG7 X;  4CYB A;  4Z5S A;  2V2S A;  2V2M A;  3ES3 A;  4CY9 A;  3UFB A;  3R2L A;  3AJP A;  1RCC A;  5D8Y A;  1O9I A;  1ZUJ A;  4W4L B;  2OC5 A;  3EGM A;  3VVA A;  2D5K A;  3E1N A;  2FG4 A;  1S30 A;  3KA9 A;  5HJH A;  2ZA6 A;  2ZG9 X;  4LPM A;  3L0M A;  2V2O A;  5FEJ A;  2CEI A;  4IWJ A;  3SE1 A;  4TW3 A;  4TOE A;  2BW1 A;  3KA8 A;  3PVR A;  1LKP A;  2IB0 A;  2JD6 0;  3PVT B;  3E1P A;  3N6O A;  4AM2 A;  2CHP A;  2C6R A;  1BCF A;  3BVE A;  3BVF A;  4MN9 A;  3WVV A;  1DVB A;  3PVY B;  3QZ3 A;  4DYU A;  1YUZ A;  5JKM A;  4TO9 A;  3E1L A;  4Y08 A;  1JRE A;  3GE4 A;  5FFA A;  3Q4O A;  1JI5 A;  5IX6 A;  4DAS A;  1AEW A;  5GU0 X;  3T9J A;  3FI6 A;  4U3G A;  1YUX A;  3E1J A;  4OYN A;  1LKM A;  2XGW A;  5E1U A;  1JTS A;  3W54 A;  3H7G A;  5K53 A;  4TOG A;  2V2N A;  5D8S A;  4KVS A;  1MFR A;  1L8I A;  5GOU A;  4XKS A;  3WVW A;  3D19 A;  2FL0 A;  3RBC A;  3PVT A;  1NFV A;  2YJK A;  1TJO A;  4TOD A;  5GU2 X;  1VEQ A;  3HL1 A;  2FG8 A;  3PVY A;  1ZS3 A;  2CIH A;  3MPS A;  2WWX B;  2VZB A;  1LB3 A;  5D8P A;  5CZU A;  1S3Q A;  3KA3 A;  2Y3Q A;  4AM5 A;  3WNW A;  3C23 A;  3F35 A;  5J8W A;  2CWL A;  4IXK A;  3UOI A;  3AJO A;  2C2J A;  2ZA7 A;  5AXS A;  4ML5 A;  2WLU A;  2V2I A;  4LQJ A;  5FFC A;  2V15 A;  4MXP A;  3QVD A;  5E2D A;  3PVR B;  3AF9 X;  5D8O A;  4ETR A;  5GU3 X;  5I4J A;  3VV9 A;  3NP2 X;  2C41 A;  5LG8 A;  4YVZ A;  4M34 A;  4RC5 B;  3C1Z A;  5JDO B;  1TK6 A;  4TOC A;  4CVR A;  1F30 A;  3PWF A;  4ZTT A;  4MJY A;  2YJJ A;  5C6F A;  4DYZ A;  1R03 A;  3V3K B;  1RCG A;  2Z5R A;  3E1Q A;  1BFR A;  3AK8 A;  3RE7 A;  1SQ3 A;  1NF4 A;  1JGC A;  2Z90 A;  5J9V A;  3RAV A;  2G4H A;  3FVB A;  2CF7 A;  3AJQ A;  3GGZ A;  4ISM A;  5D8X A;  3IS7 A;  4DYX A;  2GYD A;  2G38 B;  4RC6 B;  3PWQ A;  1RCI A;  5CMR A;  4M33 A;  5J8S A;  2ZG8 X;  2XJN A;  4ZJK A;  3IS8 A;  2AR0 A;  3E6R A;  2X17 0;  2YW6 A;  4E40 A;  4RC5 A;  3FRR A;  5JDO A;  4XKU A;  3JZ9 A;  2V8T A;  4KXR B;  3KHK A;  1Z4A A;  3C21 A;  4PGK A;  4ZKH A;  3KA4 A;  5ERK A;  3UOF A;  4ZLW A;  4DYY A;  2FFX J;  3FSE A;  5GN8 B;  1FHA A;  3GHQ A;  3Q4N A;  1LKO A;  3VNX A;  4W4K B;  4CVT A;  3Q4R A;  3QD8 A;  2FZF A;  2ZUR X;  2XKQ A;  4LYX A;  1Z6O M;  4MUD A;  1IES A;  3DBY A;  4LQH A;  3UNO A;  4A25 A;  1L8H A;  4EVD A;  4RC6 A;  4P18 A;  3ISF A;  1B71 A;  1SOF A;  3U90 A;  1O9R A;  1HRS A;  1JKV A;  4ITW A;  4R42 A;  5FFE A;  2Z5P A;  4LQV A;  4KVR A;  1BG7 A;  3R2M A;  1JKU A;  4DE6 A;  3BVL A;  3ERZ A;  2XJM A;  1UMN A;  2V8U A;  2QQY A;  3O7R A;  3PW8 C;  3F34 A;  2FHA A;  2FKZ A;  1EUM A;  2BJY A;  5GN8 A;  3RD0 A;  3PZA A;  4TOF A;  4YXJ A;  3BT5 A;  2BKC A;  4II4 B;  3BVK A;  1JYB A;  2OH3 A;  4EVB A;  4CYA A;  3KA6 A;  2V2L A;  2ITB A;  2Z5Q A;  4CVP A;  3IQ1 A;  4XKT A;  5LG2 A;  4TOH A;  3EZU A;  3QHB A;  1OTK A;  4CMY V;  4ZL5 A;  4YXM A;  4XGS A;  2UX1 A;  1VEI A;  1UVH A;  5CMQ A;  2N02 A;  3GVY A;  1TKP A;  1QGH A;  4AM4 A;  3SID A;  2HR5 A;  4Z3B A;  5HQO A;  4WJG 4;  3EZ0 A;  3F36 A;  4IWK A;  4LPJ A;  2V2J A;  1YV1 A;  3A9Q A;  2W0O A;  1RYT A;  2CN7 A;  3M6J A;  4ERU A;  2ZA8 A;  4DI0 A;  5JAC A;  4MY7 A;  4KVQ A;  3AK9 A;  4ZL6 A;  2GYQ A;  4II4 A;  3BKN A;  1MOJ A;  3F33 A;  3GGY A;  2QF9 A;  4E6K A;  3C1Y A;  3KDQ A;  1XZ1 A;  2WTL A;  2HTN A;  5GU1 X;  3F39 A;  1VJX A;  2VXI A;  5FFB A;  5D8R A;  3SH6 A;  5FFD A;  3QHC A;  4RC7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...