3PZAA

Fully reduced (all-ferrous) pyrococcus rubrerythrin after a 10 second exposure to peroxide.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
total genus 63
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pzaA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pzaA02
1OTKA 4RC6B 3ISEA 3PVRA 2XGWA 3PVTA 4TW3A 3PWFA 3SH6A 2K2DA 3PW1B 5CMQA 5GU3X 2UX1A 1CADA 5JKMA 3WVWA 1HRSA 2PYAA 2F7NA 1SQ3A 5IY0A 4A25A 1IROA 3EGMA 3SHXA 2ZA7A 1IU5A 1S3QA 1B13A 4LQJA 5GU1X 1TK6A 3PVYB 4TODA 3F36A 4U3GA 4QUWA 1LB3A 3E1NA 3E1JA 1IU6A 4ZKWA 2YW7A 2BJYA 1JKVA 2WLUA 2Z5RA 2CN6A 2JD80 5K52A 2CHPA 3F34A 4YKHA 3QZ3A 4YWMA 3KYXA 2RBDA 4ZKHA 5AI3A 3RBCA 4DYXA 2QL0A 3R2SA 1NF6A 1TJOA 3QHBA 4DYUA 2V2RA 1TKPA 1VJXA 3E1QA 1XZ3A 4PG1A 1FHMA 2V15A 2YJJA 2ZURX 1Z6OM 2FG4A 1SMMA 4ZL5A 5JKLG 3BVEA 5RXNA 3R2MA 1J30A 4LPJA 4RC5A 1RCDA 1YK5A 1BE7A 3WVUA 2YJKA 1YUZA 5GU0X 3E1PA 2V2JA 5D8RA 2Y3QA 4M32A 3OGHA 3KA9A 1LKMA 2PVXA 5HJFA 5I4JA 1SOFA 1QGHA 1RDGA 3KYVA 4POGA 2MS3A 3ISFA 1DPSA 1T9QA 4K9FA 2RDVA 2V2MA 2OH3A 1BQ9A 3PWQC 1E8JA 4YWLA 2C2UA 3E6RA 2OC5A 5D8QA 1JIGA 3SE1A 1R0HA 2V2SA 3ERZA 4ERUA 3RZTA 4TOCA 1Z4AA 4LPMA 3BVFA 2WLAA 4RC6A 3E6SA 3KWOA 4ISMA 4II4B 5HJHA 1FHAA 1TKOA 3F39A 3HL1A 4CMYA 2D5KA 3PW1A 4RC7B 1S24A 2ZA6A 3A44A 3Q4OA 2W0OA 2QF9A 5IX6A 3F33A 2ZG7X 4IWJA 1R0IA 3PVYA 4TOEA 3RAVA 3Q4RA 4XKTA 3QVDA 1H96A 5GN8B 1RCCA 4EVEA 4AR4A 3QHCA 2C2JA 1ZUJA 3RGDA 4LQNA 2VZBA 1BFRA 4PG0A 2FJCA 4KVSA 4LQHA 4EVBA 4MJYA 2CLBA 1JTSA 3KYUA 3U90A 1L8HA 2QQYA 1DATA 4DE6A 8RXNA 1S30A 5LG8A 1H7VA 2KN9A 1DVBA 1JI4A 3IS7A 4IWKA 5J8SA 4MKUA 4REUA 1F30A 1B71A 3R2KA 5D8PA 4ZLWA 2XJOA 2CLUA 5J93A 5AI2A 2ZA8A 3F37A 5FFAA 1R0JA 2XJMA 1O9RA 2ZG8X 1RCEA 2LCQA 4M35A 1LKPA 2Z5PA 2DSXA 2FL0A 2G4HA 3E1OA 5GOUA 5JKMG 3UOFA 3F32A 1RCGA 1QYBA 1JGCA 1CAAA 3A68A 4XGSA 1XZ1A 4CY9A 4IXKA 5FFCA 5LG2A 1B2OA 1IESA 1R03A 1R0FA 5FFEA 2V2NA 5D8OA 4MUDA 2V3BB 1UVHA 5K53A 1JREA 2HR5A 3AJPA 3FSEA 4AR3A 3H7GA 4ISPA 5GU2X 3RE7A 3PW8C 2V2LA 4CVPA 1MOJA 3MPSA 1O9IA 2ITBA 4CVSA 3QB9A 3FVBA 1BFYA 5D8SA 4E6KA 5LBHA 1L8IA 2GYDA 3O7RA 2VXIA 4DI0A 1NF4A 3A9QA 2FG8A 3E1MA 4LYUA 4M33A 4II4A 3R2HA 3F38A 1IERA 4KVQA 4RC7A 4CYBA 1C09A 2IB0A 2Z6MA 4ITWA 4Z5SA 1AEWA 3KA3A 3RD0A 4LPNA 1KRQA 5E1UA 4AM2A 1BG7A 4MY7A 1BCFA 2C41A 3F35A 5FFDA 1R0GA 1RDVA 5GN8A 2YW6A 3BKNA 1RYTA 2Z90A 1JKUA 2GYQA 2JD60 3IS8A 5CMRA 4AM5A 2FZFA 5JACA 3AJQA 3UNOA 1SMWA 2C6RA 3EZUA 2PVEA 1IRNA 1VEIA 2CIHA 2IU2A 4ZMCA 3AF8X 2BK6A 1RB9A 4XKUA 2C2FA 1SMUA 1NNQA 3BVKA 3TA8A 1S2ZA 2BKCA 3PWQA 3SIDA 2M4YA 7RXNA 4ZJKA 1B2JA 1N1QA 3Q4QA 4OYNA 4RXNA 3RYGA 3R2OA 1EUMA 4DZ0A 5D8XA 2CF7A 3KYYA 3KA6A 1ZRPA 3SS2A 1DX8A 3BVLA 3IQ1A 3KA4A 5J8WA 4TPUA 2CN7A 3Q4NA 2JD70 4TOAA 1YUXA 3BT5A 2GS4A 5AXSA 1F33A 5LS9A 3ES3A 4ZTTA 5FFBA 6RXNA 1LKOA 4TOGA 1MFRA 2PYBA 3NP0X 3KYWA 1UMNA 3PVRB 5JKLA 2CEIA 3PVTB 4PGIA 1QCVA 4Y08A 2FKZA 5E2DA 4ZL6A 2IY4A 1RCIA 3GE4A 4DYYA 4AR5A 4DASA 4M34A 3KXUA 4AM4A 1GWGA 1YK4A 5FEJA 4EVCA 3EZ0A 1T9PA 1VLGA 4ML5A 2FHAA 1T9OA 1YV1A 3NOZX 3E2CA 2CHIA 3R2LA 3AK8A 1VCXA 4AR6A 3T9JA 4P18A 4PGKA 4CMYV 2BW1A 3FI6A 3KA8A 5ERKA 1NFVA 4TOFA 5D8YA 1JYBA 5HQOA 3WVVA 3AF7X 2GMGA 1ZS3A 2VXXA 3KX9A 2V2IA 4LQVA 4LYXA 3OJ5A 4TO9A 3QD8A 2HTNA 4R42A 4RC8A 1VEQA 3VNXA 2VL6A 2XJNA 5CZUA 3RZ6A 1FHHA 1LTLA 3PZAA 2XKQA 2KKDA 4ETRA 4RC5B 2V2OA 2X170 4MN9A 4CYAA 3E1LA 3PW8A 4Z3BA 1Z6OA 4KVRA 3NP2X 3UOIA 3AK9A 4DYZA 4ZKXA 4TOBA 3HIUA 4CVTA 2FFXJ 2V2PA 3AF9X 4ME3A 4XKSA 4EVDA 3WNWA 4ITTA 3AJOA 1BRFA 1BQ8A 5C6FA 2ZG9X 2WTLA 3GVYA 4POFA 1RWDA 5ERJA 4CVRA 5J9VA 3BVIA 2Z5QA 3R2RA 1JI5A 1VELA 3GHQA 3O7SA 4TOHA
chains in the Genus database with same CATH superfamily
1OTKA 3S1QL 3GTQL 4RC6B 3ISEA 4YXJA 3PVRA 2XGWA 3L0MA 3VV9A 3PVTA 4TW3A 3PWFA 3SH6A 2K2DA 3I4ML 3PW1B 5IP9L 5CMQA 3HOZL 5GU3X 2UX1A 3WWLA 1CADA 5JKMA 3WVWA 2B63L 1HRSA 2PYAA 4XXBB 2F7NA 1SQ3A 5IY0A 4A25A 1IROA 3EGMA 3SHXA 2ZA7A 1IU5A 1S3QA 1B13A 4LQJA 5GU1X 1RYQA 1TK6A 3PVYB 5EIOC 4TODA 3F36A 3JZ9A 3S16L 3GTLL 4U3GA 2XJTA 4QUWA 1LB3A 3E1NA 3ZG6A 3E1JA 3KDQA 4ZKWA 1IU6A 2YW7A 2BJYA 2Z3RB 1JKVA 5HU6D 2WLUA 2Z5RA 3FRSA 3C1ZA 2CN6A 3PO2L 2JD80 5K52A 4A3FL 5MFZA 3LNLA 2CHPA 5JDOB 3F34A 4YKHA 3HKZP 4UY81 3QZ3A 3PO3L 4YWMA 4WJG4 2AQCA 3GTGL 3HOXL 3KYXA 2RBDA 4U671 2XJSA 4ZKHA 5AI3A 3FRRA 4A3CL 3RBCA 5GAGc 4DYXA 1QQTA 2QL0A 3R2SA 4LHNA 3LWQB 2O5JD 1NF6A 1TJOA 2PSMC 3QHBA 4DYUA 2V2RA 1TKPA 1VJXA 4A3EL 1VZIA 3E1QA 2A69D 1XZ3A 4PG1A 2N02A 2OKCA 1FHMA 2AUSB 3J7Z1 2V15A 2YJJA 2ZURX 1Z6OM 2PMZP 2FG4A 4LHLA 1SMMA 4ZL5A 1P7PA 5JKLG 3BVEA 2B5ID 4AI2A 1PFWA 5RXNA 3HAXC 4A3GL 3R2MA 1J30A 4LPJA 4RC5A 1RCDA 1YK5A 2Z3QB 1BE7A 3WVUA 5C3EL 2YJKA 1YUZA 5GU0X 3HOYL 3E1PA 2V2JA 5D8RA 2Y3QA 4M32A 2NYDA 3OGHA 4A3KL 2M6OA 3KA9A 1LKMA 4QIWP 4JAEA 2PVXA 5HJFA 5I4JA 1IW7D 5IP7L 1SOFA 2XJPA 2WAQP 1QGHA 1RDGA 3KYVA 1WJVA 2JI3A 4POGA 4KXRB 4W4LB 2MS3A 3ISFA 1DPSA 1T9QA 2J9UB 4K9FA 5M3FL 5H1Sc 2ZIXA 2AR0A 2V2MA 2OH3A 2RDVA 1BQ9A 3PWQC 5GAEc 1E8JA 3PL5A 5M5WL 3M3YL 4YWLA 1I3QL 2C2UA 3E6RA 2OC5A 5D8QA 1JIGA 3SE1A 2NVYL 1R0HA 2V2SA 5M5YL 2R7ZL 3ERZA 5JVG1 4ERUA 3RZTA 4TOCA 1Z4AA 3HOVL 3HOWL 1OWCA 4LPMA 3BVFA 3C23A 2E2JL 2WLAA 4RC6A 3E6SA 3KWOA 4ISMA 4II4B 5HJHA 1FHAA 1TKOA 3F39A 2V8TA 3HL1A 4CMYA 4BY1L 5GAHc 2D5KA 3PW1A 2NVQL 5IYDL 4RC7B 1S24A 2ZA6A 3A44A 3Q4OA 3LKDA 2W0OA 2QF9A 4MXPA 5IX6A 3JR7A 3F33A 2ZG7X 5IYBL 3MQKB 4IWJA 4X0JA 1R0IA 3PVYA 4TOEA 1PFVA 2C6AA 3RAVA 3Q4RA 3H9BA 3NFPI 4XKTA 2JA5L 3QVDA 2R92L 1H96A 5GN8B 1RCCA 4EVEA 4AR4A 3QHCA 2C2JA 1WCML 2AYJA 3N6OA 1ZUJA 4A3DL 4AHYA 3RGDA 4LQNA 2ERSA 2XJVA 4A3IL 4AHZA 5JDOA 2VZBA 3LWVB 1BFRA 3GGYA 4PG0A 2FJCA 4KVSA 4LQHA 4EVBA 4MJYA 2CLBA 5MGNA 1JTSA 3KYUA 3U90A 4JAFA 1L8HA 2QQYA 1DATA 4DE6A 2H12A 8RXNA 2JA7L 4BY7L 1S30A 5LG8A 1H7VA 4A3LL 2KN9A 1DVBA 3S1NL 4G6BA 1JI4A 3IS7A 2XJUA 3S2HL 4IWKA 5J8SA 4MKUA 2V0EA 4REUA 1F30A 1B71A 3R2KA 5D8PA 4B8CD 4ZLWA 2XJOA 4YVZA 2BE5D 2CLUA 5J93A 1NXGA 5AI2A 2ZA8A 5MFPA 3F37A 5FFAA 1R0JA 2XJMA 1O9RA 2ZG8X 1RCEA 2LCQA 4M35A 1LKPA 2Z5PA 2DSXA 2FL0A 4C3IL 3S1RL 3HOUL 2G4HA 3GTPL 3E1OA 5GOUA 5JKMG 3UOFA 3F32A 1RCGA 1QYBA 1JGCA 1CAAA 3A68A 4XGSA 1XZ1A 4CY9A 4IXKA 3V3KB 5FFCA 3P2AA 4BBRL 4JADA 5LG2A 5C44L 1B2OA 3LPEB 1IESA 3JZAB 1R03A 1R0FA 5FFEA 2V2NA 5D8OA 3H99A 4MUDA 2V3BB 1UVHA 5K53A 1JREA 2HR5A 3AJPA 5FJ8L 3FSEA 1OWBA 4AR3A 3H7GA 4ISPA 5GU2X 3RE7A 3PW8C 2V2LA 4CVPA 3PIP1 1MOJA 3MPSA 1O9IA 2ITBA 5DM61 2JA8L 3GGZA 4CVSA 3QB9A 3FVBA 3LWRB 1BFYA 5D8SA 4E6KA 2PPTA 5LBHA 1L8IA 3S14L 2GYDA 3K35A 3O7RA 2VXIA 4DI0A 1NF4A 5MLC3 3A9QA 2FG8A 3E1MA 4LYUA 4M33A 5JVH1 4II4A 3R2HA 3F38A 3GTOL 1IERA 4KVQA 4RC7A 4CYBA 1C09A 3PIO1 1Y1VL 2IB0A 2Z6MA 3D19A 4ITWA 4Z5SA 1AEWA 3KA3A 3RD0A 4LPNA 1KRQA 5DM71 1ODHA 5E1UA 4AM2A 1BG7A 4MY7A 4ZN1B 1BCFA 2C41A 4AHWA 3F35A 4C3HL 3CQZL 2JA6L 5FFDA 1R0GA 1RDVA 3I4NL 2CWLA 5GN8A 2YW6A 3BKNA 5GADc 1RYTA 5EINC 2Z90A 1JKUA 4V196 4X6AL 1TWFL 2GYQA 2JD60 3IS8A 5CMRA 4AM5A 2A68D 2FZFA 5JACA 1SFOL 1TWGL 3AJQA 1TWCL 3UNOA 4YXMA 3LWOB 3J7Y1 1SMWA 3HJWB 2V0FA 2G38B 2EY4E 2C6RA 3EZUA 4AYBP 2PVEA 3S17L 1IRNA 1VZGA 1VEIA 2CIHA 2IU2A 4ZMCA 3AF8X 2BK6A 1PFYA 1RB9A 4XKUA 2C2FA 1SMUA 1NNQA 2RFKB 3BVKA 2JI1A 4ZN3B 3TA8A 1S2ZA 4E40A 2BKCA 3PWQA 2CR8A 5C4JL 3SIDA 2M4YA 7RXNA 4ZJKA 2ERJA 1I6HL 1I50L 1B2JA 1N1QA 3Q4QA 4OYNA 2APOB 4RXNA 5C4XL 3RYGA 3R2OA 4C2M1 1EUMA 2M4VA 1PFUA 4DZ0A 3HJYB 3H9CA 5D8XA 2CF7A 3P8BA 3KYYA 3KA6A 1ZRPA 2YU9L 3H97A 3SS2A 1DX8A 3BVLA 3IQ1A 3KA4A 5J8WA 4TPUA 5M3ML 2CN7A 3M6JA 3Q4NA 2JD70 4TOAA 2L0ZA 1YUXA 3C1YA 3BT5A 5K2ME 2GS4A 5AXSA 1F33A 3FDJA 5M5XL 5LS9A 3ES3A 5IYCL 1NXEA 4ZTTA 5FFBA 6RXNA 1LKOA 4TOGA 2Y0SP 3H0GL 3QQCE 2XJQA 2HVYC 1MFRA 2Y44A 2PYBA 3NP0X 1F4LA 3KYWA 1UMNA 3PVRB 5JKLA 2CEIA 3PVTB 4PGIA 1QCVA 3PKIA 4Y08A 3WWNB 2FKZA 5E2DA 4AHXA 4ZL6A 2IY4A 1RCIA 2NVTL 2JI2A 3GE4A 4DYYA 4GS7D 4AI3A 4AR5A 2XJRA 4DASA 4M34A 3KXUA 4AM4A 5FLML 1GWGA 1YK4A 3FKIL 3KHKA 4AI0A 5FEJA 4EVCA 3EZ0A 1T9PA 3GTJL 3DBYA 1VLGA 4ML5A 2FHAA 3W54A 1T9OA 4E6YA 3S1ML 1YV1A 3NOZX 3E2CA 2CHIA 3R2LA 3AK8A 1VCXA 2M6PA 4AR6A 3T9JA 3IU3I 4TVMA 4P18A 4PGKA 4CMYV 2BW1A 3FI6A 3KA8A 5ERKA 1NFVA 2CKAA 1K83L 4TOFA 5D8YA 1JYBA 5HQOA 3WVVA 4C3JL 3M4OL 3AF7X 2GMGA 3LWPB 3GTKL 1ZS3A 3VPBE 4Y52L 4A3ML 2VXXA 3KX9A 2V2IA 4LQVA 4Y7NL 4LYXA 2E2HL 3OJ5A 2A6ED 2WWXB 4TO9A 1TWAL 3QD8A 1VZHA 2C6BA 4XGHA 2HTNA 4R42A 4RC8A 1VEQA 2R93L 3VNXA 2VL6A 2XJNA 3B0AB 5CZUA 3RZ6A 1FHHA 1LTLA 3PZAA 4WFN1 2XKQA 1PZXA 2KKDA 4ETRA 2NVXL 3S2DL 3K7AL 3RZDL 4RC5B 2V2OA 2MGYA 2X170 4MN9A 5MF6A 4A93L 4CYAA 3E1LA 3PW8A 4Z3BA 1Z6OA 1Z92B 4AI1A 3GTML 4KVRA 3NP2X 3UOIA 3B08B 3AK9A 2CKCA 3RZOL 4DYZA 4ZKXA 4BXXL 4JAGA 3C21A 4A3BL 1R9TL 4TOBA 2V8UA 3HIUA 4CVTA 4BBSL 4A3JL 2FFXJ 2E2IL 2V2PA 3AF9X 4ME3A 4XKSA 4EVDA 5AN9H 3MSUA 3WNWA 3H3VM 4ITTA 3AJOA 1BRFA 4W4KB 3PKJA 1Y1WL 3S15L 2A6HD 2VUML 1BQ8A 3VVAA 2WB1P 5C6FA 2ZG9X 2WTLA 3GVYA 4POFA 1RWDA 5ERJA 4CVRA 5J9VA 3BVIA 2Z5QA 3R2RA 1TWHL 1JI5A 1VELA 3GHQA 3O7SA 3UFBA 4TOHA
chains in the Genus database with same CATH topology
1OTKA 4RC6B 3ISEA 4YXJA 3PVRA 2XGWA 3L0MA 3VV9A 3PVTA 4TW3A 3PWFA 3SH6A 2K2DA 3PW1B 5CMQA 5GU3X 2UX1A 3WWLA 1CADA 5JKMA 3WVWA 1HRSA 2PYAA 4XXBB 2F7NA 1SQ3A 5IY0A 4A25A 1IROA 3EGMA 3SHXA 2ZA7A 1IU5A 1S3QA 1B13A 4LQJA 5GU1X 1RYQA 1TK6A 3PVYB 5EIOC 4TODA 3F36A 3JZ9A 4U3GA 2XJTA 4QUWA 1LB3A 3E1NA 3ZG6A 3E1JA 3KDQA 4ZKWA 1IU6A 2YW7A 2BJYA 2Z3RB 1JKVA 5HU6D 2WLUA 2Z5RA 3FRSA 3C1ZA 2CN6A 2JD80 5K52A 5MFZA 3LNLA 2CHPA 5JDOB 3F34A 4YKHA 4UY81 3QZ3A 4YWMA 4WJG4 3KYXA 2RBDA 4U671 2XJSA 4ZKHA 5AI3A 3FRRA 3RBCA 5GAGc 4DYXA 2QL0A 3R2SA 4LHNA 2O5JD 1NF6A 1TJOA 2PSMC 3QHBA 4DYUA 2V2RA 1TKPA 1VJXA 1VZIA 3E1QA 2A69D 1XZ3A 4PG1A 2N02A 2OKCA 1FHMA 3J7Z1 2V15A 2YJJA 2ZURX 1Z6OM 2FG4A 4LHLA 1SMMA 4ZL5A 4AI2A 5JKLG 3BVEA 2B5ID 5RXNA 3R2MA 1J30A 4LPJA 4RC5A 1RCDA 1YK5A 2Z3QB 1BE7A 3WVUA 2YJKA 1YUZA 5GU0X 3E1PA 2V2JA 5D8RA 2Y3QA 4M32A 2NYDA 3OGHA 2M6OA 3KA9A 1LKMA 4JAEA 2PVXA 5HJFA 5I4JA 1IW7D 1SOFA 2XJPA 1QGHA 1RDGA 3KYVA 1WJVA 2JI3A 4POGA 4KXRB 4W4LB 2MS3A 3ISFA 1DPSA 1T9QA 2J9UB 4K9FA 5H1Sc 2ZIXA 2AR0A 2V2MA 2OH3A 2RDVA 1BQ9A 3PWQC 5GAEc 1E8JA 4YWLA 2C2UA 3E6RA 2OC5A 5D8QA 1JIGA 3SE1A 1R0HA 2V2SA 3ERZA 5JVG1 4ERUA 3RZTA 4TOCA 1Z4AA 1OWCA 4LPMA 3BVFA 3C23A 2WLAA 4RC6A 3E6SA 3KWOA 4ISMA 4II4B 5HJHA 1FHAA 1TKOA 3F39A 2V8TA 3HL1A 4CMYA 5GAHc 2D5KA 3PW1A 4RC7B 1S24A 2ZA6A 3A44A 3Q4OA 3LKDA 2W0OA 2QF9A 4MXPA 5IX6A 3F33A 2ZG7X 4IWJA 4X0JA 1R0IA 3PVYA 4TOEA 2C6AA 3RAVA 3Q4RA 3NFPI 4XKTA 3QVDA 1H96A 5GN8B 1RCCA 4EVEA 4AR4A 3QHCA 2C2JA 2AYJA 3N6OA 1ZUJA 4AHYA 3RGDA 4LQNA 2ERSA 2XJVA 4AHZA 5JDOA 2VZBA 1BFRA 3GGYA 4PG0A 2FJCA 4KVSA 4LQHA 4EVBA 4MJYA 2CLBA 5MGNA 1JTSA 3KYUA 3U90A 4JAFA 1L8HA 2QQYA 1DATA 4DE6A 2H12A 8RXNA 1S30A 5LG8A 1H7VA 2KN9A 1DVBA 4G6BA 1JI4A 3IS7A 2XJUA 4IWKA 5J8SA 4MKUA 2V0EA 4REUA 1F30A 1B71A 3R2KA 5D8PA 4B8CD 4ZLWA 2XJOA 4YVZA 2BE5D 2CLUA 5J93A 1NXGA 5AI2A 2ZA8A 5MFPA 3F37A 5FFAA 1R0JA 2XJMA 1O9RA 2ZG8X 1RCEA 2LCQA 4M35A 1LKPA 2Z5PA 2DSXA 2FL0A 2G4HA 3E1OA 5GOUA 5JKMG 3UOFA 3F32A 1RCGA 1QYBA 1JGCA 1CAAA 3A68A 4XGSA 1XZ1A 4CY9A 4IXKA 3V3KB 5FFCA 3P2AA 4JADA 5LG2A 1B2OA 3LPEB 1IESA 3JZAB 1R03A 1R0FA 5FFEA 2V2NA 5D8OA 4MUDA 2V3BB 1UVHA 5K53A 1JREA 2HR5A 3AJPA 3FSEA 1OWBA 4AR3A 3H7GA 4ISPA 5GU2X 3RE7A 3PW8C 2V2LA 4CVPA 3PIP1 1MOJA 3MPSA 1O9IA 2ITBA 5DM61 3GGZA 4CVSA 3QB9A 3FVBA 1BFYA 5D8SA 4E6KA 2PPTA 5LBHA 1L8IA 2GYDA 3K35A 3O7RA 2VXIA 4DI0A 1NF4A 5MLC3 3A9QA 2FG8A 3E1MA 4LYUA 4M33A 5JVH1 4II4A 3R2HA 3F38A 1IERA 4KVQA 4RC7A 4CYBA 1C09A 3PIO1 2IB0A 2Z6MA 3D19A 4ITWA 4Z5SA 1AEWA 3KA3A 3RD0A 4LPNA 1KRQA 5DM71 1ODHA 5E1UA 4AM2A 1BG7A 4MY7A 4ZN1B 1BCFA 2C41A 4AHWA 3F35A 5FFDA 1R0GA 1RDVA 2CWLA 5GN8A 2YW6A 3BKNA 5GADc 1RYTA 5EINC 2Z90A 1JKUA 4V196 2GYQA 2JD60 3IS8A 5CMRA 4AM5A 2A68D 2FZFA 5JACA 3AJQA 3UNOA 4YXMA 3J7Y1 1SMWA 2V0FA 2G38B 2C6RA 3EZUA 2PVEA 1IRNA 1VZGA 1VEIA 2CIHA 2IU2A 4ZMCA 3AF8X 2BK6A 1RB9A 4XKUA 2C2FA 1SMUA 1NNQA 3BVKA 2JI1A 4ZN3B 3TA8A 1S2ZA 4E40A 2BKCA 3PWQA 2CR8A 3SIDA 2M4YA 7RXNA 4ZJKA 2ERJA 1B2JA 1N1QA 3Q4QA 4OYNA 4RXNA 3RYGA 3R2OA 1EUMA 2M4VA 4DZ0A 5D8XA 2CF7A 3P8BA 3KYYA 3KA6A 1ZRPA 3SS2A 1DX8A 3BVLA 3IQ1A 3KA4A 5J8WA 4TPUA 2CN7A 3M6JA 3Q4NA 2JD70 4TOAA 2L0ZA 1YUXA 3C1YA 3BT5A 5K2ME 2GS4A 5AXSA 1F33A 5LS9A 3ES3A 1NXEA 4ZTTA 5FFBA 6RXNA 1LKOA 4TOGA 3QQCE 2XJQA 1MFRA 2Y44A 2PYBA 3NP0X 3KYWA 1UMNA 3PVRB 5JKLA 2CEIA 3PVTB 4PGIA 1QCVA 3PKIA 4Y08A 3WWNB 2FKZA 5E2DA 4AHXA 4ZL6A 2IY4A 1RCIA 2JI2A 3GE4A 4DYYA 4GS7D 4AI3A 4AR5A 2XJRA 4DASA 4M34A 3KXUA 4AM4A 1GWGA 1YK4A 3KHKA 4AI0A 5FEJA 4EVCA 3EZ0A 1T9PA 3DBYA 1VLGA 4ML5A 2FHAA 3W54A 1T9OA 4E6YA 1YV1A 3NOZX 3E2CA 2CHIA 3R2LA 3AK8A 1VCXA 2M6PA 4AR6A 3T9JA 3IU3I 4TVMA 4P18A 4PGKA 4CMYV 2BW1A 3FI6A 3KA8A 5ERKA 1NFVA 2CKAA 4TOFA 5D8YA 1JYBA 5HQOA 3WVVA 3AF7X 2GMGA 1ZS3A 3VPBE 2VXXA 3KX9A 2V2IA 4LQVA 4LYXA 3OJ5A 2A6ED 2WWXB 4TO9A 3QD8A 1VZHA 2C6BA 4XGHA 2HTNA 4R42A 4RC8A 1VEQA 3VNXA 2VL6A 2XJNA 3B0AB 5CZUA 3RZ6A 1FHHA 1LTLA 3PZAA 4WFN1 2XKQA 2KKDA 4ETRA 4RC5B 2V2OA 2MGYA 2X170 4MN9A 5MF6A 4CYAA 3E1LA 3PW8A 4Z3BA 1Z6OA 1Z92B 4AI1A 4KVRA 3NP2X 3UOIA 3B08B 3AK9A 2CKCA 4DYZA 4ZKXA 4JAGA 3C21A 4TOBA 2V8UA 3HIUA 4CVTA 2FFXJ 2V2PA 3AF9X 4ME3A 4XKSA 4EVDA 5AN9H 3MSUA 3WNWA 4ITTA 3AJOA 1BRFA 4W4KB 3PKJA 2A6HD 1BQ8A 3VVAA 5C6FA 2ZG9X 2WTLA 3GVYA 4POFA 1RWDA 5ERJA 4CVRA 5J9VA 3BVIA 2Z5QA 3R2RA 1JI5A 1VELA 3GHQA 3O7SA 3UFBA 4TOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTK A;  4RC6 B;  3ISE A;  3PVR A;  2XGW A;  3PVT A;  4TW3 A;  3PWF A;  3SH6 A;  2K2D A;  3PW1 B;  5CMQ A;  5GU3 X;  2UX1 A;  1CAD A;  5JKM A;  3WVW A;  1HRS A;  2PYA A;  2F7N A;  1SQ3 A;  5IY0 A;  4A25 A;  1IRO A;  3EGM A;  3SHX A;  2ZA7 A;  1IU5 A;  1S3Q A;  1B13 A;  4LQJ A;  5GU1 X;  1TK6 A;  3PVY B;  4TOD A;  3F36 A;  4U3G A;  4QUW A;  1LB3 A;  3E1N A;  3E1J A;  1IU6 A;  4ZKW A;  2YW7 A;  2BJY A;  1JKV A;  2WLU A;  2Z5R A;  2CN6 A;  2JD8 0;  5K52 A;  2CHP A;  3F34 A;  4YKH A;  3QZ3 A;  4YWM A;  3KYX A;  2RBD A;  4ZKH A;  5AI3 A;  3RBC A;  4DYX A;  2QL0 A;  3R2S A;  1NF6 A;  1TJO A;  3QHB A;  4DYU A;  2V2R A;  1TKP A;  1VJX A;  3E1Q A;  1XZ3 A;  4PG1 A;  1FHM A;  2V15 A;  2YJJ A;  2ZUR X;  1Z6O M;  2FG4 A;  1SMM A;  4ZL5 A;  5JKL G;  3BVE A;  5RXN A;  3R2M A;  1J30 A;  4LPJ A;  4RC5 A;  1RCD A;  1YK5 A;  1BE7 A;  3WVU A;  2YJK A;  1YUZ A;  5GU0 X;  3E1P A;  2V2J A;  5D8R A;  2Y3Q A;  4M32 A;  3OGH A;  3KA9 A;  1LKM A;  2PVX A;  5HJF A;  5I4J A;  1SOF A;  1QGH A;  1RDG A;  3KYV A;  4POG A;  2MS3 A;  3ISF A;  1DPS A;  1T9Q A;  4K9F A;  2RDV A;  2V2M A;  2OH3 A;  1BQ9 A;  3PWQ C;  1E8J A;  4YWL A;  2C2U A;  3E6R A;  2OC5 A;  5D8Q A;  1JIG A;  3SE1 A;  1R0H A;  2V2S A;  3ERZ A;  4ERU A;  3RZT A;  4TOC A;  1Z4A A;  4LPM A;  3BVF A;  2WLA A;  4RC6 A;  3E6S A;  3KWO A;  4ISM A;  4II4 B;  5HJH A;  1FHA A;  1TKO A;  3F39 A;  3HL1 A;  4CMY A;  2D5K A;  3PW1 A;  4RC7 B;  1S24 A;  2ZA6 A;  3A44 A;  3Q4O A;  2W0O A;  2QF9 A;  5IX6 A;  3F33 A;  2ZG7 X;  4IWJ A;  1R0I A;  3PVY A;  4TOE A;  3RAV A;  3Q4R A;  4XKT A;  3QVD A;  1H96 A;  5GN8 B;  1RCC A;  4EVE A;  4AR4 A;  3QHC A;  2C2J A;  1ZUJ A;  3RGD A;  4LQN A;  2VZB A;  1BFR A;  4PG0 A;  2FJC A;  4KVS A;  4LQH A;  4EVB A;  4MJY A;  2CLB A;  1JTS A;  3KYU A;  3U90 A;  1L8H A;  2QQY A;  1DAT A;  4DE6 A;  8RXN A;  1S30 A;  5LG8 A;  1H7V A;  2KN9 A;  1DVB A;  1JI4 A;  3IS7 A;  4IWK A;  5J8S A;  4MKU A;  4REU A;  1F30 A;  1B71 A;  3R2K A;  5D8P A;  4ZLW A;  2XJO A;  2CLU A;  5J93 A;  5AI2 A;  2ZA8 A;  3F37 A;  5FFA A;  1R0J A;  2XJM A;  1O9R A;  2ZG8 X;  1RCE A;  2LCQ A;  4M35 A;  1LKP A;  2Z5P A;  2DSX A;  2FL0 A;  2G4H A;  3E1O A;  5GOU A;  5JKM G;  3UOF A;  3F32 A;  1RCG A;  1QYB A;  1JGC A;  1CAA A;  3A68 A;  4XGS A;  1XZ1 A;  4CY9 A;  4IXK A;  5FFC A;  5LG2 A;  1B2O A;  1IES A;  1R03 A;  1R0F A;  5FFE A;  2V2N A;  5D8O A;  4MUD A;  2V3B B;  1UVH A;  5K53 A;  1JRE A;  2HR5 A;  3AJP A;  3FSE A;  4AR3 A;  3H7G A;  4ISP A;  5GU2 X;  3RE7 A;  3PW8 C;  2V2L A;  4CVP A;  1MOJ A;  3MPS A;  1O9I A;  2ITB A;  4CVS A;  3QB9 A;  3FVB A;  1BFY A;  5D8S A;  4E6K A;  5LBH A;  1L8I A;  2GYD A;  3O7R A;  2VXI A;  4DI0 A;  1NF4 A;  3A9Q A;  2FG8 A;  3E1M A;  4LYU A;  4M33 A;  4II4 A;  3R2H A;  3F38 A;  1IER A;  4KVQ A;  4RC7 A;  4CYB A;  1C09 A;  2IB0 A;  2Z6M A;  4ITW A;  4Z5S A;  1AEW A;  3KA3 A;  3RD0 A;  4LPN A;  1KRQ A;  5E1U A;  4AM2 A;  1BG7 A;  4MY7 A;  1BCF A;  2C41 A;  3F35 A;  5FFD A;  1R0G A;  1RDV A;  5GN8 A;  2YW6 A;  3BKN A;  1RYT A;  2Z90 A;  1JKU A;  2GYQ A;  2JD6 0;  3IS8 A;  5CMR A;  4AM5 A;  2FZF A;  5JAC A;  3AJQ A;  3UNO A;  1SMW A;  2C6R A;  3EZU A;  2PVE A;  1IRN A;  1VEI A;  2CIH A;  2IU2 A;  4ZMC A;  3AF8 X;  2BK6 A;  1RB9 A;  4XKU A;  2C2F A;  1SMU A;  1NNQ A;  3BVK A;  3TA8 A;  1S2Z A;  2BKC A;  3PWQ A;  3SID A;  2M4Y A;  7RXN A;  4ZJK A;  1B2J A;  1N1Q A;  3Q4Q A;  4OYN A;  4RXN A;  3RYG A;  3R2O A;  1EUM A;  4DZ0 A;  5D8X A;  2CF7 A;  3KYY A;  3KA6 A;  1ZRP A;  3SS2 A;  1DX8 A;  3BVL A;  3IQ1 A;  3KA4 A;  5J8W A;  4TPU A;  2CN7 A;  3Q4N A;  2JD7 0;  4TOA A;  1YUX A;  3BT5 A;  2GS4 A;  5AXS A;  1F33 A;  5LS9 A;  3ES3 A;  4ZTT A;  5FFB A;  6RXN A;  1LKO A;  4TOG A;  1MFR A;  2PYB A;  3NP0 X;  3KYW A;  1UMN A;  3PVR B;  5JKL A;  2CEI A;  3PVT B;  4PGI A;  1QCV A;  4Y08 A;  2FKZ A;  5E2D A;  4ZL6 A;  2IY4 A;  1RCI A;  3GE4 A;  4DYY A;  4AR5 A;  4DAS A;  4M34 A;  3KXU A;  4AM4 A;  1GWG A;  1YK4 A;  5FEJ A;  4EVC A;  3EZ0 A;  1T9P A;  1VLG A;  4ML5 A;  2FHA A;  1T9O A;  1YV1 A;  3NOZ X;  3E2C A;  2CHI A;  3R2L A;  3AK8 A;  1VCX A;  4AR6 A;  3T9J A;  4P18 A;  4PGK A;  4CMY V;  2BW1 A;  3FI6 A;  3KA8 A;  5ERK A;  1NFV A;  4TOF A;  5D8Y A;  1JYB A;  5HQO A;  3WVV A;  3AF7 X;  2GMG A;  1ZS3 A;  2VXX A;  3KX9 A;  2V2I A;  4LQV A;  4LYX A;  3OJ5 A;  4TO9 A;  3QD8 A;  2HTN A;  4R42 A;  4RC8 A;  1VEQ A;  3VNX A;  2VL6 A;  2XJN A;  5CZU A;  3RZ6 A;  1FHH A;  1LTL A;  3PZA A;  2XKQ A;  2KKD A;  4ETR A;  4RC5 B;  2V2O A;  2X17 0;  4MN9 A;  4CYA A;  3E1L A;  3PW8 A;  4Z3B A;  1Z6O A;  4KVR A;  3NP2 X;  3UOI A;  3AK9 A;  4DYZ A;  4ZKX A;  4TOB A;  3HIU A;  4CVT A;  2FFX J;  2V2P A;  3AF9 X;  4ME3 A;  4XKS A;  4EVD A;  3WNW A;  4ITT A;  3AJO A;  1BRF A;  1BQ8 A;  5C6F A;  2ZG9 X;  2WTL A;  3GVY A;  4POF A;  1RWD A;  5ERJ A;  4CVR A;  5J9V A;  3BVI A;  2Z5Q A;  3R2R A;  1JI5 A;  1VEL A;  3GHQ A;  3O7S A;  4TOH A; 
#chains in the Genus database with same CATH topology
 1OTK A;  3S1Q L;  3GTQ L;  4RC6 B;  3ISE A;  4YXJ A;  3PVR A;  2XGW A;  3L0M A;  3VV9 A;  3PVT A;  4TW3 A;  3PWF A;  3SH6 A;  2K2D A;  3I4M L;  3PW1 B;  5IP9 L;  5CMQ A;  3HOZ L;  5GU3 X;  2UX1 A;  3WWL A;  1CAD A;  5JKM A;  3WVW A;  2B63 L;  1HRS A;  2PYA A;  4XXB B;  2F7N A;  1SQ3 A;  5IY0 A;  4A25 A;  1IRO A;  3EGM A;  3SHX A;  2ZA7 A;  1IU5 A;  1S3Q A;  1B13 A;  4LQJ A;  5GU1 X;  1RYQ A;  1TK6 A;  3PVY B;  5EIO C;  4TOD A;  3F36 A;  3JZ9 A;  3S16 L;  3GTL L;  4U3G A;  2XJT A;  4QUW A;  1LB3 A;  3E1N A;  3ZG6 A;  3E1J A;  3KDQ A;  4ZKW A;  1IU6 A;  2YW7 A;  2BJY A;  2Z3R B;  1JKV A;  5HU6 D;  2WLU A;  2Z5R A;  3FRS A;  3C1Z A;  2CN6 A;  3PO2 L;  2JD8 0;  5K52 A;  4A3F L;  5MFZ A;  3LNL A;  2CHP A;  5JDO B;  3F34 A;  4YKH A;  3HKZ P;  4UY8 1;  3QZ3 A;  3PO3 L;  4YWM A;  4WJG 4;  2AQC A;  3GTG L;  3HOX L;  3KYX A;  2RBD A;  4U67 1;  2XJS A;  4ZKH A;  5AI3 A;  3FRR A;  4A3C L;  3RBC A;  5GAG c;  4DYX A;  1QQT A;  2QL0 A;  3R2S A;  4LHN A;  3LWQ B;  2O5J D;  1NF6 A;  1TJO A;  2PSM C;  3QHB A;  4DYU A;  2V2R A;  1TKP A;  1VJX A;  4A3E L;  1VZI A;  3E1Q A;  2A69 D;  1XZ3 A;  4PG1 A;  2N02 A;  2OKC A;  1FHM A;  2AUS B;  3J7Z 1;  2V15 A;  2YJJ A;  2ZUR X;  1Z6O M;  2PMZ P;  2FG4 A;  4LHL A;  1SMM A;  4ZL5 A;  1P7P A;  5JKL G;  3BVE A;  2B5I D;  4AI2 A;  1PFW A;  5RXN A;  3HAX C;  4A3G L;  3R2M A;  1J30 A;  4LPJ A;  4RC5 A;  1RCD A;  1YK5 A;  2Z3Q B;  1BE7 A;  3WVU A;  5C3E L;  2YJK A;  1YUZ A;  5GU0 X;  3HOY L;  3E1P A;  2V2J A;  5D8R A;  2Y3Q A;  4M32 A;  2NYD A;  3OGH A;  4A3K L;  2M6O A;  3KA9 A;  1LKM A;  4QIW P;  4JAE A;  2PVX A;  5HJF A;  5I4J A;  1IW7 D;  5IP7 L;  1SOF A;  2XJP A;  2WAQ P;  1QGH A;  1RDG A;  3KYV A;  1WJV A;  2JI3 A;  4POG A;  4KXR B;  4W4L B;  2MS3 A;  3ISF A;  1DPS A;  1T9Q A;  2J9U B;  4K9F A;  5M3F L;  5H1S c;  2ZIX A;  2AR0 A;  2V2M A;  2OH3 A;  2RDV A;  1BQ9 A;  3PWQ C;  5GAE c;  1E8J A;  3PL5 A;  5M5W L;  3M3Y L;  4YWL A;  1I3Q L;  2C2U A;  3E6R A;  2OC5 A;  5D8Q A;  1JIG A;  3SE1 A;  2NVY L;  1R0H A;  2V2S A;  5M5Y L;  2R7Z L;  3ERZ A;  5JVG 1;  4ERU A;  3RZT A;  4TOC A;  1Z4A A;  3HOV L;  3HOW L;  1OWC A;  4LPM A;  3BVF A;  3C23 A;  2E2J L;  2WLA A;  4RC6 A;  3E6S A;  3KWO A;  4ISM A;  4II4 B;  5HJH A;  1FHA A;  1TKO A;  3F39 A;  2V8T A;  3HL1 A;  4CMY A;  4BY1 L;  5GAH c;  2D5K A;  3PW1 A;  2NVQ L;  5IYD L;  4RC7 B;  1S24 A;  2ZA6 A;  3A44 A;  3Q4O A;  3LKD A;  2W0O A;  2QF9 A;  4MXP A;  5IX6 A;  3JR7 A;  3F33 A;  2ZG7 X;  5IYB L;  3MQK B;  4IWJ A;  4X0J A;  1R0I A;  3PVY A;  4TOE A;  1PFV A;  2C6A A;  3RAV A;  3Q4R A;  3H9B A;  3NFP I;  4XKT A;  2JA5 L;  3QVD A;  2R92 L;  1H96 A;  5GN8 B;  1RCC A;  4EVE A;  4AR4 A;  3QHC A;  2C2J A;  1WCM L;  2AYJ A;  3N6O A;  1ZUJ A;  4A3D L;  4AHY A;  3RGD A;  4LQN A;  2ERS A;  2XJV A;  4A3I L;  4AHZ A;  5JDO A;  2VZB A;  3LWV B;  1BFR A;  3GGY A;  4PG0 A;  2FJC A;  4KVS A;  4LQH A;  4EVB A;  4MJY A;  2CLB A;  5MGN A;  1JTS A;  3KYU A;  3U90 A;  4JAF A;  1L8H A;  2QQY A;  1DAT A;  4DE6 A;  2H12 A;  8RXN A;  2JA7 L;  4BY7 L;  1S30 A;  5LG8 A;  1H7V A;  4A3L L;  2KN9 A;  1DVB A;  3S1N L;  4G6B A;  1JI4 A;  3IS7 A;  2XJU A;  3S2H L;  4IWK A;  5J8S A;  4MKU A;  2V0E A;  4REU A;  1F30 A;  1B71 A;  3R2K A;  5D8P A;  4B8C D;  4ZLW A;  2XJO A;  4YVZ A;  2BE5 D;  2CLU A;  5J93 A;  1NXG A;  5AI2 A;  2ZA8 A;  5MFP A;  3F37 A;  5FFA A;  1R0J A;  2XJM A;  1O9R A;  2ZG8 X;  1RCE A;  2LCQ A;  4M35 A;  1LKP A;  2Z5P A;  2DSX A;  2FL0 A;  4C3I L;  3S1R L;  3HOU L;  2G4H A;  3GTP L;  3E1O A;  5GOU A;  5JKM G;  3UOF A;  3F32 A;  1RCG A;  1QYB A;  1JGC A;  1CAA A;  3A68 A;  4XGS A;  1XZ1 A;  4CY9 A;  4IXK A;  3V3K B;  5FFC A;  3P2A A;  4BBR L;  4JAD A;  5LG2 A;  5C44 L;  1B2O A;  3LPE B;  1IES A;  3JZA B;  1R03 A;  1R0F A;  5FFE A;  2V2N A;  5D8O A;  3H99 A;  4MUD A;  2V3B B;  1UVH A;  5K53 A;  1JRE A;  2HR5 A;  3AJP A;  5FJ8 L;  3FSE A;  1OWB A;  4AR3 A;  3H7G A;  4ISP A;  5GU2 X;  3RE7 A;  3PW8 C;  2V2L A;  4CVP A;  3PIP 1;  1MOJ A;  3MPS A;  1O9I A;  2ITB A;  5DM6 1;  2JA8 L;  3GGZ A;  4CVS A;  3QB9 A;  3FVB A;  3LWR B;  1BFY A;  5D8S A;  4E6K A;  2PPT A;  5LBH A;  1L8I A;  3S14 L;  2GYD A;  3K35 A;  3O7R A;  2VXI A;  4DI0 A;  1NF4 A;  5MLC 3;  3A9Q A;  2FG8 A;  3E1M A;  4LYU A;  4M33 A;  5JVH 1;  4II4 A;  3R2H A;  3F38 A;  3GTO L;  1IER A;  4KVQ A;  4RC7 A;  4CYB A;  1C09 A;  3PIO 1;  1Y1V L;  2IB0 A;  2Z6M A;  3D19 A;  4ITW A;  4Z5S A;  1AEW A;  3KA3 A;  3RD0 A;  4LPN A;  1KRQ A;  5DM7 1;  1ODH A;  5E1U A;  4AM2 A;  1BG7 A;  4MY7 A;  4ZN1 B;  1BCF A;  2C41 A;  4AHW A;  3F35 A;  4C3H L;  3CQZ L;  2JA6 L;  5FFD A;  1R0G A;  1RDV A;  3I4N L;  2CWL A;  5GN8 A;  2YW6 A;  3BKN A;  5GAD c;  1RYT A;  5EIN C;  2Z90 A;  1JKU A;  4V19 6;  4X6A L;  1TWF L;  2GYQ A;  2JD6 0;  3IS8 A;  5CMR A;  4AM5 A;  2A68 D;  2FZF A;  5JAC A;  1SFO L;  1TWG L;  3AJQ A;  1TWC L;  3UNO A;  4YXM A;  3LWO B;  3J7Y 1;  1SMW A;  3HJW B;  2V0F A;  2G38 B;  2EY4 E;  2C6R A;  3EZU A;  4AYB P;  2PVE A;  3S17 L;  1IRN A;  1VZG A;  1VEI A;  2CIH A;  2IU2 A;  4ZMC A;  3AF8 X;  2BK6 A;  1PFY A;  1RB9 A;  4XKU A;  2C2F A;  1SMU A;  1NNQ A;  2RFK B;  3BVK A;  2JI1 A;  4ZN3 B;  3TA8 A;  1S2Z A;  4E40 A;  2BKC A;  3PWQ A;  2CR8 A;  5C4J L;  3SID A;  2M4Y A;  7RXN A;  4ZJK A;  2ERJ A;  1I6H L;  1I50 L;  1B2J A;  1N1Q A;  3Q4Q A;  4OYN A;  2APO B;  4RXN A;  5C4X L;  3RYG A;  3R2O A;  4C2M 1;  1EUM A;  2M4V A;  1PFU A;  4DZ0 A;  3HJY B;  3H9C A;  5D8X A;  2CF7 A;  3P8B A;  3KYY A;  3KA6 A;  1ZRP A;  2YU9 L;  3H97 A;  3SS2 A;  1DX8 A;  3BVL A;  3IQ1 A;  3KA4 A;  5J8W A;  4TPU A;  5M3M L;  2CN7 A;  3M6J A;  3Q4N A;  2JD7 0;  4TOA A;  2L0Z A;  1YUX A;  3C1Y A;  3BT5 A;  5K2M E;  2GS4 A;  5AXS A;  1F33 A;  3FDJ A;  5M5X L;  5LS9 A;  3ES3 A;  5IYC L;  1NXE A;  4ZTT A;  5FFB A;  6RXN A;  1LKO A;  4TOG A;  2Y0S P;  3H0G L;  3QQC E;  2XJQ A;  2HVY C;  1MFR A;  2Y44 A;  2PYB A;  3NP0 X;  1F4L A;  3KYW A;  1UMN A;  3PVR B;  5JKL A;  2CEI A;  3PVT B;  4PGI A;  1QCV A;  3PKI A;  4Y08 A;  3WWN B;  2FKZ A;  5E2D A;  4AHX A;  4ZL6 A;  2IY4 A;  1RCI A;  2NVT L;  2JI2 A;  3GE4 A;  4DYY A;  4GS7 D;  4AI3 A;  4AR5 A;  2XJR A;  4DAS A;  4M34 A;  3KXU A;  4AM4 A;  5FLM L;  1GWG A;  1YK4 A;  3FKI L;  3KHK A;  4AI0 A;  5FEJ A;  4EVC A;  3EZ0 A;  1T9P A;  3GTJ L;  3DBY A;  1VLG A;  4ML5 A;  2FHA A;  3W54 A;  1T9O A;  4E6Y A;  3S1M L;  1YV1 A;  3NOZ X;  3E2C A;  2CHI A;  3R2L A;  3AK8 A;  1VCX A;  2M6P A;  4AR6 A;  3T9J A;  3IU3 I;  4TVM A;  4P18 A;  4PGK A;  4CMY V;  2BW1 A;  3FI6 A;  3KA8 A;  5ERK A;  1NFV A;  2CKA A;  1K83 L;  4TOF A;  5D8Y A;  1JYB A;  5HQO A;  3WVV A;  4C3J L;  3M4O L;  3AF7 X;  2GMG A;  3LWP B;  3GTK L;  1ZS3 A;  3VPB E;  4Y52 L;  4A3M L;  2VXX A;  3KX9 A;  2V2I A;  4LQV A;  4Y7N L;  4LYX A;  2E2H L;  3OJ5 A;  2A6E D;  2WWX B;  4TO9 A;  1TWA L;  3QD8 A;  1VZH A;  2C6B A;  4XGH A;  2HTN A;  4R42 A;  4RC8 A;  1VEQ A;  2R93 L;  3VNX A;  2VL6 A;  2XJN A;  3B0A B;  5CZU A;  3RZ6 A;  1FHH A;  1LTL A;  3PZA A;  4WFN 1;  2XKQ A;  1PZX A;  2KKD A;  4ETR A;  2NVX L;  3S2D L;  3K7A L;  3RZD L;  4RC5 B;  2V2O A;  2MGY A;  2X17 0;  4MN9 A;  5MF6 A;  4A93 L;  4CYA A;  3E1L A;  3PW8 A;  4Z3B A;  1Z6O A;  1Z92 B;  4AI1 A;  3GTM L;  4KVR A;  3NP2 X;  3UOI A;  3B08 B;  3AK9 A;  2CKC A;  3RZO L;  4DYZ A;  4ZKX A;  4BXX L;  4JAG A;  3C21 A;  4A3B L;  1R9T L;  4TOB A;  2V8U A;  3HIU A;  4CVT A;  4BBS L;  4A3J L;  2FFX J;  2E2I L;  2V2P A;  3AF9 X;  4ME3 A;  4XKS A;  4EVD A;  5AN9 H;  3MSU A;  3WNW A;  3H3V M;  4ITT A;  3AJO A;  1BRF A;  4W4K B;  3PKJ A;  1Y1W L;  3S15 L;  2A6H D;  2VUM L;  1BQ8 A;  3VVA A;  2WB1 P;  5C6F A;  2ZG9 X;  2WTL A;  3GVY A;  4POF A;  1RWD A;  5ERJ A;  4CVR A;  5J9V A;  3BVI A;  2Z5Q A;  3R2R A;  1TWH L;  1JI5 A;  1VEL A;  3GHQ A;  3O7S A;  3UFB A;  4TOH A; 
#chains in the Genus database with same CATH homology
 1OTK A;  4RC6 B;  3ISE A;  4YXJ A;  3PVR A;  2XGW A;  3L0M A;  3VV9 A;  3PVT A;  4TW3 A;  3PWF A;  3SH6 A;  2K2D A;  3PW1 B;  5CMQ A;  5GU3 X;  2UX1 A;  3WWL A;  1CAD A;  5JKM A;  3WVW A;  1HRS A;  2PYA A;  4XXB B;  2F7N A;  1SQ3 A;  5IY0 A;  4A25 A;  1IRO A;  3EGM A;  3SHX A;  2ZA7 A;  1IU5 A;  1S3Q A;  1B13 A;  4LQJ A;  5GU1 X;  1RYQ A;  1TK6 A;  3PVY B;  5EIO C;  4TOD A;  3F36 A;  3JZ9 A;  4U3G A;  2XJT A;  4QUW A;  1LB3 A;  3E1N A;  3ZG6 A;  3E1J A;  3KDQ A;  4ZKW A;  1IU6 A;  2YW7 A;  2BJY A;  2Z3R B;  1JKV A;  5HU6 D;  2WLU A;  2Z5R A;  3FRS A;  3C1Z A;  2CN6 A;  2JD8 0;  5K52 A;  5MFZ A;  3LNL A;  2CHP A;  5JDO B;  3F34 A;  4YKH A;  4UY8 1;  3QZ3 A;  4YWM A;  4WJG 4;  3KYX A;  2RBD A;  4U67 1;  2XJS A;  4ZKH A;  5AI3 A;  3FRR A;  3RBC A;  5GAG c;  4DYX A;  2QL0 A;  3R2S A;  4LHN A;  2O5J D;  1NF6 A;  1TJO A;  2PSM C;  3QHB A;  4DYU A;  2V2R A;  1TKP A;  1VJX A;  1VZI A;  3E1Q A;  2A69 D;  1XZ3 A;  4PG1 A;  2N02 A;  2OKC A;  1FHM A;  3J7Z 1;  2V15 A;  2YJJ A;  2ZUR X;  1Z6O M;  2FG4 A;  4LHL A;  1SMM A;  4ZL5 A;  4AI2 A;  5JKL G;  3BVE A;  2B5I D;  5RXN A;  3R2M A;  1J30 A;  4LPJ A;  4RC5 A;  1RCD A;  1YK5 A;  2Z3Q B;  1BE7 A;  3WVU A;  2YJK A;  1YUZ A;  5GU0 X;  3E1P A;  2V2J A;  5D8R A;  2Y3Q A;  4M32 A;  2NYD A;  3OGH A;  2M6O A;  3KA9 A;  1LKM A;  4JAE A;  2PVX A;  5HJF A;  5I4J A;  1IW7 D;  1SOF A;  2XJP A;  1QGH A;  1RDG A;  3KYV A;  1WJV A;  2JI3 A;  4POG A;  4KXR B;  4W4L B;  2MS3 A;  3ISF A;  1DPS A;  1T9Q A;  2J9U B;  4K9F A;  5H1S c;  2ZIX A;  2AR0 A;  2V2M A;  2OH3 A;  2RDV A;  1BQ9 A;  3PWQ C;  5GAE c;  1E8J A;  4YWL A;  2C2U A;  3E6R A;  2OC5 A;  5D8Q A;  1JIG A;  3SE1 A;  1R0H A;  2V2S A;  3ERZ A;  5JVG 1;  4ERU A;  3RZT A;  4TOC A;  1Z4A A;  1OWC A;  4LPM A;  3BVF A;  3C23 A;  2WLA A;  4RC6 A;  3E6S A;  3KWO A;  4ISM A;  4II4 B;  5HJH A;  1FHA A;  1TKO A;  3F39 A;  2V8T A;  3HL1 A;  4CMY A;  5GAH c;  2D5K A;  3PW1 A;  4RC7 B;  1S24 A;  2ZA6 A;  3A44 A;  3Q4O A;  3LKD A;  2W0O A;  2QF9 A;  4MXP A;  5IX6 A;  3F33 A;  2ZG7 X;  4IWJ A;  4X0J A;  1R0I A;  3PVY A;  4TOE A;  2C6A A;  3RAV A;  3Q4R A;  3NFP I;  4XKT A;  3QVD A;  1H96 A;  5GN8 B;  1RCC A;  4EVE A;  4AR4 A;  3QHC A;  2C2J A;  2AYJ A;  3N6O A;  1ZUJ A;  4AHY A;  3RGD A;  4LQN A;  2ERS A;  2XJV A;  4AHZ A;  5JDO A;  2VZB A;  1BFR A;  3GGY A;  4PG0 A;  2FJC A;  4KVS A;  4LQH A;  4EVB A;  4MJY A;  2CLB A;  5MGN A;  1JTS A;  3KYU A;  3U90 A;  4JAF A;  1L8H A;  2QQY A;  1DAT A;  4DE6 A;  2H12 A;  8RXN A;  1S30 A;  5LG8 A;  1H7V A;  2KN9 A;  1DVB A;  4G6B A;  1JI4 A;  3IS7 A;  2XJU A;  4IWK A;  5J8S A;  4MKU A;  2V0E A;  4REU A;  1F30 A;  1B71 A;  3R2K A;  5D8P A;  4B8C D;  4ZLW A;  2XJO A;  4YVZ A;  2BE5 D;  2CLU A;  5J93 A;  1NXG A;  5AI2 A;  2ZA8 A;  5MFP A;  3F37 A;  5FFA A;  1R0J A;  2XJM A;  1O9R A;  2ZG8 X;  1RCE A;  2LCQ A;  4M35 A;  1LKP A;  2Z5P A;  2DSX A;  2FL0 A;  2G4H A;  3E1O A;  5GOU A;  5JKM G;  3UOF A;  3F32 A;  1RCG A;  1QYB A;  1JGC A;  1CAA A;  3A68 A;  4XGS A;  1XZ1 A;  4CY9 A;  4IXK A;  3V3K B;  5FFC A;  3P2A A;  4JAD A;  5LG2 A;  1B2O A;  3LPE B;  1IES A;  3JZA B;  1R03 A;  1R0F A;  5FFE A;  2V2N A;  5D8O A;  4MUD A;  2V3B B;  1UVH A;  5K53 A;  1JRE A;  2HR5 A;  3AJP A;  3FSE A;  1OWB A;  4AR3 A;  3H7G A;  4ISP A;  5GU2 X;  3RE7 A;  3PW8 C;  2V2L A;  4CVP A;  3PIP 1;  1MOJ A;  3MPS A;  1O9I A;  2ITB A;  5DM6 1;  3GGZ A;  4CVS A;  3QB9 A;  3FVB A;  1BFY A;  5D8S A;  4E6K A;  2PPT A;  5LBH A;  1L8I A;  2GYD A;  3K35 A;  3O7R A;  2VXI A;  4DI0 A;  1NF4 A;  5MLC 3;  3A9Q A;  2FG8 A;  3E1M A;  4LYU A;  4M33 A;  5JVH 1;  4II4 A;  3R2H A;  3F38 A;  1IER A;  4KVQ A;  4RC7 A;  4CYB A;  1C09 A;  3PIO 1;  2IB0 A;  2Z6M A;  3D19 A;  4ITW A;  4Z5S A;  1AEW A;  3KA3 A;  3RD0 A;  4LPN A;  1KRQ A;  5DM7 1;  1ODH A;  5E1U A;  4AM2 A;  1BG7 A;  4MY7 A;  4ZN1 B;  1BCF A;  2C41 A;  4AHW A;  3F35 A;  5FFD A;  1R0G A;  1RDV A;  2CWL A;  5GN8 A;  2YW6 A;  3BKN A;  5GAD c;  1RYT A;  5EIN C;  2Z90 A;  1JKU A;  4V19 6;  2GYQ A;  2JD6 0;  3IS8 A;  5CMR A;  4AM5 A;  2A68 D;  2FZF A;  5JAC A;  3AJQ A;  3UNO A;  4YXM A;  3J7Y 1;  1SMW A;  2V0F A;  2G38 B;  2C6R A;  3EZU A;  2PVE A;  1IRN A;  1VZG A;  1VEI A;  2CIH A;  2IU2 A;  4ZMC A;  3AF8 X;  2BK6 A;  1RB9 A;  4XKU A;  2C2F A;  1SMU A;  1NNQ A;  3BVK A;  2JI1 A;  4ZN3 B;  3TA8 A;  1S2Z A;  4E40 A;  2BKC A;  3PWQ A;  2CR8 A;  3SID A;  2M4Y A;  7RXN A;  4ZJK A;  2ERJ A;  1B2J A;  1N1Q A;  3Q4Q A;  4OYN A;  4RXN A;  3RYG A;  3R2O A;  1EUM A;  2M4V A;  4DZ0 A;  5D8X A;  2CF7 A;  3P8B A;  3KYY A;  3KA6 A;  1ZRP A;  3SS2 A;  1DX8 A;  3BVL A;  3IQ1 A;  3KA4 A;  5J8W A;  4TPU A;  2CN7 A;  3M6J A;  3Q4N A;  2JD7 0;  4TOA A;  2L0Z A;  1YUX A;  3C1Y A;  3BT5 A;  5K2M E;  2GS4 A;  5AXS A;  1F33 A;  5LS9 A;  3ES3 A;  1NXE A;  4ZTT A;  5FFB A;  6RXN A;  1LKO A;  4TOG A;  3QQC E;  2XJQ A;  1MFR A;  2Y44 A;  2PYB A;  3NP0 X;  3KYW A;  1UMN A;  3PVR B;  5JKL A;  2CEI A;  3PVT B;  4PGI A;  1QCV A;  3PKI A;  4Y08 A;  3WWN B;  2FKZ A;  5E2D A;  4AHX A;  4ZL6 A;  2IY4 A;  1RCI A;  2JI2 A;  3GE4 A;  4DYY A;  4GS7 D;  4AI3 A;  4AR5 A;  2XJR A;  4DAS A;  4M34 A;  3KXU A;  4AM4 A;  1GWG A;  1YK4 A;  3KHK A;  4AI0 A;  5FEJ A;  4EVC A;  3EZ0 A;  1T9P A;  3DBY A;  1VLG A;  4ML5 A;  2FHA A;  3W54 A;  1T9O A;  4E6Y A;  1YV1 A;  3NOZ X;  3E2C A;  2CHI A;  3R2L A;  3AK8 A;  1VCX A;  2M6P A;  4AR6 A;  3T9J A;  3IU3 I;  4TVM A;  4P18 A;  4PGK A;  4CMY V;  2BW1 A;  3FI6 A;  3KA8 A;  5ERK A;  1NFV A;  2CKA A;  4TOF A;  5D8Y A;  1JYB A;  5HQO A;  3WVV A;  3AF7 X;  2GMG A;  1ZS3 A;  3VPB E;  2VXX A;  3KX9 A;  2V2I A;  4LQV A;  4LYX A;  3OJ5 A;  2A6E D;  2WWX B;  4TO9 A;  3QD8 A;  1VZH A;  2C6B A;  4XGH A;  2HTN A;  4R42 A;  4RC8 A;  1VEQ A;  3VNX A;  2VL6 A;  2XJN A;  3B0A B;  5CZU A;  3RZ6 A;  1FHH A;  1LTL A;  3PZA A;  4WFN 1;  2XKQ A;  2KKD A;  4ETR A;  4RC5 B;  2V2O A;  2MGY A;  2X17 0;  4MN9 A;  5MF6 A;  4CYA A;  3E1L A;  3PW8 A;  4Z3B A;  1Z6O A;  1Z92 B;  4AI1 A;  4KVR A;  3NP2 X;  3UOI A;  3B08 B;  3AK9 A;  2CKC A;  4DYZ A;  4ZKX A;  4JAG A;  3C21 A;  4TOB A;  2V8U A;  3HIU A;  4CVT A;  2FFX J;  2V2P A;  3AF9 X;  4ME3 A;  4XKS A;  4EVD A;  5AN9 H;  3MSU A;  3WNW A;  4ITT A;  3AJO A;  1BRF A;  4W4K B;  3PKJ A;  2A6H D;  1BQ8 A;  3VVA A;  5C6F A;  2ZG9 X;  2WTL A;  3GVY A;  4POF A;  1RWD A;  5ERJ A;  4CVR A;  5J9V A;  3BVI A;  2Z5Q A;  3R2R A;  1JI5 A;  1VEL A;  3GHQ A;  3O7S A;  3UFB A;  4TOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...