3PZAA

Fully reduced (all-ferrous) pyrococcus rubrerythrin after a 10 second exposure to peroxide.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
b'VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pzaA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pzaA02
4LQJA 1F30A 5K53A 5GOUA 3KYVA 3E1QA 1RCDA 5LS9A 1L8HA 4E6KA 4XKTA 2C41A 1DPSA 3F36A 1JGCA 5GU3X 3T9JA 4TOBA 1RYTA 5HJHA 5LG2A 1UMNA 4TOHA 3O7SA 1S24A 1J30A 1OTKA 3KA6A 4ZTTA 4ZKHA 2PVXA 2IY4A 4TPUA 1RDGA 4CVPA 1Z6OA 2VL6A 2XGWA 3E1JA 3RZ6A 3WVUA 2YJKA 2C6RA 5JKMA 1CADA 3RGDA 2V2LA 1JKVA 3ES3A 1JREA 4TODA 5LG8A 3E1PA 3AF7X 4TOGA 3A44A 2V2PA 5JKLA 1IU6A 4LYXA 1YUXA 2FZFA 4MN9A 3AJQA 2CN6A 1YK5A 3R2OA 3EZUA 5K52A 5D8OA 1RCGA 3KWOA 3KXUA 3KYWA 2DSXA 1Z6OM 3F34A 2YW7A 2C2FA 5HQOA 2CN7A 4ZMCA 2ZURX 4ETRA 3BVFA 4IWKA 4ME3A 2YW6A 1IU5A 4DYXA 2CIHA 4MY7A 1N1QA 3BT5A 1SMUA 4EVBA 3ERZA 1BRFA 1T9QA 3E1LA 1NNQA 4LYUA 2V2NA 5ERKA 1VEQA 1B2JA 1TKPA 2BK6A 5E1UA 4DYZA 2FFXJ 3RE7A 4ZKWA 1Z4AA 5JKMG 2LCQA 4AR6A 2ZA8A 3U90A 3KA3A 2ZA6A 1T9OA 1NFVA 1S3QA 4II4A 4ML5A 5ERJA 3SHXA 1JYBA 4XKSA 1TKOA 2CHIA 3AJPA 1SQ3A 2Z90A 5RXNA 4RC7A 4ISMA 3AF9X 3RAVA 3O7RA 2BJYA 5CMRA 3RZTA 2CLUA 4AR4A 2V3BB 1HRSA 4AR5A 3BKNA 4LQVA 1RB9A 1MFRA 1ZUJA 4CVRA 3A68A 1VLGA 2V2OA 1SMMA 3R2KA 5AI3A 2FG4A 5AI2A 3R2MA 4ITTA 3QHCA 1L8IA 1XZ1A 4XKUA 5D8YA 2CHPA 1JI4A 4ZLWA 4ZL6A 4ZL5A 2V2JA 2XJMA 5LBHA 1QGHA 2GMGA 1XZ3A 2M4YA 4II4B 5C6FA 3SE1A 3WNWA 5I4JA 3TA8A 1C09A 1VCXA 2CEIA 3E6RA 3F37A 4RC7B 3SH6A 1BG7A 3PWQA 2Z5RA 3KA8A 3R2RA 2JD70 5HJFA 1KRQA 2JD60 3F35A 1H96A 3UNOA 2ITBA 5D8XA 2IB0A 5GU0X 3PVRA 2W0OA 1BFYA 1R0HA 2BW1A 3QB9A 3IQ1A 1RWDA 3PWFA 4DYYA 1BQ8A 2KKDA 3BVLA 3FI6A 2F7NA 4TOFA 3UOIA 1IERA 3EZ0A 2PVEA 4TW3A 3KYXA 3AJOA 4KVRA 1LTLA 1VEIA 2XJNA 3KA4A 4CMYV 5D8PA 4PGIA 3E2CA 2V2SA 4CMYA 3R2SA 2RBDA 1VELA 3PWQC 2IU2A 4MJYA 2WLUA 4XGSA 4REUA 3A9QA 4ITWA 5IY0A 1TJOA 1FHAA 2QF9A 5FFBA 2CLBA 1EUMA 1FHHA 3PVRB 3OJ5A 2Z5QA 4MUDA 1RCIA 2XKQA 1BQ9A 2GS4A 2VXXA 1QCVA 3F38A 4YKHA 3FSEA 3Q4RA 1NF4A 4TOEA 1LB3A 3AK9A 3FVBA 4POFA 4M33A 4IXKA 5GN8A 4MKUA 1IESA 2OH3A 5AXSA 5GU2X 3QVDA 2C2UA 3PVYA 4LPJA 2HR5A 2HTNA 2V15A 4AM4A 4LQNA 3PW8C 1O9IA 2XJOA 5J93A 3EGMA 1IROA 3R2HA 1JIGA 3F32A 5CZUA 3SIDA 4YWLA 3Q4QA 4A25A 2OC5A 4R42A 5CMQA 2CF7A 3ISEA 4P18A 1LKMA 3NP2X 3H7GA 3NP0X 1VJXA 1SMWA 2Y3QA 5GN8B 2RDVA 1DVBA 4CYBA 3IS7A 5FFEA 3PVYB 1RCEA 1SOFA 4OYNA 1O9RA 3HL1A 4LPMA 1CAAA 1R0FA 4RXNA 3F39A 3KA9A 3PVTA 3RYGA 2WLAA 1BE7A 2VXIA 1QYBA 2BKCA 1RCCA 2FL0A 2V2MA 4DASA 4ERUA 3GHQA 3E1MA 2V2RA 4RC6A 3QD8A 3F33A 4Y08A 2GYQA 2Z6MA 3RD0A 1FHMA 1YK4A 3ISFA 1T9PA 3KYYA 2KN9A 4K9FA 2QL0A 2ZG8X 2Z5PA 4CVSA 1MOJA 3PVTB 1S30A 3WVVA 1E8JA 3KYUA 2PYBA 4DZ0A 6RXNA 3QHBA 4PGKA 4TOAA 1NF6A 1JTSA 2ZG9X 4RC6B 5FFAA 3E1OA 1R0JA 3NOZX 3UOFA 4QUWA 1IRNA 3WVWA 3QZ3A 4KVQA 4M35A 3AF8X 3OGHA 1BFRA 3PW8A 1UVHA 3SS2A 1YV1A 4M32A 2VZBA 1AEWA 4M34A 1R0GA 2ZA7A 4Z5SA 5FFDA 1R0IA 3VNXA 4AM5A 3KX9A 3PW1A 4POGA 5JACA 5J8SA 4RC8A 4AR3A 4EVEA 1ZRPA 5FFCA 4KVSA 1TK6A 2G4HA 4DI0A 4U3GA 5D8SA 4CVTA 4IWJA 4LPNA 2K2DA 1F33A 4TO9A 2V2IA 1DX8A 2QQYA 5J9VA 3HIUA 1LKOA 3GVYA 4RC5A 3RBCA 1YUZA 1B13A 4ISPA 1DATA 2FG8A 1B71A 4AM2A 2MS3A 1BCFA 1R03A 4DE6A 4PG0A 1GWGA 5D8QA 4EVCA 5E2DA 3Q4NA 3PW1B 2JD80 2UX1A 3PZAA 2X170 4EVDA 4ZJKA 1JKUA 8RXNA 2ZG7X 2D5KA 3E1NA 3BVIA 5D8RA 2FHAA 2YJJA 5GU1X 4ZKXA 4DYUA 5J8WA 1RDVA 7RXNA 4RC5B 4Z3BA 4TOCA 1ZS3A 3IS8A 1LKPA 3Q4OA 4YWMA 3MPSA 3GE4A 5FEJA 2C2JA 2FKZA 2WTLA 5JKLG 4CYAA 4PG1A 3R2LA 4CY9A 1S2ZA 2PYAA 2GYDA 1JI5A 3E6SA 1B2OA 3BVKA 4LQHA 3AK8A 5IX6A 2FJCA 3BVEA 1H7VA
chains in the Genus database with same CATH superfamily
4LQJA 1F30A 5K53A 5IYBL 5GOUA 3KYVA 3E1QA 1RCDA 5LS9A 1L8HA 4E6KA 3IU3I 4XKTA 2C41A 1DPSA 3F36A 1JGCA 4BBRL 5GU3X 3CQZL 3T9JA 2Z3RB 3P8BA 4TOBA 1RYTA 5HJHA 2A6HD 2YU9L 5LG2A 1UMNA 4TOHA 1I3QL 3B0AB 2XJRA 3O7SA 1S24A 3HOVL 1J30A 1OTKA 3KA6A 4ZTTA 4ZKHA 2PVXA 2IY4A 4KXRB 4ZN1B 3GTOL 1Z92B 4GS7D 4TPUA 2WWXB 1RDGA 4CVPA 1Z6OA 2VL6A 2XGWA 3E1JA 3RZ6A 4AI1A 3WVUA 2YJKA 2ERSA 2C6RA 5JKMA 1CADA 4YXJA 1TWCL 3RGDA 3HJYB 2V2LA 1JKVA 3WWLA 3ES3A 5MF6A 4A3JL 1JREA 4TODA 4U671 3LWOB 3S15L 4A93L 2XJUA 5LG8A 3E1PA 4AI2A 3AF7X 4TOGA 3A44A 3S1RL 2V2PA 5JKLA 3VV9A 1IU6A 4LYXA 1VZIA 1YUXA 2FZFA 4MN9A 3AJQA 2CN6A 1YK5A 3KHKA 4AI0A 3HOXL 4XGHA 3R2OA 3EZUA 2JI3A 4AHYA 2CKAA 5K52A 5D8OA 2JA5L 1RCGA 3KWOA 3LWRB 1PFWA 3KXUA 3KYWA 4A3IL 2DSXA 3N6OA 3FRSA 1Z6OM 3F34A 5JVH1 2YW7A 2C2FA 5HQOA 1Y1WL 3S1QL 2CN7A 4ZMCA 2ZURX 4ETRA 3BVFA 3FDJA 3UFBA 2HVYC 3I4NL 4IWKA 4ME3A 2YW6A 1IU5A 3HOYL 4DYXA 3H0GL 2CIHA 4MY7A 2H12A 1N1QA 3BT5A 4AI3A 1SMUA 2NVYL 3H97A 4EVBA 3ERZA 3QQCE 1BRFA 3LWQB 4A3GL 1T9QA 3E1LA 1NNQA 4LYUA 2V2NA 5ERKA 2ERJA 1VEQA 4V196 1B2JA 5M5YL 4Y52L 1TKPA 2BK6A 5E1UA 5IYCL 4DYZA 2FFXJ 2JA6L 3RE7A 4ZKWA 1Z4AA 5JKMG 2LCQA 3MQKB 4JAGA 4TVMA 2AR0A 4AR6A 2RFKB 2N02A 2ZA8A 3KA3A 3U90A 1F4LA 2ZA6A 5DM61 5C3EL 1T9OA 3MSUA 2J9UB 1NFVA 1S3QA 3HJWB 4II4A 2V8UA 4ML5A 3DBYA 2JI1A 5M5XL 5ERJA 3H99A 2PMZP 3SHXA 2C6AA 1JYBA 4XKSA 4A3KL 1TKOA 2CHIA 3K35A 3AJPA 1SQ3A 2Z90A 5RXNA 4RC7A 5C44L 4ISMA 5FLML 3AF9X 3RAVA 3O7RA 2BJYA 3GTLL 5CMRA 3RZTA 2CLUA 4AR4A 2CR8A 2V3BB 1HRSA 4AR5A 3BKNA 4C3HL 4LQVA 1RB9A 1MFRA 1ZUJA 4CVRA 3A68A 1VLGA 2V2OA 1SMMA 3R2KA 2JA8L 5AI3A 2FG4A 2JI2A 4X0JA 2ZIXA 5AI2A 3R2MA 4ITTA 3PO2L 5EINC 1VZGA 3QHCA 1L8IA 2BE5D 2XJPA 2E2JL 1XZ1A 3RZDL 4AHWA 4XKUA 5D8YA 4A3CL 2R93L 2CHPA 1JI4A 4QIWP 4ZLWA 2JA7L 4ZL6A 4ZL5A 2V2JA 2XJMA 5LBHA 2APOB 1QGHA 2GMGA 1XZ3A 2M4YA 4II4B 5C6FA 3SE1A 4A3EL 3WNWA 5I4JA 3TA8A 1C09A 5IP7L 1VCXA 2CEIA 3E6RA 3F37A 4RC7B 1VZHA 1RYQA 3RZOL 3SH6A 3NFPI 4JAEA 5IYDL 1BG7A 3PWQA 2Z5RA 3KA8A 3R2RA 2JD70 5HJFA 1KRQA 2JD60 3F35A 4YVZA 1H96A 3UNOA 2ITBA 5D8XA 4LHLA 1SFOL 2IB0A 5GU0X 3PVRA 2W0OA 3W54A 4ZN3B 1BFYA 1R0HA 2BW1A 1WJVA 4A3BL 3QB9A 3IQ1A 1RWDA 3PWFA 4DYYA 1BQ8A 2KKDA 2A68D 3BVLA 3FI6A 2R7ZL 3H9CA 2F7NA 4JADA 4TOFA 3UOIA 1IERA 3EZ0A 4BY7L 2PVEA 4TW3A 1I50L 3AJOA 4KVRA 3KYXA 1LTLA 2WB1P 4BBSL 1VEIA 2XJNA 5HU6D 3KA4A 4CMYV 5D8PA 4PGIA 3E2CA 4UY81 2MGYA 2V2SA 4CMYA 3R2SA 2L0ZA 2RBDA 1VELA 3PWQC 4AYBP 3S2DL 2IU2A 4MJYA 3P2AA 2WLUA 4XGSA 4REUA 3A9QA 4ITWA 1OWBA 5IY0A 1TJOA 1FHAA 2QF9A 5FFBA 2CLBA 1PZXA 3PL5A 4C3IL 2M4VA 1EUMA 1FHHA 2G38B 3PVRB 3OJ5A 2Z5QA 4MUDA 1RCIA 2XKQA 1BQ9A 1I6HL 2GS4A 2VXXA 1QCVA 3F38A 4LHNA 4YKHA 3H3VM 1PFVA 3FSEA 3LPEB 3Q4RA 1NF4A 4TOEA 1LB3A 3AK9A 3GTGL 3FVBA 4POFA 4M33A 1IW7D 4IXKA 5GN8A 4MKUA 2Y44A 1IESA 2OH3A 5AXSA 5GU2X 3QVDA 2C2UA 3PVYA 2V0EA 4LPJA 2O5JD 5C4XL 5EIOC 2HR5A 2HTNA 2V15A 4AM4A 4LQNA 3PW8C 2R92L 4G6BA 1O9IA 2XJOA 5J93A 1K83L 3D19A 3EGMA 1IROA 3R2HA 1JIGA 3F32A 2Y0SP 5CZUA 2NYDA 4W4KB 3SIDA 4YWLA 3Q4QA 4WJG4 4A25A 1WCML 2OC5A 4AHXA 5GAHc 3PIP1 3GTJL 4R42A 5CMQA 2CF7A 3ISEA 3PO3L 4P18A 1LKMA 3NP2X 4B8CD 3LKDA 3H7GA 2M6PA 3NP0X 5DM71 1P7PA 1VJXA 1SMWA 2XJTA 2Y3QA 5GN8B 3JZAB 2RDVA 1DVBA 4CYBA 3IS7A 5FFEA 3PVYB 1RCEA 1TWFL 3H9BA 1SOFA 4OYNA 1O9RA 3HL1A 3KDQA 3GGYA 4LPMA 1CAAA 1R0FA 3S16L 3S2HL 3GGZA 4RXNA 2AQCA 3F39A 3KA9A 3PVTA 3RYGA 2WLAA 3HKZP 1BE7A 1ODHA 2VXIA 1QYBA 4YXMA 3V3KB 3S17L 2BKCA 1RCCA 2VUML 2FL0A 2V2MA 4DASA 4ERUA 1PFUA 3GHQA 3B08B 3E1MA 2V2RA 3PKJA 3S14L 4RC6A 2CWLA 3QD8A 5GADc 2V8TA 3J7Y1 3L0MA 3M4OL 3F33A 4Y08A 2GYQA 2Z6MA 3RD0A 1FHMA 1YK4A 5JVG1 4E6YA 4A3ML 3C1YA 2A69D 3ISFA 1T9PA 2PPTA 3KYYA 3LWVB 2M6OA 3PIO1 2KN9A 4C2M1 3LNLA 4A3DL 4K9FA 2QL0A 2ZG8X 4A3FL 2Z5PA 4CVSA 1MOJA 2AUSB 1TWHL 3PVTB 3PKIA 2NVQL 1S30A 3WVVA 1E8JA 5FJ8L 2EY4E 3KYUA 2PYBA 4DZ0A 6RXNA 3QHBA 3LWPB 3HOWL 4PGKA 4TOAA 1NF6A 1JTSA 2ZG9X 4RC6B 5FFAA 1NXGA 3E1OA 4AHZA 3FRRA 1R0JA 3NOZX 2XJQA 2XJSA 3UOFA 2B63L 4QUWA 5M3FL 4A3LL 1IRNA 3WVWA 3QZ3A 4KVQA 4M35A 3AF8X 4MXPA 3OGHA 1BFRA 3ZG6A 3PW8A 1UVHA 2C6BA 3SS2A 3HOUL 1YV1A 4M32A 2VZBA 5H1Sc 2NVXL 1AEWA 2E2IL 4M34A 1R0GA 2ZA7A 4Z5SA 5FFDA 2CKCA 1QQTA 1R0IA 3C23A 5MFZA 3VNXA 4AM5A 3C1ZA 3KX9A 3PW1A 4POGA 5JACA 5J8SA 4RC8A 5M3ML 4AR3A 4JAFA 2Z3QB 3GTQL 4EVEA 4X6AL 1ZRPA 5FFCA 5JDOA 1TWAL 4KVSA 1TK6A 2G4HA 4DI0A 4U3GA 5D8SA 3I4ML 4CVTA 4IWJA 4LPNA 3M3YL 2K2DA 1F33A 4TO9A 1Y1VL 2V2IA 5M5WL 3HAXC 1DX8A 2E2HL 2A6ED 2QQYA 5J9VA 3JR7A 3HIUA 4C3JL 1LKOA 3GVYA 4RC5A 3RBCA 1YUZA 1B13A 1OWCA 3WWNB 4ISPA 5IP9L 3S1ML 1DATA 5K2ME 2FG8A 5AN9H 1B71A 4AM2A 4BXXL 2MS3A 1BCFA 1R03A 4DE6A 2AYJA 4PG0A 3GTKL 2NVTL 5C4JL 1GWGA 1R9TL 5D8QA 5GAEc 4EVCA 5E2DA 3Q4NA 3PW1B 2XJVA 4XXBB 2JD80 2UX1A 2OKCA 3PZAA 2X170 3HOZL 4EVDA 4ZJKA 5GAGc 1JKUA 5JDOB 3FKIL 2ZG7X 8RXNA 2D5KA 3E1NA 3BVIA 2WAQP 5MFPA 3GTPL 5D8RA 2FHAA 2YJJA 5GU1X 4ZKXA 2V0FA 1PFYA 4DYUA 1NXEA 3K7AL 3JZ9A 5J8WA 1RDVA 7RXNA 4RC5B 3GTML 4WFN1 4Z3BA 4TOCA 3C21A 1ZS3A 3IS8A 1LKPA 3Q4OA 2PSMC 4YWMA 3VPBE 3MPSA 5MLC3 4E40A 3GE4A 5FEJA 3S1NL 2C2JA 2FKZA 2WTLA 1TWGL 5MGNA 5JKLG 4CYAA 4PG1A 4BY1L 3R2LA 4CY9A 1S2ZA 2PYAA 2GYDA 1JI5A 3E6SA 4Y7NL 1B2OA 3M6JA 4W4LB 3BVKA 3VVAA 2B5ID 4LQHA 3AK8A 5IX6A 3J7Z1 2FJCA 3BVEA 1H7VA
chains in the Genus database with same CATH topology
4LQJA 1F30A 5K53A 5GOUA 3KYVA 3E1QA 1RCDA 5LS9A 1L8HA 4E6KA 3IU3I 4XKTA 2C41A 1DPSA 3F36A 1JGCA 5GU3X 3T9JA 2Z3RB 3P8BA 4TOBA 1RYTA 5HJHA 2A6HD 5LG2A 1UMNA 4TOHA 3B0AB 2XJRA 3O7SA 1S24A 1J30A 1OTKA 3KA6A 4ZTTA 4ZKHA 2PVXA 2IY4A 4KXRB 4ZN1B 1Z92B 4GS7D 4TPUA 2WWXB 1RDGA 4CVPA 1Z6OA 2VL6A 2XGWA 3E1JA 3RZ6A 4AI1A 3WVUA 2YJKA 2ERSA 2C6RA 5JKMA 1CADA 4YXJA 3RGDA 2V2LA 1JKVA 3WWLA 3ES3A 5MF6A 1JREA 4TODA 4U671 2XJUA 5LG8A 3E1PA 4AI2A 3AF7X 4TOGA 3A44A 2V2PA 5JKLA 3VV9A 1IU6A 4LYXA 1VZIA 1YUXA 2FZFA 4MN9A 3AJQA 2CN6A 1YK5A 3KHKA 4AI0A 4XGHA 3R2OA 3EZUA 2JI3A 4AHYA 2CKAA 5K52A 5D8OA 1RCGA 3KWOA 3KXUA 3KYWA 2DSXA 3N6OA 3FRSA 1Z6OM 3F34A 5JVH1 2YW7A 2C2FA 5HQOA 2CN7A 4ZMCA 2ZURX 4ETRA 3BVFA 3UFBA 4IWKA 4ME3A 2YW6A 1IU5A 4DYXA 2CIHA 4MY7A 2H12A 1N1QA 3BT5A 4AI3A 1SMUA 4EVBA 3ERZA 3QQCE 1BRFA 1T9QA 3E1LA 1NNQA 4LYUA 2V2NA 5ERKA 2ERJA 1VEQA 4V196 1B2JA 1TKPA 2BK6A 5E1UA 4DYZA 2FFXJ 3RE7A 4ZKWA 1Z4AA 5JKMG 2LCQA 4JAGA 4TVMA 2AR0A 4AR6A 2N02A 2ZA8A 3KA3A 3U90A 5DM61 2ZA6A 1T9OA 3MSUA 2J9UB 1NFVA 1S3QA 4II4A 2V8UA 4ML5A 3DBYA 2JI1A 5ERJA 3SHXA 2C6AA 1JYBA 4XKSA 1TKOA 2CHIA 3K35A 3AJPA 1SQ3A 2Z90A 5RXNA 4RC7A 4ISMA 3AF9X 3RAVA 3O7RA 2BJYA 5CMRA 3RZTA 2CLUA 4AR4A 2CR8A 2V3BB 1HRSA 4AR5A 3BKNA 4LQVA 1RB9A 1MFRA 1ZUJA 4CVRA 3A68A 1VLGA 2V2OA 1SMMA 3R2KA 5AI3A 2FG4A 2JI2A 4X0JA 2ZIXA 5AI2A 3R2MA 4ITTA 5EINC 1VZGA 3QHCA 1L8IA 2BE5D 2XJPA 1XZ1A 4AHWA 4XKUA 5D8YA 2CHPA 1JI4A 4ZLWA 4ZL6A 4ZL5A 2V2JA 2XJMA 5LBHA 1QGHA 2GMGA 1XZ3A 2M4YA 4II4B 5C6FA 3SE1A 3WNWA 5I4JA 3TA8A 1C09A 1VCXA 2CEIA 3E6RA 3F37A 4RC7B 1VZHA 1RYQA 3SH6A 3NFPI 4JAEA 1BG7A 3PWQA 2Z5RA 3KA8A 3R2RA 2JD70 5HJFA 1KRQA 2JD60 3F35A 4YVZA 1H96A 3UNOA 2ITBA 5D8XA 4LHLA 2IB0A 5GU0X 3PVRA 2W0OA 3W54A 4ZN3B 1BFYA 1R0HA 2BW1A 1WJVA 3QB9A 3IQ1A 1RWDA 3PWFA 4DYYA 1BQ8A 2KKDA 2A68D 3BVLA 3FI6A 2F7NA 4JADA 4TOFA 3UOIA 1IERA 3EZ0A 2PVEA 4TW3A 3KYXA 3AJOA 4KVRA 1LTLA 1VEIA 2XJNA 5HU6D 3KA4A 4CMYV 5D8PA 4PGIA 3E2CA 4UY81 2MGYA 2V2SA 4CMYA 3R2SA 2L0ZA 2RBDA 1VELA 3PWQC 2IU2A 4MJYA 3P2AA 2WLUA 4XGSA 4REUA 3A9QA 4ITWA 1OWBA 5IY0A 1TJOA 1FHAA 2QF9A 5FFBA 2CLBA 2M4VA 1EUMA 1FHHA 2G38B 3PVRB 3OJ5A 2Z5QA 4MUDA 1RCIA 2XKQA 1BQ9A 2GS4A 2VXXA 1QCVA 3F38A 4LHNA 4YKHA 3FSEA 3LPEB 3Q4RA 1NF4A 4TOEA 1LB3A 3AK9A 3FVBA 4POFA 4M33A 1IW7D 4IXKA 5GN8A 4MKUA 2Y44A 1IESA 2OH3A 5AXSA 5GU2X 3QVDA 2C2UA 3PVYA 2V0EA 4LPJA 2O5JD 5EIOC 2HR5A 2HTNA 2V15A 4AM4A 4LQNA 3PW8C 4G6BA 1O9IA 2XJOA 5J93A 3D19A 3EGMA 1IROA 3R2HA 1JIGA 3F32A 5CZUA 2NYDA 4W4KB 3SIDA 4YWLA 3Q4QA 4WJG4 4A25A 4AHXA 2OC5A 5GAHc 3PIP1 4R42A 5CMQA 2CF7A 3ISEA 4P18A 1LKMA 3NP2X 4B8CD 3LKDA 3H7GA 2M6PA 3NP0X 5DM71 1VJXA 1SMWA 2XJTA 2Y3QA 5GN8B 3JZAB 2RDVA 1DVBA 4CYBA 3IS7A 5FFEA 3PVYB 1RCEA 1SOFA 4OYNA 1O9RA 3HL1A 3KDQA 3GGYA 4LPMA 1CAAA 1R0FA 3GGZA 4RXNA 3F39A 3KA9A 3PVTA 3RYGA 2WLAA 1BE7A 1ODHA 2VXIA 1QYBA 4YXMA 3V3KB 2BKCA 1RCCA 2FL0A 2V2MA 4DASA 4ERUA 3GHQA 3B08B 3E1MA 2V2RA 3PKJA 4RC6A 2CWLA 3QD8A 5GADc 2V8TA 3J7Y1 3L0MA 3F33A 4Y08A 2GYQA 2Z6MA 3RD0A 1FHMA 1YK4A 5JVG1 4E6YA 3C1YA 2A69D 3ISFA 1T9PA 2PPTA 3KYYA 2M6OA 3PIO1 2KN9A 3LNLA 4K9FA 2QL0A 2ZG8X 2Z5PA 4CVSA 1MOJA 3PVTB 3PKIA 1S30A 3WVVA 1E8JA 3KYUA 2PYBA 4DZ0A 6RXNA 3QHBA 4PGKA 4TOAA 1NF6A 1JTSA 2ZG9X 4RC6B 5FFAA 1NXGA 3E1OA 4AHZA 3FRRA 1R0JA 3NOZX 2XJQA 2XJSA 3UOFA 4QUWA 1IRNA 3WVWA 3QZ3A 4KVQA 4M35A 3AF8X 4MXPA 3OGHA 1BFRA 3ZG6A 3PW8A 1UVHA 2C6BA 3SS2A 1YV1A 4M32A 2VZBA 5H1Sc 1AEWA 4M34A 1R0GA 2ZA7A 4Z5SA 5FFDA 2CKCA 1R0IA 3C23A 5MFZA 3VNXA 4AM5A 3C1ZA 3KX9A 3PW1A 4POGA 5JACA 5J8SA 4RC8A 4AR3A 4JAFA 2Z3QB 4EVEA 1ZRPA 5FFCA 5JDOA 4KVSA 1TK6A 2G4HA 4DI0A 4U3GA 5D8SA 4CVTA 4IWJA 4LPNA 2K2DA 1F33A 4TO9A 2V2IA 1DX8A 2A6ED 2QQYA 5J9VA 3HIUA 1LKOA 3GVYA 4RC5A 3RBCA 1YUZA 1B13A 1OWCA 3WWNB 4ISPA 1DATA 5K2ME 2FG8A 5AN9H 1B71A 4AM2A 2MS3A 1BCFA 1R03A 4DE6A 2AYJA 4PG0A 1GWGA 5D8QA 5GAEc 4EVCA 5E2DA 3Q4NA 3PW1B 2XJVA 4XXBB 2JD80 2UX1A 2OKCA 3PZAA 2X170 4EVDA 4ZJKA 5GAGc 1JKUA 5JDOB 8RXNA 2ZG7X 2D5KA 3E1NA 3BVIA 5MFPA 5D8RA 2FHAA 2YJJA 5GU1X 4ZKXA 2V0FA 4DYUA 1NXEA 3JZ9A 5J8WA 1RDVA 7RXNA 4RC5B 4WFN1 4Z3BA 4TOCA 3C21A 1ZS3A 3IS8A 1LKPA 3Q4OA 2PSMC 4YWMA 3VPBE 3MPSA 5MLC3 4E40A 3GE4A 5FEJA 2C2JA 2FKZA 2WTLA 5MGNA 5JKLG 4CYAA 4PG1A 3R2LA 4CY9A 1S2ZA 2PYAA 2GYDA 1JI5A 3E6SA 1B2OA 3M6JA 4W4LB 3BVKA 3VVAA 2B5ID 4LQHA 3AK8A 5IX6A 3J7Z1 2FJCA 3BVEA 1H7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQJ A;  1F30 A;  5K53 A;  5GOU A;  3KYV A;  3E1Q A;  1RCD A;  5LS9 A;  1L8H A;  4E6K A;  4XKT A;  2C41 A;  1DPS A;  3F36 A;  1JGC A;  5GU3 X;  3T9J A;  4TOB A;  1RYT A;  5HJH A;  5LG2 A;  1UMN A;  4TOH A;  3O7S A;  1S24 A;  1J30 A;  1OTK A;  3KA6 A;  4ZTT A;  4ZKH A;  2PVX A;  2IY4 A;  4TPU A;  1RDG A;  4CVP A;  1Z6O A;  2VL6 A;  2XGW A;  3E1J A;  3RZ6 A;  3WVU A;  2YJK A;  2C6R A;  5JKM A;  1CAD A;  3RGD A;  2V2L A;  1JKV A;  3ES3 A;  1JRE A;  4TOD A;  5LG8 A;  3E1P A;  3AF7 X;  4TOG A;  3A44 A;  2V2P A;  5JKL A;  1IU6 A;  4LYX A;  1YUX A;  2FZF A;  4MN9 A;  3AJQ A;  2CN6 A;  1YK5 A;  3R2O A;  3EZU A;  5K52 A;  5D8O A;  1RCG A;  3KWO A;  3KXU A;  3KYW A;  2DSX A;  1Z6O M;  3F34 A;  2YW7 A;  2C2F A;  5HQO A;  2CN7 A;  4ZMC A;  2ZUR X;  4ETR A;  3BVF A;  4IWK A;  4ME3 A;  2YW6 A;  1IU5 A;  4DYX A;  2CIH A;  4MY7 A;  1N1Q A;  3BT5 A;  1SMU A;  4EVB A;  3ERZ A;  1BRF A;  1T9Q A;  3E1L A;  1NNQ A;  4LYU A;  2V2N A;  5ERK A;  1VEQ A;  1B2J A;  1TKP A;  2BK6 A;  5E1U A;  4DYZ A;  2FFX J;  3RE7 A;  4ZKW A;  1Z4A A;  5JKM G;  2LCQ A;  4AR6 A;  2ZA8 A;  3U90 A;  3KA3 A;  2ZA6 A;  1T9O A;  1NFV A;  1S3Q A;  4II4 A;  4ML5 A;  5ERJ A;  3SHX A;  1JYB A;  4XKS A;  1TKO A;  2CHI A;  3AJP A;  1SQ3 A;  2Z90 A;  5RXN A;  4RC7 A;  4ISM A;  3AF9 X;  3RAV A;  3O7R A;  2BJY A;  5CMR A;  3RZT A;  2CLU A;  4AR4 A;  2V3B B;  1HRS A;  4AR5 A;  3BKN A;  4LQV A;  1RB9 A;  1MFR A;  1ZUJ A;  4CVR A;  3A68 A;  1VLG A;  2V2O A;  1SMM A;  3R2K A;  5AI3 A;  2FG4 A;  5AI2 A;  3R2M A;  4ITT A;  3QHC A;  1L8I A;  1XZ1 A;  4XKU A;  5D8Y A;  2CHP A;  1JI4 A;  4ZLW A;  4ZL6 A;  4ZL5 A;  2V2J A;  2XJM A;  5LBH A;  1QGH A;  2GMG A;  1XZ3 A;  2M4Y A;  4II4 B;  5C6F A;  3SE1 A;  3WNW A;  5I4J A;  3TA8 A;  1C09 A;  1VCX A;  2CEI A;  3E6R A;  3F37 A;  4RC7 B;  3SH6 A;  1BG7 A;  3PWQ A;  2Z5R A;  3KA8 A;  3R2R A;  2JD7 0;  5HJF A;  1KRQ A;  2JD6 0;  3F35 A;  1H96 A;  3UNO A;  2ITB A;  5D8X A;  2IB0 A;  5GU0 X;  3PVR A;  2W0O A;  1BFY A;  1R0H A;  2BW1 A;  3QB9 A;  3IQ1 A;  1RWD A;  3PWF A;  4DYY A;  1BQ8 A;  2KKD A;  3BVL A;  3FI6 A;  2F7N A;  4TOF A;  3UOI A;  1IER A;  3EZ0 A;  2PVE A;  4TW3 A;  3KYX A;  3AJO A;  4KVR A;  1LTL A;  1VEI A;  2XJN A;  3KA4 A;  4CMY V;  5D8P A;  4PGI A;  3E2C A;  2V2S A;  4CMY A;  3R2S A;  2RBD A;  1VEL A;  3PWQ C;  2IU2 A;  4MJY A;  2WLU A;  4XGS A;  4REU A;  3A9Q A;  4ITW A;  5IY0 A;  1TJO A;  1FHA A;  2QF9 A;  5FFB A;  2CLB A;  1EUM A;  1FHH A;  3PVR B;  3OJ5 A;  2Z5Q A;  4MUD A;  1RCI A;  2XKQ A;  1BQ9 A;  2GS4 A;  2VXX A;  1QCV A;  3F38 A;  4YKH A;  3FSE A;  3Q4R A;  1NF4 A;  4TOE A;  1LB3 A;  3AK9 A;  3FVB A;  4POF A;  4M33 A;  4IXK A;  5GN8 A;  4MKU A;  1IES A;  2OH3 A;  5AXS A;  5GU2 X;  3QVD A;  2C2U A;  3PVY A;  4LPJ A;  2HR5 A;  2HTN A;  2V15 A;  4AM4 A;  4LQN A;  3PW8 C;  1O9I A;  2XJO A;  5J93 A;  3EGM A;  1IRO A;  3R2H A;  1JIG A;  3F32 A;  5CZU A;  3SID A;  4YWL A;  3Q4Q A;  4A25 A;  2OC5 A;  4R42 A;  5CMQ A;  2CF7 A;  3ISE A;  4P18 A;  1LKM A;  3NP2 X;  3H7G A;  3NP0 X;  1VJX A;  1SMW A;  2Y3Q A;  5GN8 B;  2RDV A;  1DVB A;  4CYB A;  3IS7 A;  5FFE A;  3PVY B;  1RCE A;  1SOF A;  4OYN A;  1O9R A;  3HL1 A;  4LPM A;  1CAA A;  1R0F A;  4RXN A;  3F39 A;  3KA9 A;  3PVT A;  3RYG A;  2WLA A;  1BE7 A;  2VXI A;  1QYB A;  2BKC A;  1RCC A;  2FL0 A;  2V2M A;  4DAS A;  4ERU A;  3GHQ A;  3E1M A;  2V2R A;  4RC6 A;  3QD8 A;  3F33 A;  4Y08 A;  2GYQ A;  2Z6M A;  3RD0 A;  1FHM A;  1YK4 A;  3ISF A;  1T9P A;  3KYY A;  2KN9 A;  4K9F A;  2QL0 A;  2ZG8 X;  2Z5P A;  4CVS A;  1MOJ A;  3PVT B;  1S30 A;  3WVV A;  1E8J A;  3KYU A;  2PYB A;  4DZ0 A;  6RXN A;  3QHB A;  4PGK A;  4TOA A;  1NF6 A;  1JTS A;  2ZG9 X;  4RC6 B;  5FFA A;  3E1O A;  1R0J A;  3NOZ X;  3UOF A;  4QUW A;  1IRN A;  3WVW A;  3QZ3 A;  4KVQ A;  4M35 A;  3AF8 X;  3OGH A;  1BFR A;  3PW8 A;  1UVH A;  3SS2 A;  1YV1 A;  4M32 A;  2VZB A;  1AEW A;  4M34 A;  1R0G A;  2ZA7 A;  4Z5S A;  5FFD A;  1R0I A;  3VNX A;  4AM5 A;  3KX9 A;  3PW1 A;  4POG A;  5JAC A;  5J8S A;  4RC8 A;  4AR3 A;  4EVE A;  1ZRP A;  5FFC A;  4KVS A;  1TK6 A;  2G4H A;  4DI0 A;  4U3G A;  5D8S A;  4CVT A;  4IWJ A;  4LPN A;  2K2D A;  1F33 A;  4TO9 A;  2V2I A;  1DX8 A;  2QQY A;  5J9V A;  3HIU A;  1LKO A;  3GVY A;  4RC5 A;  3RBC A;  1YUZ A;  1B13 A;  4ISP A;  1DAT A;  2FG8 A;  1B71 A;  4AM2 A;  2MS3 A;  1BCF A;  1R03 A;  4DE6 A;  4PG0 A;  1GWG A;  5D8Q A;  4EVC A;  5E2D A;  3Q4N A;  3PW1 B;  2JD8 0;  2UX1 A;  3PZA A;  2X17 0;  4EVD A;  4ZJK A;  1JKU A;  8RXN A;  2ZG7 X;  2D5K A;  3E1N A;  3BVI A;  5D8R A;  2FHA A;  2YJJ A;  5GU1 X;  4ZKX A;  4DYU A;  5J8W A;  1RDV A;  7RXN A;  4RC5 B;  4Z3B A;  4TOC A;  1ZS3 A;  3IS8 A;  1LKP A;  3Q4O A;  4YWM A;  3MPS A;  3GE4 A;  5FEJ A;  2C2J A;  2FKZ A;  2WTL A;  5JKL G;  4CYA A;  4PG1 A;  3R2L A;  4CY9 A;  1S2Z A;  2PYA A;  2GYD A;  1JI5 A;  3E6S A;  1B2O A;  3BVK A;  4LQH A;  3AK8 A;  5IX6 A;  2FJC A;  3BVE A;  1H7V A; 
#chains in the Genus database with same CATH topology
 4LQJ A;  1F30 A;  5K53 A;  5IYB L;  5GOU A;  3KYV A;  3E1Q A;  1RCD A;  5LS9 A;  1L8H A;  4E6K A;  3IU3 I;  4XKT A;  2C41 A;  1DPS A;  3F36 A;  1JGC A;  4BBR L;  5GU3 X;  3CQZ L;  3T9J A;  2Z3R B;  3P8B A;  4TOB A;  1RYT A;  5HJH A;  2A6H D;  2YU9 L;  5LG2 A;  1UMN A;  4TOH A;  1I3Q L;  3B0A B;  2XJR A;  3O7S A;  1S24 A;  3HOV L;  1J30 A;  1OTK A;  3KA6 A;  4ZTT A;  4ZKH A;  2PVX A;  2IY4 A;  4KXR B;  4ZN1 B;  3GTO L;  1Z92 B;  4GS7 D;  4TPU A;  2WWX B;  1RDG A;  4CVP A;  1Z6O A;  2VL6 A;  2XGW A;  3E1J A;  3RZ6 A;  4AI1 A;  3WVU A;  2YJK A;  2ERS A;  2C6R A;  5JKM A;  1CAD A;  4YXJ A;  1TWC L;  3RGD A;  3HJY B;  2V2L A;  1JKV A;  3WWL A;  3ES3 A;  5MF6 A;  4A3J L;  1JRE A;  4TOD A;  4U67 1;  3LWO B;  3S15 L;  4A93 L;  2XJU A;  5LG8 A;  3E1P A;  4AI2 A;  3AF7 X;  4TOG A;  3A44 A;  3S1R L;  2V2P A;  5JKL A;  3VV9 A;  1IU6 A;  4LYX A;  1VZI A;  1YUX A;  2FZF A;  4MN9 A;  3AJQ A;  2CN6 A;  1YK5 A;  3KHK A;  4AI0 A;  3HOX L;  4XGH A;  3R2O A;  3EZU A;  2JI3 A;  4AHY A;  2CKA A;  5K52 A;  5D8O A;  2JA5 L;  1RCG A;  3KWO A;  3LWR B;  1PFW A;  3KXU A;  3KYW A;  4A3I L;  2DSX A;  3N6O A;  3FRS A;  1Z6O M;  3F34 A;  5JVH 1;  2YW7 A;  2C2F A;  5HQO A;  1Y1W L;  3S1Q L;  2CN7 A;  4ZMC A;  2ZUR X;  4ETR A;  3BVF A;  3FDJ A;  3UFB A;  2HVY C;  3I4N L;  4IWK A;  4ME3 A;  2YW6 A;  1IU5 A;  3HOY L;  4DYX A;  3H0G L;  2CIH A;  4MY7 A;  2H12 A;  1N1Q A;  3BT5 A;  4AI3 A;  1SMU A;  2NVY L;  3H97 A;  4EVB A;  3ERZ A;  3QQC E;  1BRF A;  3LWQ B;  4A3G L;  1T9Q A;  3E1L A;  1NNQ A;  4LYU A;  2V2N A;  5ERK A;  2ERJ A;  1VEQ A;  4V19 6;  1B2J A;  5M5Y L;  4Y52 L;  1TKP A;  2BK6 A;  5E1U A;  5IYC L;  4DYZ A;  2FFX J;  2JA6 L;  3RE7 A;  4ZKW A;  1Z4A A;  5JKM G;  2LCQ A;  3MQK B;  4JAG A;  4TVM A;  2AR0 A;  4AR6 A;  2RFK B;  2N02 A;  2ZA8 A;  3KA3 A;  3U90 A;  1F4L A;  2ZA6 A;  5DM6 1;  5C3E L;  1T9O A;  3MSU A;  2J9U B;  1NFV A;  1S3Q A;  3HJW B;  4II4 A;  2V8U A;  4ML5 A;  3DBY A;  2JI1 A;  5M5X L;  5ERJ A;  3H99 A;  2PMZ P;  3SHX A;  2C6A A;  1JYB A;  4XKS A;  4A3K L;  1TKO A;  2CHI A;  3K35 A;  3AJP A;  1SQ3 A;  2Z90 A;  5RXN A;  4RC7 A;  5C44 L;  4ISM A;  5FLM L;  3AF9 X;  3RAV A;  3O7R A;  2BJY A;  3GTL L;  5CMR A;  3RZT A;  2CLU A;  4AR4 A;  2CR8 A;  2V3B B;  1HRS A;  4AR5 A;  3BKN A;  4C3H L;  4LQV A;  1RB9 A;  1MFR A;  1ZUJ A;  4CVR A;  3A68 A;  1VLG A;  2V2O A;  1SMM A;  3R2K A;  2JA8 L;  5AI3 A;  2FG4 A;  2JI2 A;  4X0J A;  2ZIX A;  5AI2 A;  3R2M A;  4ITT A;  3PO2 L;  5EIN C;  1VZG A;  3QHC A;  1L8I A;  2BE5 D;  2XJP A;  2E2J L;  1XZ1 A;  3RZD L;  4AHW A;  4XKU A;  5D8Y A;  4A3C L;  2R93 L;  2CHP A;  1JI4 A;  4QIW P;  4ZLW A;  2JA7 L;  4ZL6 A;  4ZL5 A;  2V2J A;  2XJM A;  5LBH A;  2APO B;  1QGH A;  2GMG A;  1XZ3 A;  2M4Y A;  4II4 B;  5C6F A;  3SE1 A;  4A3E L;  3WNW A;  5I4J A;  3TA8 A;  1C09 A;  5IP7 L;  1VCX A;  2CEI A;  3E6R A;  3F37 A;  4RC7 B;  1VZH A;  1RYQ A;  3RZO L;  3SH6 A;  3NFP I;  4JAE A;  5IYD L;  1BG7 A;  3PWQ A;  2Z5R A;  3KA8 A;  3R2R A;  2JD7 0;  5HJF A;  1KRQ A;  2JD6 0;  3F35 A;  4YVZ A;  1H96 A;  3UNO A;  2ITB A;  5D8X A;  4LHL A;  1SFO L;  2IB0 A;  5GU0 X;  3PVR A;  2W0O A;  3W54 A;  4ZN3 B;  1BFY A;  1R0H A;  2BW1 A;  1WJV A;  4A3B L;  3QB9 A;  3IQ1 A;  1RWD A;  3PWF A;  4DYY A;  1BQ8 A;  2KKD A;  2A68 D;  3BVL A;  3FI6 A;  2R7Z L;  3H9C A;  2F7N A;  4JAD A;  4TOF A;  3UOI A;  1IER A;  3EZ0 A;  4BY7 L;  2PVE A;  4TW3 A;  1I50 L;  3AJO A;  4KVR A;  3KYX A;  1LTL A;  2WB1 P;  4BBS L;  1VEI A;  2XJN A;  5HU6 D;  3KA4 A;  4CMY V;  5D8P A;  4PGI A;  3E2C A;  4UY8 1;  2MGY A;  2V2S A;  4CMY A;  3R2S A;  2L0Z A;  2RBD A;  1VEL A;  3PWQ C;  4AYB P;  3S2D L;  2IU2 A;  4MJY A;  3P2A A;  2WLU A;  4XGS A;  4REU A;  3A9Q A;  4ITW A;  1OWB A;  5IY0 A;  1TJO A;  1FHA A;  2QF9 A;  5FFB A;  2CLB A;  1PZX A;  3PL5 A;  4C3I L;  2M4V A;  1EUM A;  1FHH A;  2G38 B;  3PVR B;  3OJ5 A;  2Z5Q A;  4MUD A;  1RCI A;  2XKQ A;  1BQ9 A;  1I6H L;  2GS4 A;  2VXX A;  1QCV A;  3F38 A;  4LHN A;  4YKH A;  3H3V M;  1PFV A;  3FSE A;  3LPE B;  3Q4R A;  1NF4 A;  4TOE A;  1LB3 A;  3AK9 A;  3GTG L;  3FVB A;  4POF A;  4M33 A;  1IW7 D;  4IXK A;  5GN8 A;  4MKU A;  2Y44 A;  1IES A;  2OH3 A;  5AXS A;  5GU2 X;  3QVD A;  2C2U A;  3PVY A;  2V0E A;  4LPJ A;  2O5J D;  5C4X L;  5EIO C;  2HR5 A;  2HTN A;  2V15 A;  4AM4 A;  4LQN A;  3PW8 C;  2R92 L;  4G6B A;  1O9I A;  2XJO A;  5J93 A;  1K83 L;  3D19 A;  3EGM A;  1IRO A;  3R2H A;  1JIG A;  3F32 A;  2Y0S P;  5CZU A;  2NYD A;  4W4K B;  3SID A;  4YWL A;  3Q4Q A;  4WJG 4;  4A25 A;  1WCM L;  2OC5 A;  4AHX A;  5GAH c;  3PIP 1;  3GTJ L;  4R42 A;  5CMQ A;  2CF7 A;  3ISE A;  3PO3 L;  4P18 A;  1LKM A;  3NP2 X;  4B8C D;  3LKD A;  3H7G A;  2M6P A;  3NP0 X;  5DM7 1;  1P7P A;  1VJX A;  1SMW A;  2XJT A;  2Y3Q A;  5GN8 B;  3JZA B;  2RDV A;  1DVB A;  4CYB A;  3IS7 A;  5FFE A;  3PVY B;  1RCE A;  1TWF L;  3H9B A;  1SOF A;  4OYN A;  1O9R A;  3HL1 A;  3KDQ A;  3GGY A;  4LPM A;  1CAA A;  1R0F A;  3S16 L;  3S2H L;  3GGZ A;  4RXN A;  2AQC A;  3F39 A;  3KA9 A;  3PVT A;  3RYG A;  2WLA A;  3HKZ P;  1BE7 A;  1ODH A;  2VXI A;  1QYB A;  4YXM A;  3V3K B;  3S17 L;  2BKC A;  1RCC A;  2VUM L;  2FL0 A;  2V2M A;  4DAS A;  4ERU A;  1PFU A;  3GHQ A;  3B08 B;  3E1M A;  2V2R A;  3PKJ A;  3S14 L;  4RC6 A;  2CWL A;  3QD8 A;  5GAD c;  2V8T A;  3J7Y 1;  3L0M A;  3M4O L;  3F33 A;  4Y08 A;  2GYQ A;  2Z6M A;  3RD0 A;  1FHM A;  1YK4 A;  5JVG 1;  4E6Y A;  4A3M L;  3C1Y A;  2A69 D;  3ISF A;  1T9P A;  2PPT A;  3KYY A;  3LWV B;  2M6O A;  3PIO 1;  2KN9 A;  4C2M 1;  3LNL A;  4A3D L;  4K9F A;  2QL0 A;  2ZG8 X;  4A3F L;  2Z5P A;  4CVS A;  1MOJ A;  2AUS B;  1TWH L;  3PVT B;  3PKI A;  2NVQ L;  1S30 A;  3WVV A;  1E8J A;  5FJ8 L;  2EY4 E;  3KYU A;  2PYB A;  4DZ0 A;  6RXN A;  3QHB A;  3LWP B;  3HOW L;  4PGK A;  4TOA A;  1NF6 A;  1JTS A;  2ZG9 X;  4RC6 B;  5FFA A;  1NXG A;  3E1O A;  4AHZ A;  3FRR A;  1R0J A;  3NOZ X;  2XJQ A;  2XJS A;  3UOF A;  2B63 L;  4QUW A;  5M3F L;  4A3L L;  1IRN A;  3WVW A;  3QZ3 A;  4KVQ A;  4M35 A;  3AF8 X;  4MXP A;  3OGH A;  1BFR A;  3ZG6 A;  3PW8 A;  1UVH A;  2C6B A;  3SS2 A;  3HOU L;  1YV1 A;  4M32 A;  2VZB A;  5H1S c;  2NVX L;  1AEW A;  2E2I L;  4M34 A;  1R0G A;  2ZA7 A;  4Z5S A;  5FFD A;  2CKC A;  1QQT A;  1R0I A;  3C23 A;  5MFZ A;  3VNX A;  4AM5 A;  3C1Z A;  3KX9 A;  3PW1 A;  4POG A;  5JAC A;  5J8S A;  4RC8 A;  5M3M L;  4AR3 A;  4JAF A;  2Z3Q B;  3GTQ L;  4EVE A;  4X6A L;  1ZRP A;  5FFC A;  5JDO A;  1TWA L;  4KVS A;  1TK6 A;  2G4H A;  4DI0 A;  4U3G A;  5D8S A;  3I4M L;  4CVT A;  4IWJ A;  4LPN A;  3M3Y L;  2K2D A;  1F33 A;  4TO9 A;  1Y1V L;  2V2I A;  5M5W L;  3HAX C;  1DX8 A;  2E2H L;  2A6E D;  2QQY A;  5J9V A;  3JR7 A;  3HIU A;  4C3J L;  1LKO A;  3GVY A;  4RC5 A;  3RBC A;  1YUZ A;  1B13 A;  1OWC A;  3WWN B;  4ISP A;  5IP9 L;  3S1M L;  1DAT A;  5K2M E;  2FG8 A;  5AN9 H;  1B71 A;  4AM2 A;  4BXX L;  2MS3 A;  1BCF A;  1R03 A;  4DE6 A;  2AYJ A;  4PG0 A;  3GTK L;  2NVT L;  5C4J L;  1GWG A;  1R9T L;  5D8Q A;  5GAE c;  4EVC A;  5E2D A;  3Q4N A;  3PW1 B;  2XJV A;  4XXB B;  2JD8 0;  2UX1 A;  2OKC A;  3PZA A;  2X17 0;  3HOZ L;  4EVD A;  4ZJK A;  5GAG c;  1JKU A;  5JDO B;  3FKI L;  2ZG7 X;  8RXN A;  2D5K A;  3E1N A;  3BVI A;  2WAQ P;  5MFP A;  3GTP L;  5D8R A;  2FHA A;  2YJJ A;  5GU1 X;  4ZKX A;  2V0F A;  1PFY A;  4DYU A;  1NXE A;  3K7A L;  3JZ9 A;  5J8W A;  1RDV A;  7RXN A;  4RC5 B;  3GTM L;  4WFN 1;  4Z3B A;  4TOC A;  3C21 A;  1ZS3 A;  3IS8 A;  1LKP A;  3Q4O A;  2PSM C;  4YWM A;  3VPB E;  3MPS A;  5MLC 3;  4E40 A;  3GE4 A;  5FEJ A;  3S1N L;  2C2J A;  2FKZ A;  2WTL A;  1TWG L;  5MGN A;  5JKL G;  4CYA A;  4PG1 A;  4BY1 L;  3R2L A;  4CY9 A;  1S2Z A;  2PYA A;  2GYD A;  1JI5 A;  3E6S A;  4Y7N L;  1B2O A;  3M6J A;  4W4L B;  3BVK A;  3VVA A;  2B5I D;  4LQH A;  3AK8 A;  5IX6 A;  3J7Z 1;  2FJC A;  3BVE A;  1H7V A; 
#chains in the Genus database with same CATH homology
 4LQJ A;  1F30 A;  5K53 A;  5GOU A;  3KYV A;  3E1Q A;  1RCD A;  5LS9 A;  1L8H A;  4E6K A;  3IU3 I;  4XKT A;  2C41 A;  1DPS A;  3F36 A;  1JGC A;  5GU3 X;  3T9J A;  2Z3R B;  3P8B A;  4TOB A;  1RYT A;  5HJH A;  2A6H D;  5LG2 A;  1UMN A;  4TOH A;  3B0A B;  2XJR A;  3O7S A;  1S24 A;  1J30 A;  1OTK A;  3KA6 A;  4ZTT A;  4ZKH A;  2PVX A;  2IY4 A;  4KXR B;  4ZN1 B;  1Z92 B;  4GS7 D;  4TPU A;  2WWX B;  1RDG A;  4CVP A;  1Z6O A;  2VL6 A;  2XGW A;  3E1J A;  3RZ6 A;  4AI1 A;  3WVU A;  2YJK A;  2ERS A;  2C6R A;  5JKM A;  1CAD A;  4YXJ A;  3RGD A;  2V2L A;  1JKV A;  3WWL A;  3ES3 A;  5MF6 A;  1JRE A;  4TOD A;  4U67 1;  2XJU A;  5LG8 A;  3E1P A;  4AI2 A;  3AF7 X;  4TOG A;  3A44 A;  2V2P A;  5JKL A;  3VV9 A;  1IU6 A;  4LYX A;  1VZI A;  1YUX A;  2FZF A;  4MN9 A;  3AJQ A;  2CN6 A;  1YK5 A;  3KHK A;  4AI0 A;  4XGH A;  3R2O A;  3EZU A;  2JI3 A;  4AHY A;  2CKA A;  5K52 A;  5D8O A;  1RCG A;  3KWO A;  3KXU A;  3KYW A;  2DSX A;  3N6O A;  3FRS A;  1Z6O M;  3F34 A;  5JVH 1;  2YW7 A;  2C2F A;  5HQO A;  2CN7 A;  4ZMC A;  2ZUR X;  4ETR A;  3BVF A;  3UFB A;  4IWK A;  4ME3 A;  2YW6 A;  1IU5 A;  4DYX A;  2CIH A;  4MY7 A;  2H12 A;  1N1Q A;  3BT5 A;  4AI3 A;  1SMU A;  4EVB A;  3ERZ A;  3QQC E;  1BRF A;  1T9Q A;  3E1L A;  1NNQ A;  4LYU A;  2V2N A;  5ERK A;  2ERJ A;  1VEQ A;  4V19 6;  1B2J A;  1TKP A;  2BK6 A;  5E1U A;  4DYZ A;  2FFX J;  3RE7 A;  4ZKW A;  1Z4A A;  5JKM G;  2LCQ A;  4JAG A;  4TVM A;  2AR0 A;  4AR6 A;  2N02 A;  2ZA8 A;  3KA3 A;  3U90 A;  5DM6 1;  2ZA6 A;  1T9O A;  3MSU A;  2J9U B;  1NFV A;  1S3Q A;  4II4 A;  2V8U A;  4ML5 A;  3DBY A;  2JI1 A;  5ERJ A;  3SHX A;  2C6A A;  1JYB A;  4XKS A;  1TKO A;  2CHI A;  3K35 A;  3AJP A;  1SQ3 A;  2Z90 A;  5RXN A;  4RC7 A;  4ISM A;  3AF9 X;  3RAV A;  3O7R A;  2BJY A;  5CMR A;  3RZT A;  2CLU A;  4AR4 A;  2CR8 A;  2V3B B;  1HRS A;  4AR5 A;  3BKN A;  4LQV A;  1RB9 A;  1MFR A;  1ZUJ A;  4CVR A;  3A68 A;  1VLG A;  2V2O A;  1SMM A;  3R2K A;  5AI3 A;  2FG4 A;  2JI2 A;  4X0J A;  2ZIX A;  5AI2 A;  3R2M A;  4ITT A;  5EIN C;  1VZG A;  3QHC A;  1L8I A;  2BE5 D;  2XJP A;  1XZ1 A;  4AHW A;  4XKU A;  5D8Y A;  2CHP A;  1JI4 A;  4ZLW A;  4ZL6 A;  4ZL5 A;  2V2J A;  2XJM A;  5LBH A;  1QGH A;  2GMG A;  1XZ3 A;  2M4Y A;  4II4 B;  5C6F A;  3SE1 A;  3WNW A;  5I4J A;  3TA8 A;  1C09 A;  1VCX A;  2CEI A;  3E6R A;  3F37 A;  4RC7 B;  1VZH A;  1RYQ A;  3SH6 A;  3NFP I;  4JAE A;  1BG7 A;  3PWQ A;  2Z5R A;  3KA8 A;  3R2R A;  2JD7 0;  5HJF A;  1KRQ A;  2JD6 0;  3F35 A;  4YVZ A;  1H96 A;  3UNO A;  2ITB A;  5D8X A;  4LHL A;  2IB0 A;  5GU0 X;  3PVR A;  2W0O A;  3W54 A;  4ZN3 B;  1BFY A;  1R0H A;  2BW1 A;  1WJV A;  3QB9 A;  3IQ1 A;  1RWD A;  3PWF A;  4DYY A;  1BQ8 A;  2KKD A;  2A68 D;  3BVL A;  3FI6 A;  2F7N A;  4JAD A;  4TOF A;  3UOI A;  1IER A;  3EZ0 A;  2PVE A;  4TW3 A;  3KYX A;  3AJO A;  4KVR A;  1LTL A;  1VEI A;  2XJN A;  5HU6 D;  3KA4 A;  4CMY V;  5D8P A;  4PGI A;  3E2C A;  4UY8 1;  2MGY A;  2V2S A;  4CMY A;  3R2S A;  2L0Z A;  2RBD A;  1VEL A;  3PWQ C;  2IU2 A;  4MJY A;  3P2A A;  2WLU A;  4XGS A;  4REU A;  3A9Q A;  4ITW A;  1OWB A;  5IY0 A;  1TJO A;  1FHA A;  2QF9 A;  5FFB A;  2CLB A;  2M4V A;  1EUM A;  1FHH A;  2G38 B;  3PVR B;  3OJ5 A;  2Z5Q A;  4MUD A;  1RCI A;  2XKQ A;  1BQ9 A;  2GS4 A;  2VXX A;  1QCV A;  3F38 A;  4LHN A;  4YKH A;  3FSE A;  3LPE B;  3Q4R A;  1NF4 A;  4TOE A;  1LB3 A;  3AK9 A;  3FVB A;  4POF A;  4M33 A;  1IW7 D;  4IXK A;  5GN8 A;  4MKU A;  2Y44 A;  1IES A;  2OH3 A;  5AXS A;  5GU2 X;  3QVD A;  2C2U A;  3PVY A;  2V0E A;  4LPJ A;  2O5J D;  5EIO C;  2HR5 A;  2HTN A;  2V15 A;  4AM4 A;  4LQN A;  3PW8 C;  4G6B A;  1O9I A;  2XJO A;  5J93 A;  3D19 A;  3EGM A;  1IRO A;  3R2H A;  1JIG A;  3F32 A;  5CZU A;  2NYD A;  4W4K B;  3SID A;  4YWL A;  3Q4Q A;  4WJG 4;  4A25 A;  4AHX A;  2OC5 A;  5GAH c;  3PIP 1;  4R42 A;  5CMQ A;  2CF7 A;  3ISE A;  4P18 A;  1LKM A;  3NP2 X;  4B8C D;  3LKD A;  3H7G A;  2M6P A;  3NP0 X;  5DM7 1;  1VJX A;  1SMW A;  2XJT A;  2Y3Q A;  5GN8 B;  3JZA B;  2RDV A;  1DVB A;  4CYB A;  3IS7 A;  5FFE A;  3PVY B;  1RCE A;  1SOF A;  4OYN A;  1O9R A;  3HL1 A;  3KDQ A;  3GGY A;  4LPM A;  1CAA A;  1R0F A;  3GGZ A;  4RXN A;  3F39 A;  3KA9 A;  3PVT A;  3RYG A;  2WLA A;  1BE7 A;  1ODH A;  2VXI A;  1QYB A;  4YXM A;  3V3K B;  2BKC A;  1RCC A;  2FL0 A;  2V2M A;  4DAS A;  4ERU A;  3GHQ A;  3B08 B;  3E1M A;  2V2R A;  3PKJ A;  4RC6 A;  2CWL A;  3QD8 A;  5GAD c;  2V8T A;  3J7Y 1;  3L0M A;  3F33 A;  4Y08 A;  2GYQ A;  2Z6M A;  3RD0 A;  1FHM A;  1YK4 A;  5JVG 1;  4E6Y A;  3C1Y A;  2A69 D;  3ISF A;  1T9P A;  2PPT A;  3KYY A;  2M6O A;  3PIO 1;  2KN9 A;  3LNL A;  4K9F A;  2QL0 A;  2ZG8 X;  2Z5P A;  4CVS A;  1MOJ A;  3PVT B;  3PKI A;  1S30 A;  3WVV A;  1E8J A;  3KYU A;  2PYB A;  4DZ0 A;  6RXN A;  3QHB A;  4PGK A;  4TOA A;  1NF6 A;  1JTS A;  2ZG9 X;  4RC6 B;  5FFA A;  1NXG A;  3E1O A;  4AHZ A;  3FRR A;  1R0J A;  3NOZ X;  2XJQ A;  2XJS A;  3UOF A;  4QUW A;  1IRN A;  3WVW A;  3QZ3 A;  4KVQ A;  4M35 A;  3AF8 X;  4MXP A;  3OGH A;  1BFR A;  3ZG6 A;  3PW8 A;  1UVH A;  2C6B A;  3SS2 A;  1YV1 A;  4M32 A;  2VZB A;  5H1S c;  1AEW A;  4M34 A;  1R0G A;  2ZA7 A;  4Z5S A;  5FFD A;  2CKC A;  1R0I A;  3C23 A;  5MFZ A;  3VNX A;  4AM5 A;  3C1Z A;  3KX9 A;  3PW1 A;  4POG A;  5JAC A;  5J8S A;  4RC8 A;  4AR3 A;  4JAF A;  2Z3Q B;  4EVE A;  1ZRP A;  5FFC A;  5JDO A;  4KVS A;  1TK6 A;  2G4H A;  4DI0 A;  4U3G A;  5D8S A;  4CVT A;  4IWJ A;  4LPN A;  2K2D A;  1F33 A;  4TO9 A;  2V2I A;  1DX8 A;  2A6E D;  2QQY A;  5J9V A;  3HIU A;  1LKO A;  3GVY A;  4RC5 A;  3RBC A;  1YUZ A;  1B13 A;  1OWC A;  3WWN B;  4ISP A;  1DAT A;  5K2M E;  2FG8 A;  5AN9 H;  1B71 A;  4AM2 A;  2MS3 A;  1BCF A;  1R03 A;  4DE6 A;  2AYJ A;  4PG0 A;  1GWG A;  5D8Q A;  5GAE c;  4EVC A;  5E2D A;  3Q4N A;  3PW1 B;  2XJV A;  4XXB B;  2JD8 0;  2UX1 A;  2OKC A;  3PZA A;  2X17 0;  4EVD A;  4ZJK A;  5GAG c;  1JKU A;  5JDO B;  8RXN A;  2ZG7 X;  2D5K A;  3E1N A;  3BVI A;  5MFP A;  5D8R A;  2FHA A;  2YJJ A;  5GU1 X;  4ZKX A;  2V0F A;  4DYU A;  1NXE A;  3JZ9 A;  5J8W A;  1RDV A;  7RXN A;  4RC5 B;  4WFN 1;  4Z3B A;  4TOC A;  3C21 A;  1ZS3 A;  3IS8 A;  1LKP A;  3Q4O A;  2PSM C;  4YWM A;  3VPB E;  3MPS A;  5MLC 3;  4E40 A;  3GE4 A;  5FEJ A;  2C2J A;  2FKZ A;  2WTL A;  5MGN A;  5JKL G;  4CYA A;  4PG1 A;  3R2L A;  4CY9 A;  1S2Z A;  2PYA A;  2GYD A;  1JI5 A;  3E6S A;  1B2O A;  3M6J A;  4W4L B;  3BVK A;  3VVA A;  2B5I D;  4LQH A;  3AK8 A;  5IX6 A;  3J7Z 1;  2FJC A;  3BVE A;  1H7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...