3PZAA

Fully reduced (all-ferrous) pyrococcus rubrerythrin after a 10 second exposure to peroxide.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pzaA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pzaA02
3OGHA 2YW7A 1SMWA 2WLUA 3PVRA 4K9FA 4ZJKA 4MUDA 5ERKA 5J8WA 1R03A 4DYXA 3U90A 2ZURX 8RXNA 5LBHA 2HR5A 3ERZA 2VZBA 5D8SA 4LPNA 5FFBA 4EVBA 2JD70 1VCXA 3BVKA 3PWFA 1HRSA 1S3QA 3BVIA 1IESA 3GVYA 3RBCA 1JYBA 1BRFA 1TK6A 3TA8A 3Q4QA 2MS3A 4LYXA 4POFA 2FJCA 3WVVA 2LCQA 3SIDA 3KX9A 3AF9X 3Q4NA 1YK4A 3VNXA 3WVWA 3E1PA 1SMUA 4LPMA 3PVYA 3PW1B 4ZTTA 1IRNA 1T9QA 1UMNA 5CMQA 1Z4AA 1RCIA 2PYBA 2FFXJ 4CYBA 5D8QA 3FSEA 3BT5A 1NF6A 4MY7A 2ITBA 3PVRB 4IXKA 3UOIA 2HTNA 4ITTA 2KN9A 1B13A 1BG7A 3F38A 2Y3QA 1S30A 1SOFA 4XKTA 4OYNA 3MPSA 3ISEA 1QYBA 3NOZX 1JI5A 5HJFA 1JREA 1CAAA 1R0FA 1F33A 1BQ9A 2ZG9X 1MOJA 3O7SA 5D8OA 5FEJA 4RC5B 3Q4OA 3Q4RA 3PZAA 4CY9A 5J8SA 1VJXA 2Z5PA 2V2PA 1VELA 1FHAA 4CVSA 3SS2A 3RE7A 3RGDA 3F34A 2ZA7A 3PWQC 2CF7A 3QB9A 3R2MA 3FVBA 3WNWA 2CLUA 4U3GA 2PVXA 3KA6A 2GMGA 4ITWA 5J9VA 1GWGA 2X170 4KVRA 3E6SA 2OC5A 4P18A 2VXIA 5JKLA 5D8RA 3PVTB 5AI3A 2Z6MA 3EGMA 2G4HA 4ZL5A 1J30A 1OTKA 2OH3A 1B2JA 1JKUA 2JD80 3PW1A 4CVPA 4RC8A 4YWMA 1Z6OA 3WVUA 5GU2X 2Z5QA 4ISMA 3R2HA 2UX1A 4DYYA 1FHHA 1NNQA 1JKVA 4KVSA 7RXNA 3BVLA 1KRQA 3F35A 3ES3A 2YW6A 3E1LA 4TOCA 4DASA 3E1NA 2ZA8A 4ZL6A 1XZ1A 3R2OA 1SMMA 1BE7A 4M33A 3E1MA 5GOUA 3QHCA 1YUXA 1S24A 3F33A 4MKUA 4EVDA 4RC5A 4II4A 4AM4A 5D8XA 3UOFA 2QL0A 2YJKA 5GN8B 1JGCA 2V2SA 2V15A 3HIUA 1TJOA 3QVDA 1E8JA 3EZ0A 3QHBA 3H7GA 4E6KA 4YWLA 3SE1A 5HJHA 1VLGA 1LKMA 1IU5A 5AI2A 3PW8A 3AJPA 4DYUA 3T9JA 2V2IA 2V3BB 4CMYA 3KWOA 3BVFA 3PVTA 4MN9A 4LQVA 1ZS3A 4M34A 4REUA 5LS9A 1DATA 1N1QA 3KYWA 1JI4A 2D5KA 4Z3BA 1RB9A 1LKOA 4RXNA 2ZG7X 3GE4A 2FHAA 1VEQA 2XJMA 5GU1X 4PG0A 3EZUA 1AEWA 3F32A 3AF7X 3GHQA 4II4B 1O9IA 1YV1A 2C2FA 4RC6A 4KVQA 4DYZA 1B71A 5D8PA 4ISPA 2FG4A 4TW3A 3KYVA 4TOGA 1RCEA 4RC7B 5C6FA 4DI0A 5E2DA 1RCDA 2XJNA 3F37A 4TOFA 4ZKHA 1T9OA 3BVEA 4XKUA 1L8IA 5ERJA 5D8YA 3KA8A 4TOAA 1SQ3A 2Z90A 1O9RA 3RAVA 1C09A 1UVHA 2F7NA 3KXUA 3KYUA 4LQHA 3AK9A 3KA9A 1LKPA 4TOEA 3AJOA 5CZUA 5GU0X 2ZA6A 1IERA 5LG2A 2V2JA 3SHXA 3R2LA 5GN8A 4AM2A 2W0OA 4R42A 2IY4A 4ZKXA 5AXSA 1RDGA 1LTLA 4AR3A 1H96A 4ZMCA 4TPUA 2IB0A 2GS4A 1DVBA 2CHPA 4RC6B 3AJQA 1RCCA 2C6RA 4IWJA 1DX8A 2XKQA 2XGWA 4TODA 2QQYA 4EVEA 2KKDA 2FKZA 5E1UA 4LQJA 3R2SA 2VXXA 4XGSA 1FHMA 1RCGA 1T9PA 4PG1A 4EVCA 1R0IA 4AR6A 2BKCA 1H7VA 4PGIA 1JTSA 2CLBA 4ZLWA 5RXNA 4CYAA 3E2CA 3AF8X 2GYDA 3R2KA 4TO9A 3QZ3A 4DZ0A 2BK6A 2YJJA 1BFYA 3A44A 3KA4A 5FFCA 5LG8A 2V2NA 4RC7A 1ZUJA 2FL0A 2C2UA 1BFRA 3F36A 1R0JA 4LYUA 2BJYA 5FFEA 1ZRPA 2CIHA 4MJYA 3E1QA 2CHIA 1TKPA 4YKHA 3A68A 4POGA 1RYTA 3R2RA 5JACA 3E6RA 5HQOA 1LB3A 1IU6A 3QD8A 5IY0A 3E1JA 3O7RA 3RYGA 2M4YA 2C41A 1Z6OM 2RDVA 4XKSA 4ERUA 2ZG8X 3IS7A 4LQNA 2XJOA 3BKNA 2PYAA 3KYXA 3IS8A 5FFAA 5GU3X 5JKLG 5JKMG 3AK8A 3E1OA 4IWKA 1S2ZA 2V2RA 2VL6A 1DPSA 2C2JA 1L8HA 4Z5SA 1R0GA 2QF9A 2V2OA 3KA3A 4TOHA 5I4JA 3RZTA 2CEIA 1RWDA 5J93A 1YK5A 2Z5RA 3IQ1A 2K2DA 4ME3A 4QUWA 4LPJA 4CVRA 5K53A 4ZKWA 1XZ3A 1B2OA 2IU2A 4AR4A 1NF4A 5FFDA 4A25A 3SH6A 2WLAA 2V2MA 4CVTA 2FG8A 4ETRA 1VEIA 3NP0X 1BQ8A 2WTLA 3PVYB 5K52A 3RD0A 1TKOA 3NP2X 1NFVA 4ML5A 2V2LA 2BW1A 5CMRA 1QCVA 2GYQA 2CN6A 3UNOA 1MFRA 4AR5A 4M35A 2FZFA 2PVEA 1F30A 2CN7A 6RXNA 3A9QA 3ISFA 4M32A 3RZ6A 5JKMA 4Y08A 1R0HA 3KYYA 3FI6A 3HL1A 4TOBA 2JD60 3OJ5A 2RBDA 1QGHA 4DE6A 4CMYV 4PGKA 3PW8C 1RDVA 1BCFA 1EUMA 1IROA 5IX6A 1JIGA 1CADA 2DSXA 3F39A 1YUZA 3PWQA 4AM5A
chains in the Genus database with same CATH superfamily
4KXRB 3OGHA 2M6OA 2Z3RB 2Y0SP 2YW7A 4X6AL 5FJ8L 1SMWA 4AI1A 3KHKA 2WLUA 3PVRA 3HAXC 4K9FA 4ZJKA 4MUDA 5ERKA 2XJPA 4BY1L 4WFN1 5J8WA 1R03A 4DYXA 3U90A 2ZURX 1Z92B 8RXNA 5LBHA 2HR5A 2JA5L 3ERZA 2VZBA 5D8SA 4LPNA 5FFBA 4XXBB 4A3BL 4EVBA 3LWOB 2JD70 4X0JA 1VCXA 3BVKA 3PWFA 5MFPA 1HRSA 1S3QA 3BVIA 4C3IL 1IESA 1I3QL 3GVYA 4A3JL 3RBCA 1JYBA 5EIOC 3PIP1 2CWLA 1BRFA 1TK6A 3TA8A 3Q4QA 2MS3A 4LYXA 2M6PA 4POFA 1ODHA 2FJCA 3WVVA 2LCQA 3SIDA 2R92L 3I4NL 3KX9A 3AF9X 3Q4NA 1YK4A 3VPBE 5M5WL 3VNXA 3WVWA 3E1PA 1SMUA 4LPMA 3PVYA 3HOVL 4A93L 3PW1B 2C6AA 3H0GL 4ZTTA 1IRNA 1T9QA 1UMNA 5CMQA 1Z4AA 1RCIA 2PYBA 2FFXJ 3FRRA 5D8QA 4CYBA 3FSEA 3C1ZA 5JVH1 3BT5A 2NVTL 1NF6A 2OKCA 4MY7A 2ITBA 4AI0A 4E40A 2XJRA 4AI2A 3ZG6A 3PVRB 4IXKA 3UOIA 2HTNA 4ITTA 2KN9A 5DM71 1B13A 1BG7A 3F38A 2E2HL 3GTLL 3B0AB 2Y3QA 1VZIA 4C3HL 4BBSL 1S30A 1SOFA 3GTML 4XKTA 4OYNA 3H97A 3MPSA 3ISEA 1QYBA 3NOZX 2B63L 1JI5A 5HJFA 1JREA 5H1Sc 4A3DL 1CAAA 4JADA 1R0FA 1F33A 2NVXL 1BQ9A 2ZG9X 1MOJA 3O7SA 5D8OA 5FEJA 4RC5B 5K2ME 3Q4OA 3PKIA 3Q4RA 3CQZL 2WB1P 1R9TL 2BE5D 3S2DL 3PZAA 4CY9A 5J8SA 1VJXA 2Z5PA 2V2PA 1VELA 1FHAA 2CKAA 4CVSA 3SS2A 3RE7A 3RGDA 3WWLA 5AN9H 2HVYC 3VV9A 4A3KL 3F34A 2ZA7A 2APOB 2N02A 3PWQC 3HKZP 4GS7D 2CF7A 3QB9A 3R2MA 3GTOL 3FVBA 3NFPI 3WNWA 1TWGL 1VZGA 5MLC3 2CLUA 4U3GA 5FLML 4A3EL 2PVXA 3KA6A 2GMGA 4ITWA 2A6ED 5IYDL 5J9VA 3MSUA 1GWGA 2X170 4KVRA 3E6SA 2OC5A 3S1RL 4P18A 2VXIA 2EY4E 3K35A 5JKLA 5D8RA 3PVTB 5AI3A 3MQKB 2Z6MA 3EGMA 3DBYA 2G4HA 2XJQA 4Y52L 2L0ZA 2Z3QB 4ZL5A 1PZXA 3LKDA 2JI3A 1J30A 1OTKA 2OH3A 3S15L 1TWFL 1B2JA 1JKUA 5IP7L 2JD80 3PW1A 4JAGA 4CVPA 5HU6D 2JA8L 2PPTA 2XJTA 4RC8A 4YWMA 1Z6OA 3WVUA 5GU2X 2Z5QA 4ISMA 3R2HA 2UX1A 4DYYA 3JR7A 2E2JL 1FHHA 3GTGL 1NNQA 5DM61 1JKVA 4KVSA 7RXNA 3BVLA 1KRQA 3F35A 2RFKB 3ES3A 1Y1VL 2H12A 5EINC 3N6OA 2YW6A 3E1LA 2B5ID 5JVG1 1F4LA 4TOCA 2O5JD 3W54A 4DASA 4A3FL 3E1NA 2ZA8A 4ZL6A 1XZ1A 3LNLA 3R2OA 1SMMA 1PFUA 3D19A 1BE7A 3H3VM 4M33A 3E1MA 5GOUA 4ZN1B 3QHCA 2ERJA 3HOUL 1YUXA 1VZHA 1S24A 3F33A 4MKUA 4YXMA 4EVDA 5C4JL 4RC5A 5IYBL 4II4A 3LWRB 3LPEB 1PFWA 3S1QL 3C1YA 4AM4A 5D8XA 3UOFA 2QL0A 2YJKA 5GN8B 1QQTA 1JGCA 3JZAB 2AYJA 2V2SA 2V15A 3HIUA 3HOXL 1WJVA 1TJOA 3QVDA 1E8JA 1WCML 3EZ0A 3QHBA 1TWCL 3JZ9A 3H7GA 4E6KA 4YWLA 2JA6L 2J9UB 3SE1A 4C3JL 5HJHA 1VLGA 1LKMA 1IU5A 1I50L 3PW8A 5AI2A 3PIO1 3AJPA 4DYUA 3V3KB 2V0FA 4BY7L 3T9JA 2V2IA 2V3BB 3S17L 4CMYA 3KWOA 3B08B 1OWCA 3BVFA 3PVTA 4MN9A 4LQVA 1ZS3A 4M34A 3S16L 4REUA 5LS9A 1DATA 1N1QA 3KYWA 3J7Z1 1JI4A 2D5KA 4AI3A 4Z3BA 1RB9A 3J7Y1 1LKOA 4RXNA 5MFZA 2ZG7X 3GE4A 3S2HL 2FHAA 3QQCE 1VEQA 2XJMA 5GU1X 4PG0A 3EZUA 3IU3I 1AEWA 3F32A 3AF7X 3GHQA 4II4B 1O9IA 1YV1A 2C2FA 4RC6A 2A69D 3M4OL 3GGZA 4KVQA 4DYZA 1B71A 4V196 2XJSA 5D8PA 2C6BA 3C21A 4ISPA 2FG4A 4TW3A 3KYVA 4TOGA 4YVZA 1RCEA 4RC7B 5C6FA 4DI0A 4W4KB 5E2DA 3HOYL 5JDOB 1RCDA 2XJNA 3F37A 4TOFA 4ZKHA 1T9OA 3BVEA 4XKUA 1L8IA 5ERJA 5D8YA 4AHXA 3KA8A 4TOAA 1SFOL 1SQ3A 2Z90A 1O9RA 3H9CA 3HJWB 3RAVA 2V8TA 1C09A 2NVQL 1UVHA 2F7NA 3KXUA 3GTJL 3KYUA 3PL5A 4LQHA 3AK9A 4QIWP 5M5YL 3KA9A 1LKPA 4TOEA 3AJOA 5CZUA 5GU0X 2ZA6A 1IERA 2E2IL 5LG2A 2V2JA 3SHXA 4AHWA 3R2LA 5GN8A 4AM2A 2W0OA 4R42A 2IY4A 3P8BA 2VUML 3RZOL 2Y44A 4W4LB 5GADc 3PO3L 4ZKXA 5AXSA 5GAEc 1RDGA 1LTLA 4AHYA 1OWBA 2ERSA 4AR3A 1PFVA 1H96A 4ZMCA 4TPUA 1TWHL 2IB0A 2GS4A 1DVBA 2CHPA 4RC6B 3AJQA 4JAEA 1RCCA 2XJVA 2C6RA 4IWJA 1DX8A 2XKQA 2XGWA 4TODA 2JI1A 2QQYA 3FKIL 4LHNA 4EVEA 2KKDA 5MGNA 2FKZA 2XJUA 2G38B 5E1UA 4LQJA 5C44L 3R2SA 2VXXA 4XGSA 1FHMA 2AUSB 3M6JA 1IW7D 1RCGA 1T9PA 4PG1A 4EVCA 5M3ML 1R0IA 1TWAL 2MGYA 4AR6A 3HJYB 2BKCA 1H7VA 4PGIA 3VVAA 1JTSA 1K83L 2CLBA 5GAGc 4ZLWA 3HOWL 5RXNA 5M3FL 4CYAA 3E2CA 3AF8X 2GYDA 3L0MA 3R2KA 4TO9A 3QZ3A 4DZ0A 3H9BA 2R7ZL 2BK6A 2YJJA 1BFYA 3A44A 5C4XL 1RYQA 3KA4A 5FFCA 3S14L 3LWVB 5LG8A 4WJG4 2V2NA 4RC7A 1ZUJA 2FL0A 2AQCA 2C2UA 1BFRA 5JDOA 3F36A 1R0JA 4LYUA 2BJYA 5FFEA 1ZRPA 2CIHA 4MJYA 3E1QA 2WWXB 2CHIA 1TKPA 3GTKL 4YKHA 3A68A 4POGA 1RYTA 3R2RA 4A3IL 4MXPA 3P2AA 3PO2L 5JACA 3E6RA 5HQOA 1LB3A 4AYBP 4LHLA 3LWPB 2ZIXA 1IU6A 3QD8A 3FDJA 5IY0A 3E1JA 2R93L 3O7RA 2JI2A 4BBRL 3RYGA 3C23A 4TVMA 2M4YA 3WWNB 2C41A 1Z6OM 2RDVA 4XKSA 4ERUA 3HOZL 3S1ML 2ZG8X 3S1NL 3IS7A 4LQNA 4AHZA 2JA7L 2XJOA 1NXGA 3BKNA 2M4VA 2PYAA 3IS8A 3KYXA 5FFAA 1PFYA 5GU3X 5JKLG 5JKMG 5IYCL 3AK8A 3E1OA 2A68D 4IWKA 1S2ZA 2V2RA 2NVYL 3GGYA 2VL6A 1DPSA 4U671 3GTQL 2C2JA 2V8UA 2A6HD 1L8HA 4Z5SA 1R0GA 4A3ML 2QF9A 2V2OA 3KA3A 4TOHA 5I4JA 1Y1WL 3RZTA 2CEIA 1RWDA 5J93A 1YK5A 2PMZP 2Z5RA 4C2M1 3IQ1A 2K2DA 4ME3A 4Y7NL 4QUWA 4LPJA 4CVRA 5K53A 4ZKWA 2NYDA 1XZ3A 4A3LL 1B2OA 4A3GL 2IU2A 4AR4A 1NF4A 5FFDA 4ZN3B 4A25A 3SH6A 4B8CD 2WLAA 5GAHc 2V2MA 4CVTA 4BXXL 3M3YL 2FG8A 3H99A 4ETRA 3K7AL 5M5XL 1VEIA 3NP0X 1BQ8A 2WTLA 3PVYB 2CR8A 5K52A 2WAQP 1NXEA 3RD0A 2AR0A 4G6BA 1TKOA 3NP2X 1NFVA 4ML5A 3RZDL 2V2LA 2BW1A 5CMRA 1QCVA 3UFBA 2GYQA 2CN6A 4A3CL 3UNOA 1MFRA 4AR5A 5MF6A 4M35A 2FZFA 2PVEA 1F30A 2CN7A 2CKCA 2V0EA 6RXNA 3A9QA 4YXJA 3ISFA 1P7PA 1I6HL 4M32A 3GTPL 3RZ6A 5JKMA 4E6YA 4Y08A 1R0HA 3KYYA 3FI6A 3I4ML 2YU9L 4XGHA 3KDQA 3HL1A 3LWQB 4TOBA 2JD60 3OJ5A 2RBDA 1QGHA 4DE6A 3PKJA 5C3EL 3FRSA 4CMYV 4PGKA 3PW8C 4JAFA 4UY81 1RDVA 1BCFA 1EUMA 1IROA 5IX6A 1JIGA 5IP9L 2PSMC 1CADA 2DSXA 3F39A 1YUZA 3PWQA 4AM5A
chains in the Genus database with same CATH topology
4KXRB 3OGHA 2M6OA 2Z3RB 2YW7A 1SMWA 4AI1A 3KHKA 2WLUA 3PVRA 4K9FA 4ZJKA 4MUDA 5ERKA 2XJPA 4WFN1 5J8WA 1R03A 4DYXA 3U90A 2ZURX 1Z92B 8RXNA 5LBHA 2HR5A 3ERZA 2VZBA 5D8SA 4LPNA 5FFBA 4XXBB 4EVBA 2JD70 4X0JA 1VCXA 3BVKA 3PWFA 5MFPA 1HRSA 1S3QA 3BVIA 1IESA 3GVYA 3RBCA 1JYBA 5EIOC 3PIP1 2CWLA 1BRFA 1TK6A 3TA8A 3Q4QA 2MS3A 4LYXA 2M6PA 4POFA 1ODHA 2FJCA 3WVVA 2LCQA 3SIDA 3KX9A 3AF9X 3Q4NA 1YK4A 3VPBE 3VNXA 3WVWA 3E1PA 1SMUA 4LPMA 3PVYA 3PW1B 2C6AA 4ZTTA 1IRNA 1T9QA 1UMNA 5CMQA 1Z4AA 1RCIA 2PYBA 2FFXJ 3FRRA 5D8QA 4CYBA 3FSEA 3C1ZA 5JVH1 3BT5A 1NF6A 2OKCA 4MY7A 2ITBA 4AI0A 4E40A 2XJRA 4AI2A 3ZG6A 3PVRB 4IXKA 3UOIA 2HTNA 4ITTA 2KN9A 5DM71 1B13A 1BG7A 3F38A 3B0AB 2Y3QA 1VZIA 1S30A 1SOFA 4XKTA 4OYNA 3MPSA 3ISEA 1QYBA 3NOZX 1JI5A 5HJFA 1JREA 5H1Sc 1CAAA 4JADA 1R0FA 1F33A 1BQ9A 2ZG9X 1MOJA 3O7SA 5D8OA 5FEJA 4RC5B 5K2ME 3Q4OA 3PKIA 3Q4RA 2BE5D 3PZAA 4CY9A 5J8SA 1VJXA 2Z5PA 2V2PA 1VELA 1FHAA 2CKAA 4CVSA 3SS2A 3RE7A 3RGDA 3WWLA 5AN9H 3VV9A 3F34A 2ZA7A 4GS7D 2N02A 3PWQC 2CF7A 3QB9A 3R2MA 3FVBA 3NFPI 3WNWA 1VZGA 5MLC3 2CLUA 4U3GA 2PVXA 3KA6A 2GMGA 4ITWA 2A6ED 5J9VA 3MSUA 1GWGA 2X170 4KVRA 3E6SA 2OC5A 4P18A 2VXIA 3K35A 5JKLA 5D8RA 3PVTB 5AI3A 2Z6MA 3EGMA 3DBYA 2G4HA 2XJQA 2L0ZA 2Z3QB 4ZL5A 3LKDA 2JI3A 1J30A 1OTKA 2OH3A 1B2JA 1JKUA 2JD80 3PW1A 4JAGA 4CVPA 5HU6D 2PPTA 2XJTA 4RC8A 4YWMA 1Z6OA 3WVUA 5GU2X 2Z5QA 4ISMA 3R2HA 2UX1A 4DYYA 1FHHA 1NNQA 5DM61 1JKVA 4KVSA 7RXNA 3BVLA 1KRQA 3F35A 3ES3A 5EINC 2H12A 3N6OA 2YW6A 3E1LA 2B5ID 5JVG1 4TOCA 2O5JD 3W54A 4DASA 3E1NA 2ZA8A 4ZL6A 1XZ1A 3LNLA 3R2OA 1SMMA 3D19A 1BE7A 4M33A 3E1MA 5GOUA 4ZN1B 3QHCA 2ERJA 1YUXA 1VZHA 1S24A 3F33A 4MKUA 4YXMA 4EVDA 4RC5A 4II4A 3LPEB 3C1YA 4AM4A 5D8XA 3UOFA 2QL0A 2YJKA 5GN8B 1JGCA 3JZAB 2AYJA 2V2SA 2V15A 3HIUA 1WJVA 1TJOA 3QVDA 1E8JA 3EZ0A 3QHBA 3JZ9A 3H7GA 4E6KA 4YWLA 2J9UB 3SE1A 5HJHA 1VLGA 1LKMA 1IU5A 5AI2A 3PW8A 3PIO1 3AJPA 4DYUA 3V3KB 2V0FA 3T9JA 2V2IA 2V3BB 4CMYA 3KWOA 3B08B 1OWCA 3BVFA 3PVTA 4MN9A 4LQVA 1ZS3A 4M34A 4REUA 5LS9A 1DATA 1N1QA 3KYWA 3J7Z1 1JI4A 2D5KA 4AI3A 4Z3BA 1RB9A 3J7Y1 1LKOA 4RXNA 5MFZA 2ZG7X 3GE4A 2FHAA 3QQCE 1VEQA 2XJMA 5GU1X 4PG0A 3EZUA 3IU3I 1AEWA 3F32A 3AF7X 3GHQA 4II4B 1O9IA 1YV1A 2C2FA 4RC6A 2A69D 3GGZA 4KVQA 4DYZA 1B71A 4V196 2XJSA 5D8PA 2C6BA 3C21A 4ISPA 2FG4A 4TW3A 3KYVA 4TOGA 4YVZA 1RCEA 4RC7B 5C6FA 4DI0A 4W4KB 5E2DA 5JDOB 1RCDA 2XJNA 3F37A 4TOFA 4ZKHA 1T9OA 3BVEA 4XKUA 1L8IA 5ERJA 5D8YA 4AHXA 3KA8A 4TOAA 1SQ3A 2Z90A 1O9RA 3RAVA 2V8TA 1C09A 1UVHA 2F7NA 3KXUA 3KYUA 4LQHA 3AK9A 3KA9A 1LKPA 4TOEA 3AJOA 5CZUA 5GU0X 2ZA6A 1IERA 5LG2A 2V2JA 3SHXA 4AHWA 3R2LA 5GN8A 4AM2A 2W0OA 4R42A 2IY4A 3P8BA 2Y44A 4W4LB 5GADc 4ZKXA 5AXSA 5GAEc 1RDGA 1LTLA 4AHYA 1OWBA 2ERSA 4AR3A 1H96A 4ZMCA 4TPUA 2IB0A 2GS4A 1DVBA 2CHPA 4RC6B 3AJQA 4JAEA 1RCCA 2XJVA 2C6RA 4IWJA 1DX8A 2XKQA 2XGWA 4TODA 2JI1A 2QQYA 4LHNA 4EVEA 2KKDA 5MGNA 2FKZA 2XJUA 2G38B 5E1UA 4LQJA 3R2SA 2VXXA 4XGSA 1FHMA 3M6JA 1IW7D 1RCGA 1T9PA 4PG1A 4EVCA 1R0IA 2MGYA 4AR6A 2BKCA 1H7VA 4PGIA 3VVAA 1JTSA 2CLBA 5GAGc 4ZLWA 5RXNA 4CYAA 3E2CA 3AF8X 2GYDA 3L0MA 3R2KA 4TO9A 3QZ3A 4DZ0A 2BK6A 2YJJA 1BFYA 3A44A 1RYQA 3KA4A 5FFCA 5LG8A 4WJG4 2V2NA 4RC7A 1ZUJA 2FL0A 2C2UA 1BFRA 5JDOA 3F36A 1R0JA 4LYUA 2BJYA 5FFEA 1ZRPA 2CIHA 4MJYA 3E1QA 2WWXB 2CHIA 1TKPA 4YKHA 3A68A 4POGA 1RYTA 3R2RA 4MXPA 3P2AA 5JACA 3E6RA 5HQOA 1LB3A 4LHLA 2ZIXA 1IU6A 3QD8A 5IY0A 3E1JA 3O7RA 2JI2A 3RYGA 3C23A 4TVMA 2M4YA 3WWNB 2C41A 1Z6OM 2RDVA 4XKSA 4ERUA 2ZG8X 3IS7A 4LQNA 4AHZA 2XJOA 1NXGA 3BKNA 2M4VA 2PYAA 3IS8A 3KYXA 5FFAA 5GU3X 5JKLG 5JKMG 3AK8A 3E1OA 2A68D 4IWKA 1S2ZA 2V2RA 3GGYA 2VL6A 1DPSA 4U671 2C2JA 2V8UA 2A6HD 1L8HA 4Z5SA 1R0GA 2QF9A 2V2OA 3KA3A 4TOHA 5I4JA 3RZTA 2CEIA 1RWDA 5J93A 1YK5A 2Z5RA 3IQ1A 2K2DA 4ME3A 4QUWA 4LPJA 4CVRA 5K53A 4ZKWA 2NYDA 1XZ3A 1B2OA 2IU2A 4AR4A 1NF4A 5FFDA 4ZN3B 4A25A 3SH6A 4B8CD 2WLAA 5GAHc 2V2MA 4CVTA 2FG8A 4ETRA 1VEIA 3NP0X 1BQ8A 2WTLA 3PVYB 2CR8A 5K52A 1NXEA 3RD0A 2AR0A 4G6BA 1TKOA 3NP2X 1NFVA 4ML5A 2V2LA 2BW1A 5CMRA 1QCVA 3UFBA 2GYQA 2CN6A 3UNOA 1MFRA 4AR5A 5MF6A 4M35A 2FZFA 2PVEA 1F30A 2CN7A 2CKCA 2V0EA 6RXNA 3A9QA 4YXJA 3ISFA 4M32A 3RZ6A 5JKMA 4E6YA 4Y08A 1R0HA 3KYYA 3FI6A 4XGHA 3KDQA 3HL1A 4TOBA 2JD60 3OJ5A 2RBDA 1QGHA 4DE6A 3PKJA 3FRSA 4CMYV 4PGKA 3PW8C 4JAFA 4UY81 1RDVA 1BCFA 1EUMA 1IROA 5IX6A 1JIGA 2PSMC 1CADA 2DSXA 3F39A 1YUZA 3PWQA 4AM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGH A;  2YW7 A;  1SMW A;  2WLU A;  3PVR A;  4K9F A;  4ZJK A;  4MUD A;  5ERK A;  5J8W A;  1R03 A;  4DYX A;  3U90 A;  2ZUR X;  8RXN A;  5LBH A;  2HR5 A;  3ERZ A;  2VZB A;  5D8S A;  4LPN A;  5FFB A;  4EVB A;  2JD7 0;  1VCX A;  3BVK A;  3PWF A;  1HRS A;  1S3Q A;  3BVI A;  1IES A;  3GVY A;  3RBC A;  1JYB A;  1BRF A;  1TK6 A;  3TA8 A;  3Q4Q A;  2MS3 A;  4LYX A;  4POF A;  2FJC A;  3WVV A;  2LCQ A;  3SID A;  3KX9 A;  3AF9 X;  3Q4N A;  1YK4 A;  3VNX A;  3WVW A;  3E1P A;  1SMU A;  4LPM A;  3PVY A;  3PW1 B;  4ZTT A;  1IRN A;  1T9Q A;  1UMN A;  5CMQ A;  1Z4A A;  1RCI A;  2PYB A;  2FFX J;  4CYB A;  5D8Q A;  3FSE A;  3BT5 A;  1NF6 A;  4MY7 A;  2ITB A;  3PVR B;  4IXK A;  3UOI A;  2HTN A;  4ITT A;  2KN9 A;  1B13 A;  1BG7 A;  3F38 A;  2Y3Q A;  1S30 A;  1SOF A;  4XKT A;  4OYN A;  3MPS A;  3ISE A;  1QYB A;  3NOZ X;  1JI5 A;  5HJF A;  1JRE A;  1CAA A;  1R0F A;  1F33 A;  1BQ9 A;  2ZG9 X;  1MOJ A;  3O7S A;  5D8O A;  5FEJ A;  4RC5 B;  3Q4O A;  3Q4R A;  3PZA A;  4CY9 A;  5J8S A;  1VJX A;  2Z5P A;  2V2P A;  1VEL A;  1FHA A;  4CVS A;  3SS2 A;  3RE7 A;  3RGD A;  3F34 A;  2ZA7 A;  3PWQ C;  2CF7 A;  3QB9 A;  3R2M A;  3FVB A;  3WNW A;  2CLU A;  4U3G A;  2PVX A;  3KA6 A;  2GMG A;  4ITW A;  5J9V A;  1GWG A;  2X17 0;  4KVR A;  3E6S A;  2OC5 A;  4P18 A;  2VXI A;  5JKL A;  5D8R A;  3PVT B;  5AI3 A;  2Z6M A;  3EGM A;  2G4H A;  4ZL5 A;  1J30 A;  1OTK A;  2OH3 A;  1B2J A;  1JKU A;  2JD8 0;  3PW1 A;  4CVP A;  4RC8 A;  4YWM A;  1Z6O A;  3WVU A;  5GU2 X;  2Z5Q A;  4ISM A;  3R2H A;  2UX1 A;  4DYY A;  1FHH A;  1NNQ A;  1JKV A;  4KVS A;  7RXN A;  3BVL A;  1KRQ A;  3F35 A;  3ES3 A;  2YW6 A;  3E1L A;  4TOC A;  4DAS A;  3E1N A;  2ZA8 A;  4ZL6 A;  1XZ1 A;  3R2O A;  1SMM A;  1BE7 A;  4M33 A;  3E1M A;  5GOU A;  3QHC A;  1YUX A;  1S24 A;  3F33 A;  4MKU A;  4EVD A;  4RC5 A;  4II4 A;  4AM4 A;  5D8X A;  3UOF A;  2QL0 A;  2YJK A;  5GN8 B;  1JGC A;  2V2S A;  2V15 A;  3HIU A;  1TJO A;  3QVD A;  1E8J A;  3EZ0 A;  3QHB A;  3H7G A;  4E6K A;  4YWL A;  3SE1 A;  5HJH A;  1VLG A;  1LKM A;  1IU5 A;  5AI2 A;  3PW8 A;  3AJP A;  4DYU A;  3T9J A;  2V2I A;  2V3B B;  4CMY A;  3KWO A;  3BVF A;  3PVT A;  4MN9 A;  4LQV A;  1ZS3 A;  4M34 A;  4REU A;  5LS9 A;  1DAT A;  1N1Q A;  3KYW A;  1JI4 A;  2D5K A;  4Z3B A;  1RB9 A;  1LKO A;  4RXN A;  2ZG7 X;  3GE4 A;  2FHA A;  1VEQ A;  2XJM A;  5GU1 X;  4PG0 A;  3EZU A;  1AEW A;  3F32 A;  3AF7 X;  3GHQ A;  4II4 B;  1O9I A;  1YV1 A;  2C2F A;  4RC6 A;  4KVQ A;  4DYZ A;  1B71 A;  5D8P A;  4ISP A;  2FG4 A;  4TW3 A;  3KYV A;  4TOG A;  1RCE A;  4RC7 B;  5C6F A;  4DI0 A;  5E2D A;  1RCD A;  2XJN A;  3F37 A;  4TOF A;  4ZKH A;  1T9O A;  3BVE A;  4XKU A;  1L8I A;  5ERJ A;  5D8Y A;  3KA8 A;  4TOA A;  1SQ3 A;  2Z90 A;  1O9R A;  3RAV A;  1C09 A;  1UVH A;  2F7N A;  3KXU A;  3KYU A;  4LQH A;  3AK9 A;  3KA9 A;  1LKP A;  4TOE A;  3AJO A;  5CZU A;  5GU0 X;  2ZA6 A;  1IER A;  5LG2 A;  2V2J A;  3SHX A;  3R2L A;  5GN8 A;  4AM2 A;  2W0O A;  4R42 A;  2IY4 A;  4ZKX A;  5AXS A;  1RDG A;  1LTL A;  4AR3 A;  1H96 A;  4ZMC A;  4TPU A;  2IB0 A;  2GS4 A;  1DVB A;  2CHP A;  4RC6 B;  3AJQ A;  1RCC A;  2C6R A;  4IWJ A;  1DX8 A;  2XKQ A;  2XGW A;  4TOD A;  2QQY A;  4EVE A;  2KKD A;  2FKZ A;  5E1U A;  4LQJ A;  3R2S A;  2VXX A;  4XGS A;  1FHM A;  1RCG A;  1T9P A;  4PG1 A;  4EVC A;  1R0I A;  4AR6 A;  2BKC A;  1H7V A;  4PGI A;  1JTS A;  2CLB A;  4ZLW A;  5RXN A;  4CYA A;  3E2C A;  3AF8 X;  2GYD A;  3R2K A;  4TO9 A;  3QZ3 A;  4DZ0 A;  2BK6 A;  2YJJ A;  1BFY A;  3A44 A;  3KA4 A;  5FFC A;  5LG8 A;  2V2N A;  4RC7 A;  1ZUJ A;  2FL0 A;  2C2U A;  1BFR A;  3F36 A;  1R0J A;  4LYU A;  2BJY A;  5FFE A;  1ZRP A;  2CIH A;  4MJY A;  3E1Q A;  2CHI A;  1TKP A;  4YKH A;  3A68 A;  4POG A;  1RYT A;  3R2R A;  5JAC A;  3E6R A;  5HQO A;  1LB3 A;  1IU6 A;  3QD8 A;  5IY0 A;  3E1J A;  3O7R A;  3RYG A;  2M4Y A;  2C41 A;  1Z6O M;  2RDV A;  4XKS A;  4ERU A;  2ZG8 X;  3IS7 A;  4LQN A;  2XJO A;  3BKN A;  2PYA A;  3KYX A;  3IS8 A;  5FFA A;  5GU3 X;  5JKL G;  5JKM G;  3AK8 A;  3E1O A;  4IWK A;  1S2Z A;  2V2R A;  2VL6 A;  1DPS A;  2C2J A;  1L8H A;  4Z5S A;  1R0G A;  2QF9 A;  2V2O A;  3KA3 A;  4TOH A;  5I4J A;  3RZT A;  2CEI A;  1RWD A;  5J93 A;  1YK5 A;  2Z5R A;  3IQ1 A;  2K2D A;  4ME3 A;  4QUW A;  4LPJ A;  4CVR A;  5K53 A;  4ZKW A;  1XZ3 A;  1B2O A;  2IU2 A;  4AR4 A;  1NF4 A;  5FFD A;  4A25 A;  3SH6 A;  2WLA A;  2V2M A;  4CVT A;  2FG8 A;  4ETR A;  1VEI A;  3NP0 X;  1BQ8 A;  2WTL A;  3PVY B;  5K52 A;  3RD0 A;  1TKO A;  3NP2 X;  1NFV A;  4ML5 A;  2V2L A;  2BW1 A;  5CMR A;  1QCV A;  2GYQ A;  2CN6 A;  3UNO A;  1MFR A;  4AR5 A;  4M35 A;  2FZF A;  2PVE A;  1F30 A;  2CN7 A;  6RXN A;  3A9Q A;  3ISF A;  4M32 A;  3RZ6 A;  5JKM A;  4Y08 A;  1R0H A;  3KYY A;  3FI6 A;  3HL1 A;  4TOB A;  2JD6 0;  3OJ5 A;  2RBD A;  1QGH A;  4DE6 A;  4CMY V;  4PGK A;  3PW8 C;  1RDV A;  1BCF A;  1EUM A;  1IRO A;  5IX6 A;  1JIG A;  1CAD A;  2DSX A;  3F39 A;  1YUZ A;  3PWQ A;  4AM5 A; 
#chains in the Genus database with same CATH topology
 4KXR B;  3OGH A;  2M6O A;  2Z3R B;  2Y0S P;  2YW7 A;  4X6A L;  5FJ8 L;  1SMW A;  4AI1 A;  3KHK A;  2WLU A;  3PVR A;  3HAX C;  4K9F A;  4ZJK A;  4MUD A;  5ERK A;  2XJP A;  4BY1 L;  4WFN 1;  5J8W A;  1R03 A;  4DYX A;  3U90 A;  2ZUR X;  1Z92 B;  8RXN A;  5LBH A;  2HR5 A;  2JA5 L;  3ERZ A;  2VZB A;  5D8S A;  4LPN A;  5FFB A;  4XXB B;  4A3B L;  4EVB A;  3LWO B;  2JD7 0;  4X0J A;  1VCX A;  3BVK A;  3PWF A;  5MFP A;  1HRS A;  1S3Q A;  3BVI A;  4C3I L;  1IES A;  1I3Q L;  3GVY A;  4A3J L;  3RBC A;  1JYB A;  5EIO C;  3PIP 1;  2CWL A;  1BRF A;  1TK6 A;  3TA8 A;  3Q4Q A;  2MS3 A;  4LYX A;  2M6P A;  4POF A;  1ODH A;  2FJC A;  3WVV A;  2LCQ A;  3SID A;  2R92 L;  3I4N L;  3KX9 A;  3AF9 X;  3Q4N A;  1YK4 A;  3VPB E;  5M5W L;  3VNX A;  3WVW A;  3E1P A;  1SMU A;  4LPM A;  3PVY A;  3HOV L;  4A93 L;  3PW1 B;  2C6A A;  3H0G L;  4ZTT A;  1IRN A;  1T9Q A;  1UMN A;  5CMQ A;  1Z4A A;  1RCI A;  2PYB A;  2FFX J;  3FRR A;  5D8Q A;  4CYB A;  3FSE A;  3C1Z A;  5JVH 1;  3BT5 A;  2NVT L;  1NF6 A;  2OKC A;  4MY7 A;  2ITB A;  4AI0 A;  4E40 A;  2XJR A;  4AI2 A;  3ZG6 A;  3PVR B;  4IXK A;  3UOI A;  2HTN A;  4ITT A;  2KN9 A;  5DM7 1;  1B13 A;  1BG7 A;  3F38 A;  2E2H L;  3GTL L;  3B0A B;  2Y3Q A;  1VZI A;  4C3H L;  4BBS L;  1S30 A;  1SOF A;  3GTM L;  4XKT A;  4OYN A;  3H97 A;  3MPS A;  3ISE A;  1QYB A;  3NOZ X;  2B63 L;  1JI5 A;  5HJF A;  1JRE A;  5H1S c;  4A3D L;  1CAA A;  4JAD A;  1R0F A;  1F33 A;  2NVX L;  1BQ9 A;  2ZG9 X;  1MOJ A;  3O7S A;  5D8O A;  5FEJ A;  4RC5 B;  5K2M E;  3Q4O A;  3PKI A;  3Q4R A;  3CQZ L;  2WB1 P;  1R9T L;  2BE5 D;  3S2D L;  3PZA A;  4CY9 A;  5J8S A;  1VJX A;  2Z5P A;  2V2P A;  1VEL A;  1FHA A;  2CKA A;  4CVS A;  3SS2 A;  3RE7 A;  3RGD A;  3WWL A;  5AN9 H;  2HVY C;  3VV9 A;  4A3K L;  3F34 A;  2ZA7 A;  2APO B;  2N02 A;  3PWQ C;  3HKZ P;  4GS7 D;  2CF7 A;  3QB9 A;  3R2M A;  3GTO L;  3FVB A;  3NFP I;  3WNW A;  1TWG L;  1VZG A;  5MLC 3;  2CLU A;  4U3G A;  5FLM L;  4A3E L;  2PVX A;  3KA6 A;  2GMG A;  4ITW A;  2A6E D;  5IYD L;  5J9V A;  3MSU A;  1GWG A;  2X17 0;  4KVR A;  3E6S A;  2OC5 A;  3S1R L;  4P18 A;  2VXI A;  2EY4 E;  3K35 A;  5JKL A;  5D8R A;  3PVT B;  5AI3 A;  3MQK B;  2Z6M A;  3EGM A;  3DBY A;  2G4H A;  2XJQ A;  4Y52 L;  2L0Z A;  2Z3Q B;  4ZL5 A;  1PZX A;  3LKD A;  2JI3 A;  1J30 A;  1OTK A;  2OH3 A;  3S15 L;  1TWF L;  1B2J A;  1JKU A;  5IP7 L;  2JD8 0;  3PW1 A;  4JAG A;  4CVP A;  5HU6 D;  2JA8 L;  2PPT A;  2XJT A;  4RC8 A;  4YWM A;  1Z6O A;  3WVU A;  5GU2 X;  2Z5Q A;  4ISM A;  3R2H A;  2UX1 A;  4DYY A;  3JR7 A;  2E2J L;  1FHH A;  3GTG L;  1NNQ A;  5DM6 1;  1JKV A;  4KVS A;  7RXN A;  3BVL A;  1KRQ A;  3F35 A;  2RFK B;  3ES3 A;  1Y1V L;  2H12 A;  5EIN C;  3N6O A;  2YW6 A;  3E1L A;  2B5I D;  5JVG 1;  1F4L A;  4TOC A;  2O5J D;  3W54 A;  4DAS A;  4A3F L;  3E1N A;  2ZA8 A;  4ZL6 A;  1XZ1 A;  3LNL A;  3R2O A;  1SMM A;  1PFU A;  3D19 A;  1BE7 A;  3H3V M;  4M33 A;  3E1M A;  5GOU A;  4ZN1 B;  3QHC A;  2ERJ A;  3HOU L;  1YUX A;  1VZH A;  1S24 A;  3F33 A;  4MKU A;  4YXM A;  4EVD A;  5C4J L;  4RC5 A;  5IYB L;  4II4 A;  3LWR B;  3LPE B;  1PFW A;  3S1Q L;  3C1Y A;  4AM4 A;  5D8X A;  3UOF A;  2QL0 A;  2YJK A;  5GN8 B;  1QQT A;  1JGC A;  3JZA B;  2AYJ A;  2V2S A;  2V15 A;  3HIU A;  3HOX L;  1WJV A;  1TJO A;  3QVD A;  1E8J A;  1WCM L;  3EZ0 A;  3QHB A;  1TWC L;  3JZ9 A;  3H7G A;  4E6K A;  4YWL A;  2JA6 L;  2J9U B;  3SE1 A;  4C3J L;  5HJH A;  1VLG A;  1LKM A;  1IU5 A;  1I50 L;  3PW8 A;  5AI2 A;  3PIO 1;  3AJP A;  4DYU A;  3V3K B;  2V0F A;  4BY7 L;  3T9J A;  2V2I A;  2V3B B;  3S17 L;  4CMY A;  3KWO A;  3B08 B;  1OWC A;  3BVF A;  3PVT A;  4MN9 A;  4LQV A;  1ZS3 A;  4M34 A;  3S16 L;  4REU A;  5LS9 A;  1DAT A;  1N1Q A;  3KYW A;  3J7Z 1;  1JI4 A;  2D5K A;  4AI3 A;  4Z3B A;  1RB9 A;  3J7Y 1;  1LKO A;  4RXN A;  5MFZ A;  2ZG7 X;  3GE4 A;  3S2H L;  2FHA A;  3QQC E;  1VEQ A;  2XJM A;  5GU1 X;  4PG0 A;  3EZU A;  3IU3 I;  1AEW A;  3F32 A;  3AF7 X;  3GHQ A;  4II4 B;  1O9I A;  1YV1 A;  2C2F A;  4RC6 A;  2A69 D;  3M4O L;  3GGZ A;  4KVQ A;  4DYZ A;  1B71 A;  4V19 6;  2XJS A;  5D8P A;  2C6B A;  3C21 A;  4ISP A;  2FG4 A;  4TW3 A;  3KYV A;  4TOG A;  4YVZ A;  1RCE A;  4RC7 B;  5C6F A;  4DI0 A;  4W4K B;  5E2D A;  3HOY L;  5JDO B;  1RCD A;  2XJN A;  3F37 A;  4TOF A;  4ZKH A;  1T9O A;  3BVE A;  4XKU A;  1L8I A;  5ERJ A;  5D8Y A;  4AHX A;  3KA8 A;  4TOA A;  1SFO L;  1SQ3 A;  2Z90 A;  1O9R A;  3H9C A;  3HJW B;  3RAV A;  2V8T A;  1C09 A;  2NVQ L;  1UVH A;  2F7N A;  3KXU A;  3GTJ L;  3KYU A;  3PL5 A;  4LQH A;  3AK9 A;  4QIW P;  5M5Y L;  3KA9 A;  1LKP A;  4TOE A;  3AJO A;  5CZU A;  5GU0 X;  2ZA6 A;  1IER A;  2E2I L;  5LG2 A;  2V2J A;  3SHX A;  4AHW A;  3R2L A;  5GN8 A;  4AM2 A;  2W0O A;  4R42 A;  2IY4 A;  3P8B A;  2VUM L;  3RZO L;  2Y44 A;  4W4L B;  5GAD c;  3PO3 L;  4ZKX A;  5AXS A;  5GAE c;  1RDG A;  1LTL A;  4AHY A;  1OWB A;  2ERS A;  4AR3 A;  1PFV A;  1H96 A;  4ZMC A;  4TPU A;  1TWH L;  2IB0 A;  2GS4 A;  1DVB A;  2CHP A;  4RC6 B;  3AJQ A;  4JAE A;  1RCC A;  2XJV A;  2C6R A;  4IWJ A;  1DX8 A;  2XKQ A;  2XGW A;  4TOD A;  2JI1 A;  2QQY A;  3FKI L;  4LHN A;  4EVE A;  2KKD A;  5MGN A;  2FKZ A;  2XJU A;  2G38 B;  5E1U A;  4LQJ A;  5C44 L;  3R2S A;  2VXX A;  4XGS A;  1FHM A;  2AUS B;  3M6J A;  1IW7 D;  1RCG A;  1T9P A;  4PG1 A;  4EVC A;  5M3M L;  1R0I A;  1TWA L;  2MGY A;  4AR6 A;  3HJY B;  2BKC A;  1H7V A;  4PGI A;  3VVA A;  1JTS A;  1K83 L;  2CLB A;  5GAG c;  4ZLW A;  3HOW L;  5RXN A;  5M3F L;  4CYA A;  3E2C A;  3AF8 X;  2GYD A;  3L0M A;  3R2K A;  4TO9 A;  3QZ3 A;  4DZ0 A;  3H9B A;  2R7Z L;  2BK6 A;  2YJJ A;  1BFY A;  3A44 A;  5C4X L;  1RYQ A;  3KA4 A;  5FFC A;  3S14 L;  3LWV B;  5LG8 A;  4WJG 4;  2V2N A;  4RC7 A;  1ZUJ A;  2FL0 A;  2AQC A;  2C2U A;  1BFR A;  5JDO A;  3F36 A;  1R0J A;  4LYU A;  2BJY A;  5FFE A;  1ZRP A;  2CIH A;  4MJY A;  3E1Q A;  2WWX B;  2CHI A;  1TKP A;  3GTK L;  4YKH A;  3A68 A;  4POG A;  1RYT A;  3R2R A;  4A3I L;  4MXP A;  3P2A A;  3PO2 L;  5JAC A;  3E6R A;  5HQO A;  1LB3 A;  4AYB P;  4LHL A;  3LWP B;  2ZIX A;  1IU6 A;  3QD8 A;  3FDJ A;  5IY0 A;  3E1J A;  2R93 L;  3O7R A;  2JI2 A;  4BBR L;  3RYG A;  3C23 A;  4TVM A;  2M4Y A;  3WWN B;  2C41 A;  1Z6O M;  2RDV A;  4XKS A;  4ERU A;  3HOZ L;  3S1M L;  2ZG8 X;  3S1N L;  3IS7 A;  4LQN A;  4AHZ A;  2JA7 L;  2XJO A;  1NXG A;  3BKN A;  2M4V A;  2PYA A;  3IS8 A;  3KYX A;  5FFA A;  1PFY A;  5GU3 X;  5JKL G;  5JKM G;  5IYC L;  3AK8 A;  3E1O A;  2A68 D;  4IWK A;  1S2Z A;  2V2R A;  2NVY L;  3GGY A;  2VL6 A;  1DPS A;  4U67 1;  3GTQ L;  2C2J A;  2V8U A;  2A6H D;  1L8H A;  4Z5S A;  1R0G A;  4A3M L;  2QF9 A;  2V2O A;  3KA3 A;  4TOH A;  5I4J A;  1Y1W L;  3RZT A;  2CEI A;  1RWD A;  5J93 A;  1YK5 A;  2PMZ P;  2Z5R A;  4C2M 1;  3IQ1 A;  2K2D A;  4ME3 A;  4Y7N L;  4QUW A;  4LPJ A;  4CVR A;  5K53 A;  4ZKW A;  2NYD A;  1XZ3 A;  4A3L L;  1B2O A;  4A3G L;  2IU2 A;  4AR4 A;  1NF4 A;  5FFD A;  4ZN3 B;  4A25 A;  3SH6 A;  4B8C D;  2WLA A;  5GAH c;  2V2M A;  4CVT A;  4BXX L;  3M3Y L;  2FG8 A;  3H99 A;  4ETR A;  3K7A L;  5M5X L;  1VEI A;  3NP0 X;  1BQ8 A;  2WTL A;  3PVY B;  2CR8 A;  5K52 A;  2WAQ P;  1NXE A;  3RD0 A;  2AR0 A;  4G6B A;  1TKO A;  3NP2 X;  1NFV A;  4ML5 A;  3RZD L;  2V2L A;  2BW1 A;  5CMR A;  1QCV A;  3UFB A;  2GYQ A;  2CN6 A;  4A3C L;  3UNO A;  1MFR A;  4AR5 A;  5MF6 A;  4M35 A;  2FZF A;  2PVE A;  1F30 A;  2CN7 A;  2CKC A;  2V0E A;  6RXN A;  3A9Q A;  4YXJ A;  3ISF A;  1P7P A;  1I6H L;  4M32 A;  3GTP L;  3RZ6 A;  5JKM A;  4E6Y A;  4Y08 A;  1R0H A;  3KYY A;  3FI6 A;  3I4M L;  2YU9 L;  4XGH A;  3KDQ A;  3HL1 A;  3LWQ B;  4TOB A;  2JD6 0;  3OJ5 A;  2RBD A;  1QGH A;  4DE6 A;  3PKJ A;  5C3E L;  3FRS A;  4CMY V;  4PGK A;  3PW8 C;  4JAF A;  4UY8 1;  1RDV A;  1BCF A;  1EUM A;  1IRO A;  5IX6 A;  1JIG A;  5IP9 L;  2PSM C;  1CAD A;  2DSX A;  3F39 A;  1YUZ A;  3PWQ A;  4AM5 A; 
#chains in the Genus database with same CATH homology
 4KXR B;  3OGH A;  2M6O A;  2Z3R B;  2YW7 A;  1SMW A;  4AI1 A;  3KHK A;  2WLU A;  3PVR A;  4K9F A;  4ZJK A;  4MUD A;  5ERK A;  2XJP A;  4WFN 1;  5J8W A;  1R03 A;  4DYX A;  3U90 A;  2ZUR X;  1Z92 B;  8RXN A;  5LBH A;  2HR5 A;  3ERZ A;  2VZB A;  5D8S A;  4LPN A;  5FFB A;  4XXB B;  4EVB A;  2JD7 0;  4X0J A;  1VCX A;  3BVK A;  3PWF A;  5MFP A;  1HRS A;  1S3Q A;  3BVI A;  1IES A;  3GVY A;  3RBC A;  1JYB A;  5EIO C;  3PIP 1;  2CWL A;  1BRF A;  1TK6 A;  3TA8 A;  3Q4Q A;  2MS3 A;  4LYX A;  2M6P A;  4POF A;  1ODH A;  2FJC A;  3WVV A;  2LCQ A;  3SID A;  3KX9 A;  3AF9 X;  3Q4N A;  1YK4 A;  3VPB E;  3VNX A;  3WVW A;  3E1P A;  1SMU A;  4LPM A;  3PVY A;  3PW1 B;  2C6A A;  4ZTT A;  1IRN A;  1T9Q A;  1UMN A;  5CMQ A;  1Z4A A;  1RCI A;  2PYB A;  2FFX J;  3FRR A;  5D8Q A;  4CYB A;  3FSE A;  3C1Z A;  5JVH 1;  3BT5 A;  1NF6 A;  2OKC A;  4MY7 A;  2ITB A;  4AI0 A;  4E40 A;  2XJR A;  4AI2 A;  3ZG6 A;  3PVR B;  4IXK A;  3UOI A;  2HTN A;  4ITT A;  2KN9 A;  5DM7 1;  1B13 A;  1BG7 A;  3F38 A;  3B0A B;  2Y3Q A;  1VZI A;  1S30 A;  1SOF A;  4XKT A;  4OYN A;  3MPS A;  3ISE A;  1QYB A;  3NOZ X;  1JI5 A;  5HJF A;  1JRE A;  5H1S c;  1CAA A;  4JAD A;  1R0F A;  1F33 A;  1BQ9 A;  2ZG9 X;  1MOJ A;  3O7S A;  5D8O A;  5FEJ A;  4RC5 B;  5K2M E;  3Q4O A;  3PKI A;  3Q4R A;  2BE5 D;  3PZA A;  4CY9 A;  5J8S A;  1VJX A;  2Z5P A;  2V2P A;  1VEL A;  1FHA A;  2CKA A;  4CVS A;  3SS2 A;  3RE7 A;  3RGD A;  3WWL A;  5AN9 H;  3VV9 A;  3F34 A;  2ZA7 A;  4GS7 D;  2N02 A;  3PWQ C;  2CF7 A;  3QB9 A;  3R2M A;  3FVB A;  3NFP I;  3WNW A;  1VZG A;  5MLC 3;  2CLU A;  4U3G A;  2PVX A;  3KA6 A;  2GMG A;  4ITW A;  2A6E D;  5J9V A;  3MSU A;  1GWG A;  2X17 0;  4KVR A;  3E6S A;  2OC5 A;  4P18 A;  2VXI A;  3K35 A;  5JKL A;  5D8R A;  3PVT B;  5AI3 A;  2Z6M A;  3EGM A;  3DBY A;  2G4H A;  2XJQ A;  2L0Z A;  2Z3Q B;  4ZL5 A;  3LKD A;  2JI3 A;  1J30 A;  1OTK A;  2OH3 A;  1B2J A;  1JKU A;  2JD8 0;  3PW1 A;  4JAG A;  4CVP A;  5HU6 D;  2PPT A;  2XJT A;  4RC8 A;  4YWM A;  1Z6O A;  3WVU A;  5GU2 X;  2Z5Q A;  4ISM A;  3R2H A;  2UX1 A;  4DYY A;  1FHH A;  1NNQ A;  5DM6 1;  1JKV A;  4KVS A;  7RXN A;  3BVL A;  1KRQ A;  3F35 A;  3ES3 A;  5EIN C;  2H12 A;  3N6O A;  2YW6 A;  3E1L A;  2B5I D;  5JVG 1;  4TOC A;  2O5J D;  3W54 A;  4DAS A;  3E1N A;  2ZA8 A;  4ZL6 A;  1XZ1 A;  3LNL A;  3R2O A;  1SMM A;  3D19 A;  1BE7 A;  4M33 A;  3E1M A;  5GOU A;  4ZN1 B;  3QHC A;  2ERJ A;  1YUX A;  1VZH A;  1S24 A;  3F33 A;  4MKU A;  4YXM A;  4EVD A;  4RC5 A;  4II4 A;  3LPE B;  3C1Y A;  4AM4 A;  5D8X A;  3UOF A;  2QL0 A;  2YJK A;  5GN8 B;  1JGC A;  3JZA B;  2AYJ A;  2V2S A;  2V15 A;  3HIU A;  1WJV A;  1TJO A;  3QVD A;  1E8J A;  3EZ0 A;  3QHB A;  3JZ9 A;  3H7G A;  4E6K A;  4YWL A;  2J9U B;  3SE1 A;  5HJH A;  1VLG A;  1LKM A;  1IU5 A;  5AI2 A;  3PW8 A;  3PIO 1;  3AJP A;  4DYU A;  3V3K B;  2V0F A;  3T9J A;  2V2I A;  2V3B B;  4CMY A;  3KWO A;  3B08 B;  1OWC A;  3BVF A;  3PVT A;  4MN9 A;  4LQV A;  1ZS3 A;  4M34 A;  4REU A;  5LS9 A;  1DAT A;  1N1Q A;  3KYW A;  3J7Z 1;  1JI4 A;  2D5K A;  4AI3 A;  4Z3B A;  1RB9 A;  3J7Y 1;  1LKO A;  4RXN A;  5MFZ A;  2ZG7 X;  3GE4 A;  2FHA A;  3QQC E;  1VEQ A;  2XJM A;  5GU1 X;  4PG0 A;  3EZU A;  3IU3 I;  1AEW A;  3F32 A;  3AF7 X;  3GHQ A;  4II4 B;  1O9I A;  1YV1 A;  2C2F A;  4RC6 A;  2A69 D;  3GGZ A;  4KVQ A;  4DYZ A;  1B71 A;  4V19 6;  2XJS A;  5D8P A;  2C6B A;  3C21 A;  4ISP A;  2FG4 A;  4TW3 A;  3KYV A;  4TOG A;  4YVZ A;  1RCE A;  4RC7 B;  5C6F A;  4DI0 A;  4W4K B;  5E2D A;  5JDO B;  1RCD A;  2XJN A;  3F37 A;  4TOF A;  4ZKH A;  1T9O A;  3BVE A;  4XKU A;  1L8I A;  5ERJ A;  5D8Y A;  4AHX A;  3KA8 A;  4TOA A;  1SQ3 A;  2Z90 A;  1O9R A;  3RAV A;  2V8T A;  1C09 A;  1UVH A;  2F7N A;  3KXU A;  3KYU A;  4LQH A;  3AK9 A;  3KA9 A;  1LKP A;  4TOE A;  3AJO A;  5CZU A;  5GU0 X;  2ZA6 A;  1IER A;  5LG2 A;  2V2J A;  3SHX A;  4AHW A;  3R2L A;  5GN8 A;  4AM2 A;  2W0O A;  4R42 A;  2IY4 A;  3P8B A;  2Y44 A;  4W4L B;  5GAD c;  4ZKX A;  5AXS A;  5GAE c;  1RDG A;  1LTL A;  4AHY A;  1OWB A;  2ERS A;  4AR3 A;  1H96 A;  4ZMC A;  4TPU A;  2IB0 A;  2GS4 A;  1DVB A;  2CHP A;  4RC6 B;  3AJQ A;  4JAE A;  1RCC A;  2XJV A;  2C6R A;  4IWJ A;  1DX8 A;  2XKQ A;  2XGW A;  4TOD A;  2JI1 A;  2QQY A;  4LHN A;  4EVE A;  2KKD A;  5MGN A;  2FKZ A;  2XJU A;  2G38 B;  5E1U A;  4LQJ A;  3R2S A;  2VXX A;  4XGS A;  1FHM A;  3M6J A;  1IW7 D;  1RCG A;  1T9P A;  4PG1 A;  4EVC A;  1R0I A;  2MGY A;  4AR6 A;  2BKC A;  1H7V A;  4PGI A;  3VVA A;  1JTS A;  2CLB A;  5GAG c;  4ZLW A;  5RXN A;  4CYA A;  3E2C A;  3AF8 X;  2GYD A;  3L0M A;  3R2K A;  4TO9 A;  3QZ3 A;  4DZ0 A;  2BK6 A;  2YJJ A;  1BFY A;  3A44 A;  1RYQ A;  3KA4 A;  5FFC A;  5LG8 A;  4WJG 4;  2V2N A;  4RC7 A;  1ZUJ A;  2FL0 A;  2C2U A;  1BFR A;  5JDO A;  3F36 A;  1R0J A;  4LYU A;  2BJY A;  5FFE A;  1ZRP A;  2CIH A;  4MJY A;  3E1Q A;  2WWX B;  2CHI A;  1TKP A;  4YKH A;  3A68 A;  4POG A;  1RYT A;  3R2R A;  4MXP A;  3P2A A;  5JAC A;  3E6R A;  5HQO A;  1LB3 A;  4LHL A;  2ZIX A;  1IU6 A;  3QD8 A;  5IY0 A;  3E1J A;  3O7R A;  2JI2 A;  3RYG A;  3C23 A;  4TVM A;  2M4Y A;  3WWN B;  2C41 A;  1Z6O M;  2RDV A;  4XKS A;  4ERU A;  2ZG8 X;  3IS7 A;  4LQN A;  4AHZ A;  2XJO A;  1NXG A;  3BKN A;  2M4V A;  2PYA A;  3IS8 A;  3KYX A;  5FFA A;  5GU3 X;  5JKL G;  5JKM G;  3AK8 A;  3E1O A;  2A68 D;  4IWK A;  1S2Z A;  2V2R A;  3GGY A;  2VL6 A;  1DPS A;  4U67 1;  2C2J A;  2V8U A;  2A6H D;  1L8H A;  4Z5S A;  1R0G A;  2QF9 A;  2V2O A;  3KA3 A;  4TOH A;  5I4J A;  3RZT A;  2CEI A;  1RWD A;  5J93 A;  1YK5 A;  2Z5R A;  3IQ1 A;  2K2D A;  4ME3 A;  4QUW A;  4LPJ A;  4CVR A;  5K53 A;  4ZKW A;  2NYD A;  1XZ3 A;  1B2O A;  2IU2 A;  4AR4 A;  1NF4 A;  5FFD A;  4ZN3 B;  4A25 A;  3SH6 A;  4B8C D;  2WLA A;  5GAH c;  2V2M A;  4CVT A;  2FG8 A;  4ETR A;  1VEI A;  3NP0 X;  1BQ8 A;  2WTL A;  3PVY B;  2CR8 A;  5K52 A;  1NXE A;  3RD0 A;  2AR0 A;  4G6B A;  1TKO A;  3NP2 X;  1NFV A;  4ML5 A;  2V2L A;  2BW1 A;  5CMR A;  1QCV A;  3UFB A;  2GYQ A;  2CN6 A;  3UNO A;  1MFR A;  4AR5 A;  5MF6 A;  4M35 A;  2FZF A;  2PVE A;  1F30 A;  2CN7 A;  2CKC A;  2V0E A;  6RXN A;  3A9Q A;  4YXJ A;  3ISF A;  4M32 A;  3RZ6 A;  5JKM A;  4E6Y A;  4Y08 A;  1R0H A;  3KYY A;  3FI6 A;  4XGH A;  3KDQ A;  3HL1 A;  4TOB A;  2JD6 0;  3OJ5 A;  2RBD A;  1QGH A;  4DE6 A;  3PKJ A;  3FRS A;  4CMY V;  4PGK A;  3PW8 C;  4JAF A;  4UY8 1;  1RDV A;  1BCF A;  1EUM A;  1IRO A;  5IX6 A;  1JIG A;  2PSM C;  1CAD A;  2DSX A;  3F39 A;  1YUZ A;  3PWQ A;  4AM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...