3EZ0A

Crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
216
Chain Sequence
b'TSPADTARYNRFVADLFGMMAYGELSAFERFSADARYSPTLHDRAVLGRIAVVEFRHYELVSARLEAMGIDAEDAMLPFQAAVDYFHSRTRPADWYESLMKAYVIDTVSADFYRAISRYVDAGTRDVIEQIQASDETTEVLRERLRSALADDPRLASRLALWGRRLLGEALTQAQRVSYEHAFLGSLIAAAKELVSGLIAGLAEKHSKRMTQLGLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein with ferritin-like fold
publication title Crystal structure of protein of unknown function with ferritin-like fold (YP_832262.1) from Arthrobacter sp. FB24 at 2.33 A resolution
rcsb
source organism Arthrobacter sp. fb24
molecule tags Structural genomics, unknown function
total genus 81
structure length 216
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13794 MiaE_2 tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ez0A00
1JI4A 2V2JA 1NNQA 3EZUA 3IS7A 2HR5A 3R2KA 2XJMA 3PW8A 2VXXA 5J8SA 5E2DA 5D8RA 2C6RA 5D8YA 4CMYV 3AK9A 2CIHA 2FZFA 2CLBA 4M35A 4CVTA 5GU2X 3UOIA 2JD70 4TW3A 1DATA 1ZUJA 2Z5PA 1N1QA 1JI5A 2V2NA 2V2IA 4ZMCA 4ITTA 5CZUA 3NOZX 5LG8A 1QGHA 2GS4A 4ZJKA 1RCEA 1RCDA 2FG4A 2ITBA 2YW6A 4IXKA 1YV1A 2FJCA 1MFRA 2CLUA 3H7GA 4P18A 5GOUA 2F7NA 4TOHA 4RC6A 3SH6A 3EZ0A 1TK6A 4LQJA 2BK6A 3E1PA 1UVHA 2WTLA 4RC6B 4DYZA 1SQ3A 2XKQA 2QQYA 4Z3BA 3R2RA 2JD60 2QF9A 1VEQA 3PZAA 1GWGA 3BVKA 3R2HA 3RD0A 1JKVA 3PVTA 1LKOA 3KA9A 3PVTB 1BCFA 5LS9A 2CHIA 4DI0A 2XGWA 3GVYA 4EVCA 4AM4A 3KA8A 3R2SA 5HJHA 1BFRA 2YJKA 3KA4A 4R42A 1NFVA 1S2ZA 3U90A 4ERUA 2V15A 1MOJA 1SOFA 1B71A 4PG1A 1LKMA 2RBDA 3MPSA 2ZG9X 4M34A 4PGKA 3WVWA 4ETRA 4TOEA 4DZ0A 1EUMA 2IB0A 3BT5A 5FFCA 3E2CA 4TODA 3AJPA 1VEIA 3BVEA 4E6KA 3PWQA 2JD80 5FFBA 2D5KA 1IERA 2IY4A 3AJQA 4OYNA 4CVSA 5FFDA 3HIUA 1F30A 4KVSA 5JACA 1NF4A 2ZG8X 3AF8X 3SHXA 3F32A 3Q4OA 4II4A 3QVDA 4DE6A 3NP2X 2CEIA 2Z6MA 2BKCA 3QHCA 1TJOA 1JGCA 4II4B 3ISEA 3ES3A 1JIGA 3SE1A 5J9VA 5E1UA 1OTKA 2YW7A 1VELA 2ZA6A 3IQ1A 4IWKA 4XKSA 4Z5SA 5HQOA 3E6RA 3F38A 4TOGA 1JKUA 2BJYA 3F36A 5ERKA 5J93A 5JKMG 3GHQA 1JREA 3SIDA 4A25A 4ISPA 1L8IA 4MY7A 1R03A 2V2MA 3O7SA 2X170 4QUWA 2UX1A 1RCGA 4ZL5A 4TOAA 4AM2A 1Z6OA 3PW1A 5JKLA 5J8WA 5C6FA 4LPNA 2W0OA 2ZA7A 3PW1B 3WVVA 2C2UA 3E1LA 1RCIA 2YJJA 3Q4QA 1L8HA 3E1MA 3R2OA 3RBCA 3PWQC 3WVUA 3WNWA 4YKHA 2WLAA 4Y08A 1JTSA 1LKPA 5D8OA 5K53A 4EVBA 2ZG7X 4ZKHA 2XJOA 5CMRA 2CN7A 1F33A 2HTNA 3E6SA 3BVFA 4TOFA 1HRSA 2XJNA 3F35A 4IWJA 2GYDA 4CYAA 4XKUA 4RC5A 5FFEA 1XZ3A 3PW8C 2GYQA 5JKMA 4RC5B 5GU3X 4ZLWA 2C2FA 3BVLA 3KA3A 3IS8A 3KX9A 1UMNA 4LYUA 2C2JA 1VLGA 3E1NA 1S3QA 4ISMA 4DYUA 5ERJA 3OJ5A 4CVPA 5D8SA 2V2OA 2Z5RA 4CY9A 1JYBA 1Z6OM 2OC5A 2FL0A 3PVYA 4ZKWA 4MN9A 1ZS3A 3E1OA 3PVRA 2IU2A 3PWFA 3QB9A 3PVYB 3PVRB 3QHBA 1O9RA 3BKNA 3F34A 4EVEA 1H96A 2CN6A 3GE4A 3ISFA 4ZTTA 5GN8A 2Y3QA 5GN8B 5AXSA 4LPMA 1DVBA 4DYYA 4EVDA 4RC8A 5D8PA 5K52A 4DASA 3F39A 2V2PA 3EGMA 4REUA 1Z4AA 4XGSA 4ML5A 3RGDA 3AF7X 2BW1A 3FI6A 3AF9X 3AJOA 4DYXA 5FFAA 1YUXA 1YUZA 3F37A 3R2MA 3A9QA 1QYBA 2FG8A 3R2LA 3HL1A 3KXUA 2FHAA 1NF6A 1RCCA 2V2RA 2VXIA 2C41A 4LPJA 5HJFA 2V2SA 4LQHA 1DPSA 1IESA 4TOBA 2WLUA 3Q4RA 5FEJA 4PGIA 3UNOA 4RC7A 3VNXA 4M32A 2VZBA 3FSEA 4AM5A 4M33A 1VJXA 4RC7B 5D8XA 3F33A 4CMYA 4TOCA 5GU0X 4KVQA 5CMQA 3OGHA 1TKPA 1KRQA 4LQVA 2FFXJ 1TKOA 2V2LA 2CHPA 1FHAA 3FVBA 3A68A 5IX6A 4TO9A 4ITWA 3UOFA 4XKTA 1RYTA 3E1QA 3BVIA 4ZL6A 2Z90A 2CF7A 3KA6A 4MUDA 3T9JA 3TA8A 3AK8A 4ZKXA 4U3GA 1BG7A 2ZURX 1J30A 3KWOA 5I4JA 2FKZA 3ERZA 4LQNA 1O9IA 4KVRA 2Z5QA 5LBHA 1LB3A 4MKUA 3RAVA 3O7RA 2PYBA 3NP0X 4LYXA 3QZ3A 5D8QA 1XZ1A 5LG2A 3QD8A 5JKLG 3E1JA 3RE7A 4PG0A 3Q4NA 5GU1X 1S30A 2OH3A 4CVRA 4CYBA 2ZA8A 4MJYA 2G4HA 1AEWA
chains in the Genus database with same CATH superfamily
1JI4A 2V2JA 1NNQA 3EZUA 3IS7A 3KHKA 2HR5A 3R2KA 2XJMA 3PW8A 2VXXA 2G38B 5J8SA 5E2DA 5D8RA 2Y44A 2C6RA 5D8YA 4CMYV 3AK9A 2CIHA 2FZFA 2CLBA 4M35A 4CVTA 5GU2X 3UOIA 2JD70 4X0JA 4TW3A 1DATA 1ZUJA 2Z5PA 1N1QA 1JI5A 2V2NA 2V2IA 4ZMCA 4ITTA 2MGYA 5CZUA 3NOZX 5LG8A 1QGHA 2GS4A 4ZJKA 1RCEA 1RCDA 2FG4A 2ITBA 4YVZA 2OKCA 2YW6A 4MXPA 4IXKA 1YV1A 2FJCA 1MFRA 2CLUA 3H7GA 4P18A 5GOUA 2F7NA 4TOHA 4RC6A 3SH6A 3EZ0A 1TK6A 4LQJA 2BK6A 2AR0A 3E1PA 1UVHA 2WTLA 3LKDA 4RC6B 4YXJA 4DYZA 1SQ3A 2XKQA 2QQYA 4Z3BA 3L0MA 3R2RA 2JD60 2QF9A 1VEQA 4E40A 3PZAA 1GWGA 3BVKA 3R2HA 3RD0A 1JKVA 3PVTA 1LKOA 3KA9A 3M6JA 3PVTB 1BCFA 5LS9A 2CHIA 4DI0A 2XGWA 3GVYA 4EVCA 4AM4A 3KA8A 3R2SA 5HJHA 1BFRA 2YJKA 3KA4A 4R42A 1NFVA 1S2ZA 3U90A 4ERUA 2V15A 1MOJA 1SOFA 1B71A 4PG1A 1LKMA 2RBDA 3VVAA 3MPSA 2ZG9X 4M34A 4PGKA 3WVWA 4ETRA 4TOEA 4DZ0A 1EUMA 2IB0A 3BT5A 5FFCA 3E2CA 4TODA 3AJPA 1VEIA 3BVEA 4E6KA 3PWQA 2JD80 5FFBA 2D5KA 1IERA 2IY4A 3AJQA 4OYNA 4CVSA 5FFDA 3HIUA 1F30A 4KVSA 5JACA 1NF4A 2ZG8X 3AF8X 3SHXA 3F32A 3Q4OA 4II4A 3QVDA 4DE6A 3NP2X 2CEIA 3DBYA 2Z6MA 2BKCA 3QHCA 1TJOA 1JGCA 4II4B 3ISEA 3ES3A 1JIGA 3SE1A 5J9VA 3C1ZA 5E1UA 1OTKA 4W4KB 2YW7A 1VELA 2ZA6A 3IQ1A 4IWKA 4XKSA 4Z5SA 5HQOA 3E6RA 3F38A 4TOGA 1JKUA 2BJYA 3C23A 3F36A 5ERKA 5J93A 5JKMG 3GHQA 1JREA 3W54A 3SIDA 4A25A 4ISPA 1L8IA 4MY7A 1R03A 2V2MA 3O7SA 2X170 4QUWA 2V8TA 2UX1A 1RCGA 4ZL5A 4TOAA 4AM2A 1Z6OA 2CWLA 3PW1A 3N6OA 5J8WA 5JKLA 5C6FA 4LPNA 2W0OA 2ZA7A 3PW1B 3WVVA 2C2UA 3E1LA 1RCIA 2YJJA 3Q4QA 1L8HA 3E1MA 3R2OA 3RBCA 3PWQC 3WVUA 5HU6D 3UFBA 4YKHA 3WNWA 4YXMA 2WLAA 4Y08A 1JTSA 1LKPA 5D8OA 5K53A 3VV9A 4EVBA 2ZG7X 4ZKHA 2XJOA 5CMRA 2CN7A 1F33A 2HTNA 3E6SA 3BVFA 4TOFA 1HRSA 5JDOA 2XJNA 3F35A 4IWJA 2N02A 5JDOB 2GYDA 4CYAA 4XKUA 3D19A 4RC5A 5FFEA 1XZ3A 3PW8C 2GYQA 5JKMA 4RC5B 5GU3X 4ZLWA 2C2FA 3BVLA 3KA3A 3IS8A 3KX9A 1UMNA 3KDQA 4LYUA 2C2JA 1VLGA 3E1NA 1S3QA 4ISMA 4DYUA 5ERJA 3OJ5A 4CVPA 3FRRA 5D8SA 2V2OA 3JZ9A 2Z5RA 4CY9A 1JYBA 1Z6OM 2OC5A 2FL0A 3PVYA 4ZKWA 4MN9A 1ZS3A 3E1OA 3PVRA 2IU2A 3PWFA 3QB9A 3PVYB 3PVRB 3QHBA 1O9RA 3BKNA 3F34A 4EVEA 1H96A 2CN6A 3GE4A 3ISFA 4ZTTA 5GN8A 2Y3QA 5GN8B 5AXSA 4LPMA 1DVBA 4DYYA 4EVDA 4RC8A 5D8PA 5K52A 4DASA 3F39A 2V2PA 3EGMA 4REUA 1Z4AA 4XGSA 4ML5A 3RGDA 3AF7X 2BW1A 3FI6A 3AF9X 3AJOA 3GGZA 4DYXA 5FFAA 2WWXB 1YUXA 1YUZA 3F37A 3R2MA 3A9QA 1QYBA 2FG8A 3GGYA 3R2LA 3HL1A 3KXUA 3JZAB 2FHAA 1NF6A 1RCCA 2V2RA 4W4LB 2VXIA 2C41A 4LPJA 3FRSA 5HJFA 2V2SA 4LQHA 1DPSA 1IESA 4TOBA 2WLUA 3Q4RA 5FEJA 4PGIA 3UNOA 4RC7A 3VNXA 4M32A 2V8UA 2VZBA 3FSEA 4AM5A 4M33A 1VJXA 4RC7B 5D8XA 3F33A 4CMYA 4TOCA 5GU0X 4KXRB 4KVQA 5CMQA 3OGHA 1TKPA 1KRQA 4LQVA 2FFXJ 1TKOA 2V2LA 2CHPA 1FHAA 3FVBA 3A68A 5IX6A 4TO9A 4WJG4 4ITWA 3UOFA 4XKTA 1RYTA 3E1QA 3BVIA 4ZL6A 2Z90A 2CF7A 3KA6A 4MUDA 3T9JA 3TA8A 3AK8A 4ZKXA 4U3GA 1BG7A 2ZURX 1J30A 3KWOA 5I4JA 2FKZA 3ERZA 3C21A 4LQNA 1O9IA 4KVRA 2Z5QA 5LBHA 1LB3A 4MKUA 3RAVA 3O7RA 2PYBA 3NP0X 4LYXA 3QZ3A 5D8QA 1XZ1A 3C1YA 5LG2A 3QD8A 5JKLG 3E1JA 3RE7A 3V3KB 4PG0A 3Q4NA 5GU1X 1S30A 2OH3A 4CVRA 4CYBA 2ZA8A 4MJYA 2G4HA 1AEWA
chains in the Genus database with same CATH topology
1JI4A 2V2JA 1NNQA 3EZUA 3IS7A 3KHKA 2HR5A 3R2KA 2XJMA 3PW8A 2VXXA 2G38B 5J8SA 5E2DA 5D8RA 2Y44A 2C6RA 5D8YA 4CMYV 3AK9A 2CIHA 2FZFA 2CLBA 4M35A 4CVTA 5GU2X 3UOIA 2JD70 4X0JA 4TW3A 1DATA 1ZUJA 2Z5PA 1N1QA 1JI5A 2V2NA 2V2IA 4ZMCA 4ITTA 2MGYA 5CZUA 3NOZX 5LG8A 1QGHA 2GS4A 4ZJKA 1RCEA 1RCDA 2FG4A 2ITBA 4YVZA 2OKCA 2YW6A 4MXPA 4IXKA 1YV1A 2FJCA 1MFRA 2CLUA 3H7GA 4P18A 5GOUA 2F7NA 4TOHA 4RC6A 3SH6A 3EZ0A 1TK6A 4LQJA 2BK6A 2AR0A 3E1PA 1UVHA 2WTLA 3LKDA 4RC6B 4YXJA 4DYZA 1SQ3A 2XKQA 2QQYA 4Z3BA 3L0MA 3R2RA 2JD60 2QF9A 1VEQA 4E40A 3PZAA 1GWGA 3BVKA 3R2HA 3RD0A 1JKVA 3PVTA 1LKOA 3KA9A 3M6JA 3PVTB 1BCFA 5LS9A 2CHIA 4DI0A 2XGWA 3GVYA 4EVCA 4AM4A 3KA8A 3R2SA 5HJHA 1BFRA 2YJKA 3KA4A 4R42A 1NFVA 1S2ZA 3U90A 4ERUA 2V15A 1MOJA 1SOFA 1B71A 4PG1A 1LKMA 2RBDA 3VVAA 3MPSA 2ZG9X 4M34A 4PGKA 3WVWA 4ETRA 4TOEA 4DZ0A 1EUMA 2IB0A 3BT5A 5FFCA 3E2CA 4TODA 3AJPA 1VEIA 3BVEA 4E6KA 3PWQA 2JD80 5FFBA 2D5KA 1IERA 2IY4A 3AJQA 4OYNA 4CVSA 5FFDA 3HIUA 1F30A 4KVSA 5JACA 1NF4A 2ZG8X 3AF8X 3SHXA 3F32A 3Q4OA 4II4A 3QVDA 4DE6A 3NP2X 2CEIA 3DBYA 2Z6MA 2BKCA 3QHCA 1TJOA 1JGCA 4II4B 3ISEA 3ES3A 1JIGA 3SE1A 5J9VA 3C1ZA 5E1UA 1OTKA 4W4KB 2YW7A 1VELA 2ZA6A 3IQ1A 4IWKA 4XKSA 4Z5SA 5HQOA 3E6RA 3F38A 4TOGA 1JKUA 2BJYA 3C23A 3F36A 5ERKA 5J93A 5JKMG 3GHQA 1JREA 3W54A 3SIDA 4A25A 4ISPA 1L8IA 4MY7A 1R03A 2V2MA 3O7SA 2X170 4QUWA 2V8TA 2UX1A 1RCGA 4ZL5A 4TOAA 4AM2A 1Z6OA 2CWLA 3PW1A 3N6OA 5J8WA 5JKLA 5C6FA 4LPNA 2W0OA 2ZA7A 3PW1B 3WVVA 2C2UA 3E1LA 1RCIA 2YJJA 3Q4QA 1L8HA 3E1MA 3R2OA 3RBCA 3PWQC 3WVUA 5HU6D 3UFBA 4YKHA 3WNWA 4YXMA 2WLAA 4Y08A 1JTSA 1LKPA 5D8OA 5K53A 3VV9A 4EVBA 2ZG7X 4ZKHA 2XJOA 5CMRA 2CN7A 1F33A 2HTNA 3E6SA 3BVFA 4TOFA 1HRSA 5JDOA 2XJNA 3F35A 4IWJA 2N02A 5JDOB 2GYDA 4CYAA 4XKUA 3D19A 4RC5A 5FFEA 1XZ3A 3PW8C 2GYQA 5JKMA 4RC5B 5GU3X 4ZLWA 2C2FA 3BVLA 3KA3A 3IS8A 3KX9A 1UMNA 3KDQA 4LYUA 2C2JA 1VLGA 3E1NA 1S3QA 4ISMA 4DYUA 5ERJA 3OJ5A 4CVPA 3FRRA 5D8SA 2V2OA 3JZ9A 2Z5RA 4CY9A 1JYBA 1Z6OM 2OC5A 2FL0A 3PVYA 4ZKWA 4MN9A 1ZS3A 3E1OA 3PVRA 2IU2A 3PWFA 3QB9A 3PVYB 3PVRB 3QHBA 1O9RA 3BKNA 3F34A 4EVEA 1H96A 2CN6A 3GE4A 3ISFA 4ZTTA 5GN8A 2Y3QA 5GN8B 5AXSA 4LPMA 1DVBA 4DYYA 4EVDA 4RC8A 5D8PA 5K52A 4DASA 3F39A 2V2PA 3EGMA 4REUA 1Z4AA 4XGSA 4ML5A 3RGDA 3AF7X 2BW1A 3FI6A 3AF9X 3AJOA 3GGZA 4DYXA 5FFAA 2WWXB 1YUXA 1YUZA 3F37A 3R2MA 3A9QA 1QYBA 2FG8A 3GGYA 3R2LA 3HL1A 3KXUA 3JZAB 2FHAA 1NF6A 1RCCA 2V2RA 4W4LB 2VXIA 2C41A 4LPJA 3FRSA 5HJFA 2V2SA 4LQHA 1DPSA 1IESA 4TOBA 2WLUA 3Q4RA 5FEJA 4PGIA 3UNOA 4RC7A 3VNXA 4M32A 2V8UA 2VZBA 3FSEA 4AM5A 4M33A 1VJXA 4RC7B 5D8XA 3F33A 4CMYA 4TOCA 5GU0X 4KXRB 4KVQA 5CMQA 3OGHA 1TKPA 1KRQA 4LQVA 2FFXJ 1TKOA 2V2LA 2CHPA 1FHAA 3FVBA 3A68A 5IX6A 4TO9A 4WJG4 4ITWA 3UOFA 4XKTA 1RYTA 3E1QA 3BVIA 4ZL6A 2Z90A 2CF7A 3KA6A 4MUDA 3T9JA 3TA8A 3AK8A 4ZKXA 4U3GA 1BG7A 2ZURX 1J30A 3KWOA 5I4JA 2FKZA 3ERZA 3C21A 4LQNA 1O9IA 4KVRA 2Z5QA 5LBHA 1LB3A 4MKUA 3RAVA 3O7RA 2PYBA 3NP0X 4LYXA 3QZ3A 5D8QA 1XZ1A 3C1YA 5LG2A 3QD8A 5JKLG 3E1JA 3RE7A 3V3KB 4PG0A 3Q4NA 5GU1X 1S30A 2OH3A 4CVRA 4CYBA 2ZA8A 4MJYA 2G4HA 1AEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI4 A;  2V2J A;  1NNQ A;  3EZU A;  3IS7 A;  2HR5 A;  3R2K A;  2XJM A;  3PW8 A;  2VXX A;  5J8S A;  5E2D A;  5D8R A;  2C6R A;  5D8Y A;  4CMY V;  3AK9 A;  2CIH A;  2FZF A;  2CLB A;  4M35 A;  4CVT A;  5GU2 X;  3UOI A;  2JD7 0;  4TW3 A;  1DAT A;  1ZUJ A;  2Z5P A;  1N1Q A;  1JI5 A;  2V2N A;  2V2I A;  4ZMC A;  4ITT A;  5CZU A;  3NOZ X;  5LG8 A;  1QGH A;  2GS4 A;  4ZJK A;  1RCE A;  1RCD A;  2FG4 A;  2ITB A;  2YW6 A;  4IXK A;  1YV1 A;  2FJC A;  1MFR A;  2CLU A;  3H7G A;  4P18 A;  5GOU A;  2F7N A;  4TOH A;  4RC6 A;  3SH6 A;  3EZ0 A;  1TK6 A;  4LQJ A;  2BK6 A;  3E1P A;  1UVH A;  2WTL A;  4RC6 B;  4DYZ A;  1SQ3 A;  2XKQ A;  2QQY A;  4Z3B A;  3R2R A;  2JD6 0;  2QF9 A;  1VEQ A;  3PZA A;  1GWG A;  3BVK A;  3R2H A;  3RD0 A;  1JKV A;  3PVT A;  1LKO A;  3KA9 A;  3PVT B;  1BCF A;  5LS9 A;  2CHI A;  4DI0 A;  2XGW A;  3GVY A;  4EVC A;  4AM4 A;  3KA8 A;  3R2S A;  5HJH A;  1BFR A;  2YJK A;  3KA4 A;  4R42 A;  1NFV A;  1S2Z A;  3U90 A;  4ERU A;  2V15 A;  1MOJ A;  1SOF A;  1B71 A;  4PG1 A;  1LKM A;  2RBD A;  3MPS A;  2ZG9 X;  4M34 A;  4PGK A;  3WVW A;  4ETR A;  4TOE A;  4DZ0 A;  1EUM A;  2IB0 A;  3BT5 A;  5FFC A;  3E2C A;  4TOD A;  3AJP A;  1VEI A;  3BVE A;  4E6K A;  3PWQ A;  2JD8 0;  5FFB A;  2D5K A;  1IER A;  2IY4 A;  3AJQ A;  4OYN A;  4CVS A;  5FFD A;  3HIU A;  1F30 A;  4KVS A;  5JAC A;  1NF4 A;  2ZG8 X;  3AF8 X;  3SHX A;  3F32 A;  3Q4O A;  4II4 A;  3QVD A;  4DE6 A;  3NP2 X;  2CEI A;  2Z6M A;  2BKC A;  3QHC A;  1TJO A;  1JGC A;  4II4 B;  3ISE A;  3ES3 A;  1JIG A;  3SE1 A;  5J9V A;  5E1U A;  1OTK A;  2YW7 A;  1VEL A;  2ZA6 A;  3IQ1 A;  4IWK A;  4XKS A;  4Z5S A;  5HQO A;  3E6R A;  3F38 A;  4TOG A;  1JKU A;  2BJY A;  3F36 A;  5ERK A;  5J93 A;  5JKM G;  3GHQ A;  1JRE A;  3SID A;  4A25 A;  4ISP A;  1L8I A;  4MY7 A;  1R03 A;  2V2M A;  3O7S A;  2X17 0;  4QUW A;  2UX1 A;  1RCG A;  4ZL5 A;  4TOA A;  4AM2 A;  1Z6O A;  3PW1 A;  5JKL A;  5J8W A;  5C6F A;  4LPN A;  2W0O A;  2ZA7 A;  3PW1 B;  3WVV A;  2C2U A;  3E1L A;  1RCI A;  2YJJ A;  3Q4Q A;  1L8H A;  3E1M A;  3R2O A;  3RBC A;  3PWQ C;  3WVU A;  3WNW A;  4YKH A;  2WLA A;  4Y08 A;  1JTS A;  1LKP A;  5D8O A;  5K53 A;  4EVB A;  2ZG7 X;  4ZKH A;  2XJO A;  5CMR A;  2CN7 A;  1F33 A;  2HTN A;  3E6S A;  3BVF A;  4TOF A;  1HRS A;  2XJN A;  3F35 A;  4IWJ A;  2GYD A;  4CYA A;  4XKU A;  4RC5 A;  5FFE A;  1XZ3 A;  3PW8 C;  2GYQ A;  5JKM A;  4RC5 B;  5GU3 X;  4ZLW A;  2C2F A;  3BVL A;  3KA3 A;  3IS8 A;  3KX9 A;  1UMN A;  4LYU A;  2C2J A;  1VLG A;  3E1N A;  1S3Q A;  4ISM A;  4DYU A;  5ERJ A;  3OJ5 A;  4CVP A;  5D8S A;  2V2O A;  2Z5R A;  4CY9 A;  1JYB A;  1Z6O M;  2OC5 A;  2FL0 A;  3PVY A;  4ZKW A;  4MN9 A;  1ZS3 A;  3E1O A;  3PVR A;  2IU2 A;  3PWF A;  3QB9 A;  3PVY B;  3PVR B;  3QHB A;  1O9R A;  3BKN A;  3F34 A;  4EVE A;  1H96 A;  2CN6 A;  3GE4 A;  3ISF A;  4ZTT A;  5GN8 A;  2Y3Q A;  5GN8 B;  5AXS A;  4LPM A;  1DVB A;  4DYY A;  4EVD A;  4RC8 A;  5D8P A;  5K52 A;  4DAS A;  3F39 A;  2V2P A;  3EGM A;  4REU A;  1Z4A A;  4XGS A;  4ML5 A;  3RGD A;  3AF7 X;  2BW1 A;  3FI6 A;  3AF9 X;  3AJO A;  4DYX A;  5FFA A;  1YUX A;  1YUZ A;  3F37 A;  3R2M A;  3A9Q A;  1QYB A;  2FG8 A;  3R2L A;  3HL1 A;  3KXU A;  2FHA A;  1NF6 A;  1RCC A;  2V2R A;  2VXI A;  2C41 A;  4LPJ A;  5HJF A;  2V2S A;  4LQH A;  1DPS A;  1IES A;  4TOB A;  2WLU A;  3Q4R A;  5FEJ A;  4PGI A;  3UNO A;  4RC7 A;  3VNX A;  4M32 A;  2VZB A;  3FSE A;  4AM5 A;  4M33 A;  1VJX A;  4RC7 B;  5D8X A;  3F33 A;  4CMY A;  4TOC A;  5GU0 X;  4KVQ A;  5CMQ A;  3OGH A;  1TKP A;  1KRQ A;  4LQV A;  2FFX J;  1TKO A;  2V2L A;  2CHP A;  1FHA A;  3FVB A;  3A68 A;  5IX6 A;  4TO9 A;  4ITW A;  3UOF A;  4XKT A;  1RYT A;  3E1Q A;  3BVI A;  4ZL6 A;  2Z90 A;  2CF7 A;  3KA6 A;  4MUD A;  3T9J A;  3TA8 A;  3AK8 A;  4ZKX A;  4U3G A;  1BG7 A;  2ZUR X;  1J30 A;  3KWO A;  5I4J A;  2FKZ A;  3ERZ A;  4LQN A;  1O9I A;  4KVR A;  2Z5Q A;  5LBH A;  1LB3 A;  4MKU A;  3RAV A;  3O7R A;  2PYB A;  3NP0 X;  4LYX A;  3QZ3 A;  5D8Q A;  1XZ1 A;  5LG2 A;  3QD8 A;  5JKL G;  3E1J A;  3RE7 A;  4PG0 A;  3Q4N A;  5GU1 X;  1S30 A;  2OH3 A;  4CVR A;  4CYB A;  2ZA8 A;  4MJY A;  2G4H A;  1AEW A; 
#chains in the Genus database with same CATH topology
 1JI4 A;  2V2J A;  1NNQ A;  3EZU A;  3IS7 A;  3KHK A;  2HR5 A;  3R2K A;  2XJM A;  3PW8 A;  2VXX A;  2G38 B;  5J8S A;  5E2D A;  5D8R A;  2Y44 A;  2C6R A;  5D8Y A;  4CMY V;  3AK9 A;  2CIH A;  2FZF A;  2CLB A;  4M35 A;  4CVT A;  5GU2 X;  3UOI A;  2JD7 0;  4X0J A;  4TW3 A;  1DAT A;  1ZUJ A;  2Z5P A;  1N1Q A;  1JI5 A;  2V2N A;  2V2I A;  4ZMC A;  4ITT A;  2MGY A;  5CZU A;  3NOZ X;  5LG8 A;  1QGH A;  2GS4 A;  4ZJK A;  1RCE A;  1RCD A;  2FG4 A;  2ITB A;  4YVZ A;  2OKC A;  2YW6 A;  4MXP A;  4IXK A;  1YV1 A;  2FJC A;  1MFR A;  2CLU A;  3H7G A;  4P18 A;  5GOU A;  2F7N A;  4TOH A;  4RC6 A;  3SH6 A;  3EZ0 A;  1TK6 A;  4LQJ A;  2BK6 A;  2AR0 A;  3E1P A;  1UVH A;  2WTL A;  3LKD A;  4RC6 B;  4YXJ A;  4DYZ A;  1SQ3 A;  2XKQ A;  2QQY A;  4Z3B A;  3L0M A;  3R2R A;  2JD6 0;  2QF9 A;  1VEQ A;  4E40 A;  3PZA A;  1GWG A;  3BVK A;  3R2H A;  3RD0 A;  1JKV A;  3PVT A;  1LKO A;  3KA9 A;  3M6J A;  3PVT B;  1BCF A;  5LS9 A;  2CHI A;  4DI0 A;  2XGW A;  3GVY A;  4EVC A;  4AM4 A;  3KA8 A;  3R2S A;  5HJH A;  1BFR A;  2YJK A;  3KA4 A;  4R42 A;  1NFV A;  1S2Z A;  3U90 A;  4ERU A;  2V15 A;  1MOJ A;  1SOF A;  1B71 A;  4PG1 A;  1LKM A;  2RBD A;  3VVA A;  3MPS A;  2ZG9 X;  4M34 A;  4PGK A;  3WVW A;  4ETR A;  4TOE A;  4DZ0 A;  1EUM A;  2IB0 A;  3BT5 A;  5FFC A;  3E2C A;  4TOD A;  3AJP A;  1VEI A;  3BVE A;  4E6K A;  3PWQ A;  2JD8 0;  5FFB A;  2D5K A;  1IER A;  2IY4 A;  3AJQ A;  4OYN A;  4CVS A;  5FFD A;  3HIU A;  1F30 A;  4KVS A;  5JAC A;  1NF4 A;  2ZG8 X;  3AF8 X;  3SHX A;  3F32 A;  3Q4O A;  4II4 A;  3QVD A;  4DE6 A;  3NP2 X;  2CEI A;  3DBY A;  2Z6M A;  2BKC A;  3QHC A;  1TJO A;  1JGC A;  4II4 B;  3ISE A;  3ES3 A;  1JIG A;  3SE1 A;  5J9V A;  3C1Z A;  5E1U A;  1OTK A;  4W4K B;  2YW7 A;  1VEL A;  2ZA6 A;  3IQ1 A;  4IWK A;  4XKS A;  4Z5S A;  5HQO A;  3E6R A;  3F38 A;  4TOG A;  1JKU A;  2BJY A;  3C23 A;  3F36 A;  5ERK A;  5J93 A;  5JKM G;  3GHQ A;  1JRE A;  3W54 A;  3SID A;  4A25 A;  4ISP A;  1L8I A;  4MY7 A;  1R03 A;  2V2M A;  3O7S A;  2X17 0;  4QUW A;  2V8T A;  2UX1 A;  1RCG A;  4ZL5 A;  4TOA A;  4AM2 A;  1Z6O A;  2CWL A;  3PW1 A;  3N6O A;  5J8W A;  5JKL A;  5C6F A;  4LPN A;  2W0O A;  2ZA7 A;  3PW1 B;  3WVV A;  2C2U A;  3E1L A;  1RCI A;  2YJJ A;  3Q4Q A;  1L8H A;  3E1M A;  3R2O A;  3RBC A;  3PWQ C;  3WVU A;  5HU6 D;  3UFB A;  4YKH A;  3WNW A;  4YXM A;  2WLA A;  4Y08 A;  1JTS A;  1LKP A;  5D8O A;  5K53 A;  3VV9 A;  4EVB A;  2ZG7 X;  4ZKH A;  2XJO A;  5CMR A;  2CN7 A;  1F33 A;  2HTN A;  3E6S A;  3BVF A;  4TOF A;  1HRS A;  5JDO A;  2XJN A;  3F35 A;  4IWJ A;  2N02 A;  5JDO B;  2GYD A;  4CYA A;  4XKU A;  3D19 A;  4RC5 A;  5FFE A;  1XZ3 A;  3PW8 C;  2GYQ A;  5JKM A;  4RC5 B;  5GU3 X;  4ZLW A;  2C2F A;  3BVL A;  3KA3 A;  3IS8 A;  3KX9 A;  1UMN A;  3KDQ A;  4LYU A;  2C2J A;  1VLG A;  3E1N A;  1S3Q A;  4ISM A;  4DYU A;  5ERJ A;  3OJ5 A;  4CVP A;  3FRR A;  5D8S A;  2V2O A;  3JZ9 A;  2Z5R A;  4CY9 A;  1JYB A;  1Z6O M;  2OC5 A;  2FL0 A;  3PVY A;  4ZKW A;  4MN9 A;  1ZS3 A;  3E1O A;  3PVR A;  2IU2 A;  3PWF A;  3QB9 A;  3PVY B;  3PVR B;  3QHB A;  1O9R A;  3BKN A;  3F34 A;  4EVE A;  1H96 A;  2CN6 A;  3GE4 A;  3ISF A;  4ZTT A;  5GN8 A;  2Y3Q A;  5GN8 B;  5AXS A;  4LPM A;  1DVB A;  4DYY A;  4EVD A;  4RC8 A;  5D8P A;  5K52 A;  4DAS A;  3F39 A;  2V2P A;  3EGM A;  4REU A;  1Z4A A;  4XGS A;  4ML5 A;  3RGD A;  3AF7 X;  2BW1 A;  3FI6 A;  3AF9 X;  3AJO A;  3GGZ A;  4DYX A;  5FFA A;  2WWX B;  1YUX A;  1YUZ A;  3F37 A;  3R2M A;  3A9Q A;  1QYB A;  2FG8 A;  3GGY A;  3R2L A;  3HL1 A;  3KXU A;  3JZA B;  2FHA A;  1NF6 A;  1RCC A;  2V2R A;  4W4L B;  2VXI A;  2C41 A;  4LPJ A;  3FRS A;  5HJF A;  2V2S A;  4LQH A;  1DPS A;  1IES A;  4TOB A;  2WLU A;  3Q4R A;  5FEJ A;  4PGI A;  3UNO A;  4RC7 A;  3VNX A;  4M32 A;  2V8U A;  2VZB A;  3FSE A;  4AM5 A;  4M33 A;  1VJX A;  4RC7 B;  5D8X A;  3F33 A;  4CMY A;  4TOC A;  5GU0 X;  4KXR B;  4KVQ A;  5CMQ A;  3OGH A;  1TKP A;  1KRQ A;  4LQV A;  2FFX J;  1TKO A;  2V2L A;  2CHP A;  1FHA A;  3FVB A;  3A68 A;  5IX6 A;  4TO9 A;  4WJG 4;  4ITW A;  3UOF A;  4XKT A;  1RYT A;  3E1Q A;  3BVI A;  4ZL6 A;  2Z90 A;  2CF7 A;  3KA6 A;  4MUD A;  3T9J A;  3TA8 A;  3AK8 A;  4ZKX A;  4U3G A;  1BG7 A;  2ZUR X;  1J30 A;  3KWO A;  5I4J A;  2FKZ A;  3ERZ A;  3C21 A;  4LQN A;  1O9I A;  4KVR A;  2Z5Q A;  5LBH A;  1LB3 A;  4MKU A;  3RAV A;  3O7R A;  2PYB A;  3NP0 X;  4LYX A;  3QZ3 A;  5D8Q A;  1XZ1 A;  3C1Y A;  5LG2 A;  3QD8 A;  5JKL G;  3E1J A;  3RE7 A;  3V3K B;  4PG0 A;  3Q4N A;  5GU1 X;  1S30 A;  2OH3 A;  4CVR A;  4CYB A;  2ZA8 A;  4MJY A;  2G4H A;  1AEW A; 
#chains in the Genus database with same CATH homology
 1JI4 A;  2V2J A;  1NNQ A;  3EZU A;  3IS7 A;  3KHK A;  2HR5 A;  3R2K A;  2XJM A;  3PW8 A;  2VXX A;  2G38 B;  5J8S A;  5E2D A;  5D8R A;  2Y44 A;  2C6R A;  5D8Y A;  4CMY V;  3AK9 A;  2CIH A;  2FZF A;  2CLB A;  4M35 A;  4CVT A;  5GU2 X;  3UOI A;  2JD7 0;  4X0J A;  4TW3 A;  1DAT A;  1ZUJ A;  2Z5P A;  1N1Q A;  1JI5 A;  2V2N A;  2V2I A;  4ZMC A;  4ITT A;  2MGY A;  5CZU A;  3NOZ X;  5LG8 A;  1QGH A;  2GS4 A;  4ZJK A;  1RCE A;  1RCD A;  2FG4 A;  2ITB A;  4YVZ A;  2OKC A;  2YW6 A;  4MXP A;  4IXK A;  1YV1 A;  2FJC A;  1MFR A;  2CLU A;  3H7G A;  4P18 A;  5GOU A;  2F7N A;  4TOH A;  4RC6 A;  3SH6 A;  3EZ0 A;  1TK6 A;  4LQJ A;  2BK6 A;  2AR0 A;  3E1P A;  1UVH A;  2WTL A;  3LKD A;  4RC6 B;  4YXJ A;  4DYZ A;  1SQ3 A;  2XKQ A;  2QQY A;  4Z3B A;  3L0M A;  3R2R A;  2JD6 0;  2QF9 A;  1VEQ A;  4E40 A;  3PZA A;  1GWG A;  3BVK A;  3R2H A;  3RD0 A;  1JKV A;  3PVT A;  1LKO A;  3KA9 A;  3M6J A;  3PVT B;  1BCF A;  5LS9 A;  2CHI A;  4DI0 A;  2XGW A;  3GVY A;  4EVC A;  4AM4 A;  3KA8 A;  3R2S A;  5HJH A;  1BFR A;  2YJK A;  3KA4 A;  4R42 A;  1NFV A;  1S2Z A;  3U90 A;  4ERU A;  2V15 A;  1MOJ A;  1SOF A;  1B71 A;  4PG1 A;  1LKM A;  2RBD A;  3VVA A;  3MPS A;  2ZG9 X;  4M34 A;  4PGK A;  3WVW A;  4ETR A;  4TOE A;  4DZ0 A;  1EUM A;  2IB0 A;  3BT5 A;  5FFC A;  3E2C A;  4TOD A;  3AJP A;  1VEI A;  3BVE A;  4E6K A;  3PWQ A;  2JD8 0;  5FFB A;  2D5K A;  1IER A;  2IY4 A;  3AJQ A;  4OYN A;  4CVS A;  5FFD A;  3HIU A;  1F30 A;  4KVS A;  5JAC A;  1NF4 A;  2ZG8 X;  3AF8 X;  3SHX A;  3F32 A;  3Q4O A;  4II4 A;  3QVD A;  4DE6 A;  3NP2 X;  2CEI A;  3DBY A;  2Z6M A;  2BKC A;  3QHC A;  1TJO A;  1JGC A;  4II4 B;  3ISE A;  3ES3 A;  1JIG A;  3SE1 A;  5J9V A;  3C1Z A;  5E1U A;  1OTK A;  4W4K B;  2YW7 A;  1VEL A;  2ZA6 A;  3IQ1 A;  4IWK A;  4XKS A;  4Z5S A;  5HQO A;  3E6R A;  3F38 A;  4TOG A;  1JKU A;  2BJY A;  3C23 A;  3F36 A;  5ERK A;  5J93 A;  5JKM G;  3GHQ A;  1JRE A;  3W54 A;  3SID A;  4A25 A;  4ISP A;  1L8I A;  4MY7 A;  1R03 A;  2V2M A;  3O7S A;  2X17 0;  4QUW A;  2V8T A;  2UX1 A;  1RCG A;  4ZL5 A;  4TOA A;  4AM2 A;  1Z6O A;  2CWL A;  3PW1 A;  3N6O A;  5J8W A;  5JKL A;  5C6F A;  4LPN A;  2W0O A;  2ZA7 A;  3PW1 B;  3WVV A;  2C2U A;  3E1L A;  1RCI A;  2YJJ A;  3Q4Q A;  1L8H A;  3E1M A;  3R2O A;  3RBC A;  3PWQ C;  3WVU A;  5HU6 D;  3UFB A;  4YKH A;  3WNW A;  4YXM A;  2WLA A;  4Y08 A;  1JTS A;  1LKP A;  5D8O A;  5K53 A;  3VV9 A;  4EVB A;  2ZG7 X;  4ZKH A;  2XJO A;  5CMR A;  2CN7 A;  1F33 A;  2HTN A;  3E6S A;  3BVF A;  4TOF A;  1HRS A;  5JDO A;  2XJN A;  3F35 A;  4IWJ A;  2N02 A;  5JDO B;  2GYD A;  4CYA A;  4XKU A;  3D19 A;  4RC5 A;  5FFE A;  1XZ3 A;  3PW8 C;  2GYQ A;  5JKM A;  4RC5 B;  5GU3 X;  4ZLW A;  2C2F A;  3BVL A;  3KA3 A;  3IS8 A;  3KX9 A;  1UMN A;  3KDQ A;  4LYU A;  2C2J A;  1VLG A;  3E1N A;  1S3Q A;  4ISM A;  4DYU A;  5ERJ A;  3OJ5 A;  4CVP A;  3FRR A;  5D8S A;  2V2O A;  3JZ9 A;  2Z5R A;  4CY9 A;  1JYB A;  1Z6O M;  2OC5 A;  2FL0 A;  3PVY A;  4ZKW A;  4MN9 A;  1ZS3 A;  3E1O A;  3PVR A;  2IU2 A;  3PWF A;  3QB9 A;  3PVY B;  3PVR B;  3QHB A;  1O9R A;  3BKN A;  3F34 A;  4EVE A;  1H96 A;  2CN6 A;  3GE4 A;  3ISF A;  4ZTT A;  5GN8 A;  2Y3Q A;  5GN8 B;  5AXS A;  4LPM A;  1DVB A;  4DYY A;  4EVD A;  4RC8 A;  5D8P A;  5K52 A;  4DAS A;  3F39 A;  2V2P A;  3EGM A;  4REU A;  1Z4A A;  4XGS A;  4ML5 A;  3RGD A;  3AF7 X;  2BW1 A;  3FI6 A;  3AF9 X;  3AJO A;  3GGZ A;  4DYX A;  5FFA A;  2WWX B;  1YUX A;  1YUZ A;  3F37 A;  3R2M A;  3A9Q A;  1QYB A;  2FG8 A;  3GGY A;  3R2L A;  3HL1 A;  3KXU A;  3JZA B;  2FHA A;  1NF6 A;  1RCC A;  2V2R A;  4W4L B;  2VXI A;  2C41 A;  4LPJ A;  3FRS A;  5HJF A;  2V2S A;  4LQH A;  1DPS A;  1IES A;  4TOB A;  2WLU A;  3Q4R A;  5FEJ A;  4PGI A;  3UNO A;  4RC7 A;  3VNX A;  4M32 A;  2V8U A;  2VZB A;  3FSE A;  4AM5 A;  4M33 A;  1VJX A;  4RC7 B;  5D8X A;  3F33 A;  4CMY A;  4TOC A;  5GU0 X;  4KXR B;  4KVQ A;  5CMQ A;  3OGH A;  1TKP A;  1KRQ A;  4LQV A;  2FFX J;  1TKO A;  2V2L A;  2CHP A;  1FHA A;  3FVB A;  3A68 A;  5IX6 A;  4TO9 A;  4WJG 4;  4ITW A;  3UOF A;  4XKT A;  1RYT A;  3E1Q A;  3BVI A;  4ZL6 A;  2Z90 A;  2CF7 A;  3KA6 A;  4MUD A;  3T9J A;  3TA8 A;  3AK8 A;  4ZKX A;  4U3G A;  1BG7 A;  2ZUR X;  1J30 A;  3KWO A;  5I4J A;  2FKZ A;  3ERZ A;  3C21 A;  4LQN A;  1O9I A;  4KVR A;  2Z5Q A;  5LBH A;  1LB3 A;  4MKU A;  3RAV A;  3O7R A;  2PYB A;  3NP0 X;  4LYX A;  3QZ3 A;  5D8Q A;  1XZ1 A;  3C1Y A;  5LG2 A;  3QD8 A;  5JKL G;  3E1J A;  3RE7 A;  3V3K B;  4PG0 A;  3Q4N A;  5GU1 X;  1S30 A;  2OH3 A;  4CVR A;  4CYB A;  2ZA8 A;  4MJY A;  2G4H A;  1AEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...