3EZ0A

Crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
216
Chain Sequence
TSPADTARYNRFVADLFGMMAYGELSAFERFSADARYSPTLHDRAVLGRIAVVEFRHYELVSARLEAMGIDAEDAMLPFQAAVDYFHSRTRPADWYESLMKAYVIDTVSADFYRAISRYVDAGTRDVIEQIQASDETTEVLRERLRSALADDPRLASRLALWGRRLLGEALTQAQRVSYEHAFLGSLIAAAKELVSGLIAGLAEKHSKRMTQLGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein with ferritin-like fold
publication title Crystal structure of protein of unknown function with ferritin-like fold (YP_832262.1) from Arthrobacter sp. FB24 at 2.33 A resolution
rcsb
source organism Arthrobacter sp. fb24
total genus 81
structure length 216
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13794 MiaE_2 tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ez0A00
4DI0A 4CMYA 4LPNA 1LKOA 5HJHA 3UOIA 3ERZA 3F38A 1JKVA 5GU0X 4MN9A 1NNQA 3AF8X 5GU3X 3PVRA 4AM5A 3E1PA 1O9IA 2ZA8A 1JI4A 3WVUA 4DYUA 4PGIA 4II4B 3F35A 4DZ0A 5FFBA 4ZL6A 1N1QA 3A68A 1MFRA 1RCGA 3TA8A 2FKZA 2OC5A 3O7SA 3H7GA 1RCIA 2FZFA 1F33A 5LS9A 3PWQA 1NFVA 3BVEA 4ZTTA 4TODA 1H96A 5FFEA 2ZA6A 5HJFA 1YUZA 2BK6A 2Y3QA 2CHIA 3F36A 4EVBA 3E1NA 3F39A 3E6SA 2ZG9X 1VEQA 4OYNA 4RC6B 3KA9A 2CIHA 3BVIA 4ERUA 4RC7A 3BVLA 2GYDA 1S2ZA 5GN8A 3GHQA 4CVRA 5ERJA 2VXXA 3KA8A 5FFAA 3AJOA 3NOZX 1TKOA 3KA6A 3FSEA 4ITTA 2G4HA 4TOGA 1JREA 4KVSA 2GS4A 1XZ1A 3F32A 3E1LA 3ES3A 4TOAA 2FL0A 5GOUA 3BVFA 3IS8A 4YKHA 3R2KA 4CVPA 5JKMA 4CVSA 5D8XA 4Z3BA 3QB9A 1BCFA 5D8PA 5E1UA 3PZAA 2IB0A 3OGHA 5E2DA 5AXSA 1NF6A 2YJKA 3GVYA 3PVTA 3PW1B 5J9VA 5LG8A 5C6FA 3QHBA 4ETRA 4TW3A 4LYXA 4CVTA 3EZUA 3R2OA 4CY9A 4ZKXA 3BT5A 4MKUA 1SQ3A 4TOHA 2YW6A 3R2HA 4ZKWA 3SE1A 5CMRA 1JYBA 3PVRB 2XJNA 3E1QA 3R2RA 3WNWA 2W0OA 4DYYA 2PYBA 1TJOA 2WTLA 1QGHA 4CYBA 2UX1A 2F7NA 1DPSA 5HQOA 3U90A 2JD80 2C6RA 1ZUJA 4ML5A 1JIGA 4ITWA 4CYAA 4EVDA 4MJYA 5FFCA 1FHAA 3R2MA 3QZ3A 1LKPA 2YW7A 2ITBA 4LPMA 5JKLG 2Z5QA 4DE6A 3E2CA 1NF4A 2VXIA 3Q4RA 2WLAA 3PVYA 1RYTA 3WVWA 5JKMG 4ZJKA 3NP2X 4MUDA 4RC7B 4U3GA 4XGSA 3RD0A 2V2IA 1YUXA 5GN8B 2C2UA 2V2SA 4RC6A 3HL1A 3QHCA 2X170 1VJXA 3UOFA 3E6RA 2Z6MA 4XKSA 3T9JA 1MOJA 4TOEA 2D5KA 1L8IA 3IQ1A 5FEJA 5JKLA 2C41A 3AK9A 3R2LA 4TOBA 2IU2A 3E1JA 4E6KA 3O7RA 3E1MA 2CLBA 4TOCA 4DASA 2XKQA 5LBHA 5CMQA 4XKUA 3ISFA 1GWGA 2CF7A 1UMNA 3Q4NA 3F37A 3F34A 2CN7A 5I4JA 3UNOA 2V2OA 4RC5A 2XGWA 4PG1A 3PVTB 5JACA 4IWKA 1J30A 1EUMA 3QD8A 1TK6A 4EVCA 5K53A 1JI5A 5D8OA 3QVDA 2BJYA 3AK8A 2OH3A 3IS7A 3EGMA 4ISMA 4QUWA 3SHXA 2ZG7X 3RAVA 2ZG8X 5D8RA 4A25A 4M34A 1RCEA 5D8SA 3F33A 5GU2X 2CHPA 2CN6A 3RE7A 1QYBA 3AF7X 2BKCA 2FHAA 4CMYV 4DYXA 3VNXA 4REUA 3AJPA 5ERKA 1KRQA 2FG8A 4R42A 1VEIA 3WVVA 4II4A 3AF9X 2V2JA 3BKNA 1IESA 3Q4QA 3NP0X 4IXKA 1VELA 2V2MA 1Z4AA 4KVRA 1RCDA 3A9QA 2C2JA 4ISPA 1XZ3A 2ZA7A 5D8YA 4DYZA 1B71A 5D8QA 1AEWA 1S3QA 4KVQA 1LB3A 5LG2A 4ZMCA 2HTNA 3KXUA 3AJQA 5IX6A 2FG4A 4Z5SA 3MPSA 4ZKHA 3PVYB 2XJMA 2HR5A 2V2LA 1IERA 4PGKA 1DATA 4M33A 4AM4A 2Z5RA 2FFXJ 3SH6A 3EZ0A 3PW8C 1BG7A 2IY4A 1Z6OM 1DVBA 2VZBA 4ZLWA 3FVBA 5J93A 4RC8A 5CZUA 4PG0A 3Q4OA 4M32A 3E1OA 4IWJA 1Z6OA 1SOFA 4LPJA 4LQVA 2V15A 3KA4A 1BFRA 5GU1X 2C2FA 4M35A 4P18A 4TOFA 1VLGA 3KWOA 2V2PA 4LYUA 2RBDA 4EVEA 2V2RA 1RCCA 2XJOA 2ZURX 2GYQA 3HIUA 3OJ5A 2JD70 3PWFA 4MY7A 4LQHA 5FFDA 3FI6A 2YJJA 2Z90A 4LQJA 5J8WA 3PWQC 3R2SA 3RBCA 5K52A 2QQYA 1O9RA 2CEIA 2WLUA 1OTKA 2V2NA 1R03A 4RC5B 1LKMA 1F30A 4LQNA 3SIDA 4Y08A 5J8SA 3BVKA 4XKTA 1UVHA 2BW1A 3ISEA 1JGCA 1TKPA 2QF9A 1JTSA 1L8HA 3PW1A 4TO9A 4ZL5A 3KA3A 1ZS3A 2JD60 1JKUA 1HRSA 2FJCA 4AM2A 2CLUA 1S30A 1YV1A 3KX9A 3PW8A 2Z5PA 3RGDA 3GE4A
chains in the Genus database with same CATH superfamily
5JDOB 4DI0A 4CMYA 4LPNA 1LKOA 5HJHA 3UOIA 3ERZA 3F38A 1JKVA 5GU0X 4MN9A 1NNQA 3AF8X 5GU3X 3PVRA 4AM5A 3E1PA 1O9IA 2ZA8A 3C21A 1JI4A 3WVUA 4DYUA 4PGIA 4II4B 3F35A 4DZ0A 5FFBA 4ZL6A 1N1QA 3A68A 1MFRA 1RCGA 3TA8A 2FKZA 2OC5A 3O7SA 3JZAB 3H7GA 1RCIA 2FZFA 1F33A 5LS9A 3PWQA 1NFVA 3BVEA 4ZTTA 4KXRB 4TODA 4WJG4 1H96A 5FFEA 2ZA6A 3KHKA 5HJFA 1YUZA 2BK6A 2Y3QA 3N6OA 2CHIA 3F36A 3JZ9A 4EVBA 3FRSA 3E1NA 2MGYA 3F39A 3E6SA 2ZG9X 1VEQA 4OYNA 4RC6B 3KA9A 2CIHA 3BVIA 4ERUA 4RC7A 3BVLA 2GYDA 1S2ZA 5GN8A 3GHQA 4YVZA 4CVRA 5ERJA 4YXJA 2VXXA 3KA8A 5FFAA 3AJOA 3NOZX 1TKOA 3KA6A 3FSEA 4ITTA 2G4HA 2CWLA 4TOGA 1JREA 3V3KB 4KVSA 2GS4A 1XZ1A 3F32A 3E1LA 3ES3A 4TOAA 3DBYA 2FL0A 5GOUA 3BVFA 3IS8A 4YKHA 3R2KA 4CVPA 5JKMA 4CVSA 2Y44A 5D8XA 4Z3BA 3QB9A 1BCFA 5D8PA 5E1UA 3PZAA 2IB0A 3OGHA 2AR0A 5E2DA 5AXSA 1NF6A 2YJKA 3GVYA 3PVTA 3PW1B 5J9VA 5LG8A 5C6FA 3QHBA 4ETRA 4TW3A 4LYXA 4CVTA 3C23A 3EZUA 3R2OA 4CY9A 4ZKXA 3BT5A 4MKUA 1SQ3A 4TOHA 2YW6A 3R2HA 4ZKWA 3SE1A 5CMRA 1JYBA 3PVRB 2XJNA 3E1QA 3VVAA 3R2RA 3WNWA 2W0OA 4DYYA 2PYBA 1TJOA 2WTLA 1QGHA 4YXMA 4CYBA 2UX1A 2F7NA 1DPSA 5HQOA 5HU6D 3U90A 2JD80 2C6RA 4W4KB 1ZUJA 4ML5A 1JIGA 4ITWA 4CYAA 4EVDA 4MJYA 5FFCA 1FHAA 3GGYA 3R2MA 3QZ3A 1LKPA 2YW7A 2ITBA 4LPMA 5JKLG 2Z5QA 3GGZA 4DE6A 3E2CA 1NF4A 2VXIA 3Q4RA 4E40A 2WLAA 3PVYA 1RYTA 3WVWA 5JKMG 4ZJKA 3NP2X 4MUDA 4RC7B 4U3GA 4X0JA 4W4LB 4XGSA 3RD0A 2V2IA 3C1ZA 1YUXA 5GN8B 2C2UA 2V2SA 4RC6A 3HL1A 3QHCA 2X170 1VJXA 3UOFA 3E6RA 3KDQA 2Z6MA 4XKSA 3T9JA 1MOJA 4TOEA 2D5KA 1L8IA 3IQ1A 3LKDA 5FEJA 5JKLA 2C41A 3AK9A 3R2LA 4TOBA 2IU2A 3E1JA 4E6KA 3O7RA 3E1MA 2CLBA 4TOCA 4DASA 2XKQA 5LBHA 5CMQA 4XKUA 3ISFA 1GWGA 2CF7A 1UMNA 3Q4NA 3F37A 3F34A 2CN7A 5I4JA 3UNOA 2V2OA 3L0MA 4RC5A 2XGWA 4PG1A 3PVTB 5JACA 4IWKA 1J30A 1EUMA 3QD8A 1TK6A 4EVCA 5K53A 1JI5A 5D8OA 3QVDA 2BJYA 3AK8A 2V8UA 2OH3A 3IS7A 3EGMA 4ISMA 4QUWA 3SHXA 3VV9A 3FRRA 2ZG7X 5JDOA 3RAVA 2ZG8X 5D8RA 4A25A 4M34A 1RCEA 5D8SA 3F33A 5GU2X 2CHPA 2CN6A 3RE7A 1QYBA 3AF7X 2BKCA 2FHAA 4CMYV 4DYXA 3VNXA 4REUA 3AJPA 5ERKA 1KRQA 2FG8A 4R42A 1VEIA 3WVVA 4II4A 3AF9X 2V2JA 3BKNA 1IESA 3Q4QA 3NP0X 4IXKA 1VELA 3M6JA 2V2MA 3UFBA 1Z4AA 4KVRA 1RCDA 3A9QA 2C2JA 4ISPA 1XZ3A 2ZA7A 5D8YA 4DYZA 1B71A 5D8QA 1AEWA 1S3QA 4KVQA 1LB3A 5LG2A 4ZMCA 2HTNA 3KXUA 4MXPA 3AJQA 5IX6A 2FG4A 4Z5SA 3MPSA 4ZKHA 3PVYB 2XJMA 2HR5A 2V2LA 1IERA 4PGKA 1DATA 4M33A 4AM4A 2Z5RA 2FFXJ 3SH6A 3EZ0A 3PW8C 1BG7A 2IY4A 1Z6OM 1DVBA 2VZBA 4ZLWA 3FVBA 5J93A 2N02A 4RC8A 5CZUA 4PG0A 3Q4OA 4M32A 3E1OA 4IWJA 1Z6OA 1SOFA 4LPJA 4LQVA 2V15A 3KA4A 1BFRA 5GU1X 2C2FA 4M35A 4P18A 4TOFA 1VLGA 3KWOA 2V2PA 4LYUA 2RBDA 4EVEA 2V2RA 2V8TA 1RCCA 2XJOA 2ZURX 2GYQA 3HIUA 3OJ5A 2JD70 3PWFA 4MY7A 4LQHA 5FFDA 3FI6A 2YJJA 2Z90A 4LQJA 5J8WA 3PWQC 3R2SA 3RBCA 5K52A 2G38B 2QQYA 1O9RA 2CEIA 2WLUA 1OTKA 2V2NA 1R03A 4RC5B 1LKMA 1F30A 4LQNA 3SIDA 4Y08A 5J8SA 3BVKA 4XKTA 1UVHA 2BW1A 3ISEA 1JGCA 1TKPA 2QF9A 1JTSA 1L8HA 3D19A 3PW1A 4TO9A 2WWXB 3KA3A 1ZS3A 4ZL5A 3C1YA 2JD60 1JKUA 1HRSA 2FJCA 4AM2A 2CLUA 1S30A 3W54A 1YV1A 3KX9A 3PW8A 2Z5PA 3RGDA 2OKCA 3GE4A
chains in the Genus database with same CATH topology
5JDOB 4DI0A 4CMYA 4LPNA 1LKOA 5HJHA 3UOIA 3ERZA 3F38A 1JKVA 5GU0X 4MN9A 1NNQA 3AF8X 5GU3X 3PVRA 4AM5A 3E1PA 1O9IA 2ZA8A 3C21A 1JI4A 3WVUA 4DYUA 4PGIA 4II4B 3F35A 4DZ0A 5FFBA 4ZL6A 1N1QA 3A68A 1MFRA 1RCGA 3TA8A 2FKZA 2OC5A 3O7SA 3JZAB 3H7GA 1RCIA 2FZFA 1F33A 5LS9A 3PWQA 1NFVA 3BVEA 4ZTTA 4KXRB 4TODA 4WJG4 1H96A 5FFEA 2ZA6A 3KHKA 5HJFA 1YUZA 2BK6A 2Y3QA 3N6OA 2CHIA 3F36A 3JZ9A 4EVBA 3FRSA 3E1NA 2MGYA 3F39A 3E6SA 2ZG9X 1VEQA 4OYNA 4RC6B 3KA9A 2CIHA 3BVIA 4ERUA 4RC7A 3BVLA 2GYDA 1S2ZA 5GN8A 3GHQA 4YVZA 4CVRA 5ERJA 4YXJA 2VXXA 3KA8A 5FFAA 3AJOA 3NOZX 1TKOA 3KA6A 3FSEA 4ITTA 2G4HA 2CWLA 4TOGA 1JREA 3V3KB 4KVSA 2GS4A 1XZ1A 3F32A 3E1LA 3ES3A 4TOAA 3DBYA 2FL0A 5GOUA 3BVFA 3IS8A 4YKHA 3R2KA 4CVPA 5JKMA 4CVSA 2Y44A 5D8XA 4Z3BA 3QB9A 1BCFA 5D8PA 5E1UA 3PZAA 2IB0A 3OGHA 2AR0A 5E2DA 5AXSA 1NF6A 2YJKA 3GVYA 3PVTA 3PW1B 5J9VA 5LG8A 5C6FA 3QHBA 4ETRA 4TW3A 4LYXA 4CVTA 3C23A 3EZUA 3R2OA 4CY9A 4ZKXA 3BT5A 4MKUA 1SQ3A 4TOHA 2YW6A 3R2HA 4ZKWA 3SE1A 5CMRA 1JYBA 3PVRB 2XJNA 3E1QA 3VVAA 3R2RA 3WNWA 2W0OA 4DYYA 2PYBA 1TJOA 2WTLA 1QGHA 4YXMA 4CYBA 2UX1A 2F7NA 1DPSA 5HQOA 5HU6D 3U90A 2JD80 2C6RA 4W4KB 1ZUJA 4ML5A 1JIGA 4ITWA 4CYAA 4EVDA 4MJYA 5FFCA 1FHAA 3GGYA 3R2MA 3QZ3A 1LKPA 2YW7A 2ITBA 4LPMA 5JKLG 2Z5QA 3GGZA 4DE6A 3E2CA 1NF4A 2VXIA 3Q4RA 4E40A 2WLAA 3PVYA 1RYTA 3WVWA 5JKMG 4ZJKA 3NP2X 4MUDA 4RC7B 4U3GA 4X0JA 4W4LB 4XGSA 3RD0A 2V2IA 3C1ZA 1YUXA 5GN8B 2C2UA 2V2SA 4RC6A 3HL1A 3QHCA 2X170 1VJXA 3UOFA 3E6RA 3KDQA 2Z6MA 4XKSA 3T9JA 1MOJA 4TOEA 2D5KA 1L8IA 3IQ1A 3LKDA 5FEJA 5JKLA 2C41A 3AK9A 3R2LA 4TOBA 2IU2A 3E1JA 4E6KA 3O7RA 3E1MA 2CLBA 4TOCA 4DASA 2XKQA 5LBHA 5CMQA 4XKUA 3ISFA 1GWGA 2CF7A 1UMNA 3Q4NA 3F37A 3F34A 2CN7A 5I4JA 3UNOA 2V2OA 3L0MA 4RC5A 2XGWA 4PG1A 3PVTB 5JACA 4IWKA 1J30A 1EUMA 3QD8A 1TK6A 4EVCA 5K53A 1JI5A 5D8OA 3QVDA 2BJYA 3AK8A 2V8UA 2OH3A 3IS7A 3EGMA 4ISMA 4QUWA 3SHXA 3VV9A 3FRRA 2ZG7X 5JDOA 3RAVA 2ZG8X 5D8RA 4A25A 4M34A 1RCEA 5D8SA 3F33A 5GU2X 2CHPA 2CN6A 3RE7A 1QYBA 3AF7X 2BKCA 2FHAA 4CMYV 4DYXA 3VNXA 4REUA 3AJPA 5ERKA 1KRQA 2FG8A 4R42A 1VEIA 3WVVA 4II4A 3AF9X 2V2JA 3BKNA 1IESA 3Q4QA 3NP0X 4IXKA 1VELA 3M6JA 2V2MA 3UFBA 1Z4AA 4KVRA 1RCDA 3A9QA 2C2JA 4ISPA 1XZ3A 2ZA7A 5D8YA 4DYZA 1B71A 5D8QA 1AEWA 1S3QA 4KVQA 1LB3A 5LG2A 4ZMCA 2HTNA 3KXUA 4MXPA 3AJQA 5IX6A 2FG4A 4Z5SA 3MPSA 4ZKHA 3PVYB 2XJMA 2HR5A 2V2LA 1IERA 4PGKA 1DATA 4M33A 4AM4A 2Z5RA 2FFXJ 3SH6A 3EZ0A 3PW8C 1BG7A 2IY4A 1Z6OM 1DVBA 2VZBA 4ZLWA 3FVBA 5J93A 2N02A 4RC8A 5CZUA 4PG0A 3Q4OA 4M32A 3E1OA 4IWJA 1Z6OA 1SOFA 4LPJA 4LQVA 2V15A 3KA4A 1BFRA 5GU1X 2C2FA 4M35A 4P18A 4TOFA 1VLGA 3KWOA 2V2PA 4LYUA 2RBDA 4EVEA 2V2RA 2V8TA 1RCCA 2XJOA 2ZURX 2GYQA 3HIUA 3OJ5A 2JD70 3PWFA 4MY7A 4LQHA 5FFDA 3FI6A 2YJJA 2Z90A 4LQJA 5J8WA 3PWQC 3R2SA 3RBCA 5K52A 2G38B 2QQYA 1O9RA 2CEIA 2WLUA 1OTKA 2V2NA 1R03A 4RC5B 1LKMA 1F30A 4LQNA 3SIDA 4Y08A 5J8SA 3BVKA 4XKTA 1UVHA 2BW1A 3ISEA 1JGCA 1TKPA 2QF9A 1JTSA 1L8HA 3D19A 3PW1A 4TO9A 2WWXB 3KA3A 1ZS3A 4ZL5A 3C1YA 2JD60 1JKUA 1HRSA 2FJCA 4AM2A 2CLUA 1S30A 3W54A 1YV1A 3KX9A 3PW8A 2Z5PA 3RGDA 2OKCA 3GE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI0 A;  4CMY A;  4LPN A;  1LKO A;  5HJH A;  3UOI A;  3ERZ A;  3F38 A;  1JKV A;  5GU0 X;  4MN9 A;  1NNQ A;  3AF8 X;  5GU3 X;  3PVR A;  4AM5 A;  3E1P A;  1O9I A;  2ZA8 A;  1JI4 A;  3WVU A;  4DYU A;  4PGI A;  4II4 B;  3F35 A;  4DZ0 A;  5FFB A;  4ZL6 A;  1N1Q A;  3A68 A;  1MFR A;  1RCG A;  3TA8 A;  2FKZ A;  2OC5 A;  3O7S A;  3H7G A;  1RCI A;  2FZF A;  1F33 A;  5LS9 A;  3PWQ A;  1NFV A;  3BVE A;  4ZTT A;  4TOD A;  1H96 A;  5FFE A;  2ZA6 A;  5HJF A;  1YUZ A;  2BK6 A;  2Y3Q A;  2CHI A;  3F36 A;  4EVB A;  3E1N A;  3F39 A;  3E6S A;  2ZG9 X;  1VEQ A;  4OYN A;  4RC6 B;  3KA9 A;  2CIH A;  3BVI A;  4ERU A;  4RC7 A;  3BVL A;  2GYD A;  1S2Z A;  5GN8 A;  3GHQ A;  4CVR A;  5ERJ A;  2VXX A;  3KA8 A;  5FFA A;  3AJO A;  3NOZ X;  1TKO A;  3KA6 A;  3FSE A;  4ITT A;  2G4H A;  4TOG A;  1JRE A;  4KVS A;  2GS4 A;  1XZ1 A;  3F32 A;  3E1L A;  3ES3 A;  4TOA A;  2FL0 A;  5GOU A;  3BVF A;  3IS8 A;  4YKH A;  3R2K A;  4CVP A;  5JKM A;  4CVS A;  5D8X A;  4Z3B A;  3QB9 A;  1BCF A;  5D8P A;  5E1U A;  3PZA A;  2IB0 A;  3OGH A;  5E2D A;  5AXS A;  1NF6 A;  2YJK A;  3GVY A;  3PVT A;  3PW1 B;  5J9V A;  5LG8 A;  5C6F A;  3QHB A;  4ETR A;  4TW3 A;  4LYX A;  4CVT A;  3EZU A;  3R2O A;  4CY9 A;  4ZKX A;  3BT5 A;  4MKU A;  1SQ3 A;  4TOH A;  2YW6 A;  3R2H A;  4ZKW A;  3SE1 A;  5CMR A;  1JYB A;  3PVR B;  2XJN A;  3E1Q A;  3R2R A;  3WNW A;  2W0O A;  4DYY A;  2PYB A;  1TJO A;  2WTL A;  1QGH A;  4CYB A;  2UX1 A;  2F7N A;  1DPS A;  5HQO A;  3U90 A;  2JD8 0;  2C6R A;  1ZUJ A;  4ML5 A;  1JIG A;  4ITW A;  4CYA A;  4EVD A;  4MJY A;  5FFC A;  1FHA A;  3R2M A;  3QZ3 A;  1LKP A;  2YW7 A;  2ITB A;  4LPM A;  5JKL G;  2Z5Q A;  4DE6 A;  3E2C A;  1NF4 A;  2VXI A;  3Q4R A;  2WLA A;  3PVY A;  1RYT A;  3WVW A;  5JKM G;  4ZJK A;  3NP2 X;  4MUD A;  4RC7 B;  4U3G A;  4XGS A;  3RD0 A;  2V2I A;  1YUX A;  5GN8 B;  2C2U A;  2V2S A;  4RC6 A;  3HL1 A;  3QHC A;  2X17 0;  1VJX A;  3UOF A;  3E6R A;  2Z6M A;  4XKS A;  3T9J A;  1MOJ A;  4TOE A;  2D5K A;  1L8I A;  3IQ1 A;  5FEJ A;  5JKL A;  2C41 A;  3AK9 A;  3R2L A;  4TOB A;  2IU2 A;  3E1J A;  4E6K A;  3O7R A;  3E1M A;  2CLB A;  4TOC A;  4DAS A;  2XKQ A;  5LBH A;  5CMQ A;  4XKU A;  3ISF A;  1GWG A;  2CF7 A;  1UMN A;  3Q4N A;  3F37 A;  3F34 A;  2CN7 A;  5I4J A;  3UNO A;  2V2O A;  4RC5 A;  2XGW A;  4PG1 A;  3PVT B;  5JAC A;  4IWK A;  1J30 A;  1EUM A;  3QD8 A;  1TK6 A;  4EVC A;  5K53 A;  1JI5 A;  5D8O A;  3QVD A;  2BJY A;  3AK8 A;  2OH3 A;  3IS7 A;  3EGM A;  4ISM A;  4QUW A;  3SHX A;  2ZG7 X;  3RAV A;  2ZG8 X;  5D8R A;  4A25 A;  4M34 A;  1RCE A;  5D8S A;  3F33 A;  5GU2 X;  2CHP A;  2CN6 A;  3RE7 A;  1QYB A;  3AF7 X;  2BKC A;  2FHA A;  4CMY V;  4DYX A;  3VNX A;  4REU A;  3AJP A;  5ERK A;  1KRQ A;  2FG8 A;  4R42 A;  1VEI A;  3WVV A;  4II4 A;  3AF9 X;  2V2J A;  3BKN A;  1IES A;  3Q4Q A;  3NP0 X;  4IXK A;  1VEL A;  2V2M A;  1Z4A A;  4KVR A;  1RCD A;  3A9Q A;  2C2J A;  4ISP A;  1XZ3 A;  2ZA7 A;  5D8Y A;  4DYZ A;  1B71 A;  5D8Q A;  1AEW A;  1S3Q A;  4KVQ A;  1LB3 A;  5LG2 A;  4ZMC A;  2HTN A;  3KXU A;  3AJQ A;  5IX6 A;  2FG4 A;  4Z5S A;  3MPS A;  4ZKH A;  3PVY B;  2XJM A;  2HR5 A;  2V2L A;  1IER A;  4PGK A;  1DAT A;  4M33 A;  4AM4 A;  2Z5R A;  2FFX J;  3SH6 A;  3EZ0 A;  3PW8 C;  1BG7 A;  2IY4 A;  1Z6O M;  1DVB A;  2VZB A;  4ZLW A;  3FVB A;  5J93 A;  4RC8 A;  5CZU A;  4PG0 A;  3Q4O A;  4M32 A;  3E1O A;  4IWJ A;  1Z6O A;  1SOF A;  4LPJ A;  4LQV A;  2V15 A;  3KA4 A;  1BFR A;  5GU1 X;  2C2F A;  4M35 A;  4P18 A;  4TOF A;  1VLG A;  3KWO A;  2V2P A;  4LYU A;  2RBD A;  4EVE A;  2V2R A;  1RCC A;  2XJO A;  2ZUR X;  2GYQ A;  3HIU A;  3OJ5 A;  2JD7 0;  3PWF A;  4MY7 A;  4LQH A;  5FFD A;  3FI6 A;  2YJJ A;  2Z90 A;  4LQJ A;  5J8W A;  3PWQ C;  3R2S A;  3RBC A;  5K52 A;  2QQY A;  1O9R A;  2CEI A;  2WLU A;  1OTK A;  2V2N A;  1R03 A;  4RC5 B;  1LKM A;  1F30 A;  4LQN A;  3SID A;  4Y08 A;  5J8S A;  3BVK A;  4XKT A;  1UVH A;  2BW1 A;  3ISE A;  1JGC A;  1TKP A;  2QF9 A;  1JTS A;  1L8H A;  3PW1 A;  4TO9 A;  4ZL5 A;  3KA3 A;  1ZS3 A;  2JD6 0;  1JKU A;  1HRS A;  2FJC A;  4AM2 A;  2CLU A;  1S30 A;  1YV1 A;  3KX9 A;  3PW8 A;  2Z5P A;  3RGD A;  3GE4 A; 
#chains in the Genus database with same CATH topology
 5JDO B;  4DI0 A;  4CMY A;  4LPN A;  1LKO A;  5HJH A;  3UOI A;  3ERZ A;  3F38 A;  1JKV A;  5GU0 X;  4MN9 A;  1NNQ A;  3AF8 X;  5GU3 X;  3PVR A;  4AM5 A;  3E1P A;  1O9I A;  2ZA8 A;  3C21 A;  1JI4 A;  3WVU A;  4DYU A;  4PGI A;  4II4 B;  3F35 A;  4DZ0 A;  5FFB A;  4ZL6 A;  1N1Q A;  3A68 A;  1MFR A;  1RCG A;  3TA8 A;  2FKZ A;  2OC5 A;  3O7S A;  3JZA B;  3H7G A;  1RCI A;  2FZF A;  1F33 A;  5LS9 A;  3PWQ A;  1NFV A;  3BVE A;  4ZTT A;  4KXR B;  4TOD A;  4WJG 4;  1H96 A;  5FFE A;  2ZA6 A;  3KHK A;  5HJF A;  1YUZ A;  2BK6 A;  2Y3Q A;  3N6O A;  2CHI A;  3F36 A;  3JZ9 A;  4EVB A;  3FRS A;  3E1N A;  2MGY A;  3F39 A;  3E6S A;  2ZG9 X;  1VEQ A;  4OYN A;  4RC6 B;  3KA9 A;  2CIH A;  3BVI A;  4ERU A;  4RC7 A;  3BVL A;  2GYD A;  1S2Z A;  5GN8 A;  3GHQ A;  4YVZ A;  4CVR A;  5ERJ A;  4YXJ A;  2VXX A;  3KA8 A;  5FFA A;  3AJO A;  3NOZ X;  1TKO A;  3KA6 A;  3FSE A;  4ITT A;  2G4H A;  2CWL A;  4TOG A;  1JRE A;  3V3K B;  4KVS A;  2GS4 A;  1XZ1 A;  3F32 A;  3E1L A;  3ES3 A;  4TOA A;  3DBY A;  2FL0 A;  5GOU A;  3BVF A;  3IS8 A;  4YKH A;  3R2K A;  4CVP A;  5JKM A;  4CVS A;  2Y44 A;  5D8X A;  4Z3B A;  3QB9 A;  1BCF A;  5D8P A;  5E1U A;  3PZA A;  2IB0 A;  3OGH A;  2AR0 A;  5E2D A;  5AXS A;  1NF6 A;  2YJK A;  3GVY A;  3PVT A;  3PW1 B;  5J9V A;  5LG8 A;  5C6F A;  3QHB A;  4ETR A;  4TW3 A;  4LYX A;  4CVT A;  3C23 A;  3EZU A;  3R2O A;  4CY9 A;  4ZKX A;  3BT5 A;  4MKU A;  1SQ3 A;  4TOH A;  2YW6 A;  3R2H A;  4ZKW A;  3SE1 A;  5CMR A;  1JYB A;  3PVR B;  2XJN A;  3E1Q A;  3VVA A;  3R2R A;  3WNW A;  2W0O A;  4DYY A;  2PYB A;  1TJO A;  2WTL A;  1QGH A;  4YXM A;  4CYB A;  2UX1 A;  2F7N A;  1DPS A;  5HQO A;  5HU6 D;  3U90 A;  2JD8 0;  2C6R A;  4W4K B;  1ZUJ A;  4ML5 A;  1JIG A;  4ITW A;  4CYA A;  4EVD A;  4MJY A;  5FFC A;  1FHA A;  3GGY A;  3R2M A;  3QZ3 A;  1LKP A;  2YW7 A;  2ITB A;  4LPM A;  5JKL G;  2Z5Q A;  3GGZ A;  4DE6 A;  3E2C A;  1NF4 A;  2VXI A;  3Q4R A;  4E40 A;  2WLA A;  3PVY A;  1RYT A;  3WVW A;  5JKM G;  4ZJK A;  3NP2 X;  4MUD A;  4RC7 B;  4U3G A;  4X0J A;  4W4L B;  4XGS A;  3RD0 A;  2V2I A;  3C1Z A;  1YUX A;  5GN8 B;  2C2U A;  2V2S A;  4RC6 A;  3HL1 A;  3QHC A;  2X17 0;  1VJX A;  3UOF A;  3E6R A;  3KDQ A;  2Z6M A;  4XKS A;  3T9J A;  1MOJ A;  4TOE A;  2D5K A;  1L8I A;  3IQ1 A;  3LKD A;  5FEJ A;  5JKL A;  2C41 A;  3AK9 A;  3R2L A;  4TOB A;  2IU2 A;  3E1J A;  4E6K A;  3O7R A;  3E1M A;  2CLB A;  4TOC A;  4DAS A;  2XKQ A;  5LBH A;  5CMQ A;  4XKU A;  3ISF A;  1GWG A;  2CF7 A;  1UMN A;  3Q4N A;  3F37 A;  3F34 A;  2CN7 A;  5I4J A;  3UNO A;  2V2O A;  3L0M A;  4RC5 A;  2XGW A;  4PG1 A;  3PVT B;  5JAC A;  4IWK A;  1J30 A;  1EUM A;  3QD8 A;  1TK6 A;  4EVC A;  5K53 A;  1JI5 A;  5D8O A;  3QVD A;  2BJY A;  3AK8 A;  2V8U A;  2OH3 A;  3IS7 A;  3EGM A;  4ISM A;  4QUW A;  3SHX A;  3VV9 A;  3FRR A;  2ZG7 X;  5JDO A;  3RAV A;  2ZG8 X;  5D8R A;  4A25 A;  4M34 A;  1RCE A;  5D8S A;  3F33 A;  5GU2 X;  2CHP A;  2CN6 A;  3RE7 A;  1QYB A;  3AF7 X;  2BKC A;  2FHA A;  4CMY V;  4DYX A;  3VNX A;  4REU A;  3AJP A;  5ERK A;  1KRQ A;  2FG8 A;  4R42 A;  1VEI A;  3WVV A;  4II4 A;  3AF9 X;  2V2J A;  3BKN A;  1IES A;  3Q4Q A;  3NP0 X;  4IXK A;  1VEL A;  3M6J A;  2V2M A;  3UFB A;  1Z4A A;  4KVR A;  1RCD A;  3A9Q A;  2C2J A;  4ISP A;  1XZ3 A;  2ZA7 A;  5D8Y A;  4DYZ A;  1B71 A;  5D8Q A;  1AEW A;  1S3Q A;  4KVQ A;  1LB3 A;  5LG2 A;  4ZMC A;  2HTN A;  3KXU A;  4MXP A;  3AJQ A;  5IX6 A;  2FG4 A;  4Z5S A;  3MPS A;  4ZKH A;  3PVY B;  2XJM A;  2HR5 A;  2V2L A;  1IER A;  4PGK A;  1DAT A;  4M33 A;  4AM4 A;  2Z5R A;  2FFX J;  3SH6 A;  3EZ0 A;  3PW8 C;  1BG7 A;  2IY4 A;  1Z6O M;  1DVB A;  2VZB A;  4ZLW A;  3FVB A;  5J93 A;  2N02 A;  4RC8 A;  5CZU A;  4PG0 A;  3Q4O A;  4M32 A;  3E1O A;  4IWJ A;  1Z6O A;  1SOF A;  4LPJ A;  4LQV A;  2V15 A;  3KA4 A;  1BFR A;  5GU1 X;  2C2F A;  4M35 A;  4P18 A;  4TOF A;  1VLG A;  3KWO A;  2V2P A;  4LYU A;  2RBD A;  4EVE A;  2V2R A;  2V8T A;  1RCC A;  2XJO A;  2ZUR X;  2GYQ A;  3HIU A;  3OJ5 A;  2JD7 0;  3PWF A;  4MY7 A;  4LQH A;  5FFD A;  3FI6 A;  2YJJ A;  2Z90 A;  4LQJ A;  5J8W A;  3PWQ C;  3R2S A;  3RBC A;  5K52 A;  2G38 B;  2QQY A;  1O9R A;  2CEI A;  2WLU A;  1OTK A;  2V2N A;  1R03 A;  4RC5 B;  1LKM A;  1F30 A;  4LQN A;  3SID A;  4Y08 A;  5J8S A;  3BVK A;  4XKT A;  1UVH A;  2BW1 A;  3ISE A;  1JGC A;  1TKP A;  2QF9 A;  1JTS A;  1L8H A;  3D19 A;  3PW1 A;  4TO9 A;  2WWX B;  3KA3 A;  1ZS3 A;  4ZL5 A;  3C1Y A;  2JD6 0;  1JKU A;  1HRS A;  2FJC A;  4AM2 A;  2CLU A;  1S30 A;  3W54 A;  1YV1 A;  3KX9 A;  3PW8 A;  2Z5P A;  3RGD A;  2OKC A;  3GE4 A; 
#chains in the Genus database with same CATH homology
 5JDO B;  4DI0 A;  4CMY A;  4LPN A;  1LKO A;  5HJH A;  3UOI A;  3ERZ A;  3F38 A;  1JKV A;  5GU0 X;  4MN9 A;  1NNQ A;  3AF8 X;  5GU3 X;  3PVR A;  4AM5 A;  3E1P A;  1O9I A;  2ZA8 A;  3C21 A;  1JI4 A;  3WVU A;  4DYU A;  4PGI A;  4II4 B;  3F35 A;  4DZ0 A;  5FFB A;  4ZL6 A;  1N1Q A;  3A68 A;  1MFR A;  1RCG A;  3TA8 A;  2FKZ A;  2OC5 A;  3O7S A;  3JZA B;  3H7G A;  1RCI A;  2FZF A;  1F33 A;  5LS9 A;  3PWQ A;  1NFV A;  3BVE A;  4ZTT A;  4KXR B;  4TOD A;  4WJG 4;  1H96 A;  5FFE A;  2ZA6 A;  3KHK A;  5HJF A;  1YUZ A;  2BK6 A;  2Y3Q A;  3N6O A;  2CHI A;  3F36 A;  3JZ9 A;  4EVB A;  3FRS A;  3E1N A;  2MGY A;  3F39 A;  3E6S A;  2ZG9 X;  1VEQ A;  4OYN A;  4RC6 B;  3KA9 A;  2CIH A;  3BVI A;  4ERU A;  4RC7 A;  3BVL A;  2GYD A;  1S2Z A;  5GN8 A;  3GHQ A;  4YVZ A;  4CVR A;  5ERJ A;  4YXJ A;  2VXX A;  3KA8 A;  5FFA A;  3AJO A;  3NOZ X;  1TKO A;  3KA6 A;  3FSE A;  4ITT A;  2G4H A;  2CWL A;  4TOG A;  1JRE A;  3V3K B;  4KVS A;  2GS4 A;  1XZ1 A;  3F32 A;  3E1L A;  3ES3 A;  4TOA A;  3DBY A;  2FL0 A;  5GOU A;  3BVF A;  3IS8 A;  4YKH A;  3R2K A;  4CVP A;  5JKM A;  4CVS A;  2Y44 A;  5D8X A;  4Z3B A;  3QB9 A;  1BCF A;  5D8P A;  5E1U A;  3PZA A;  2IB0 A;  3OGH A;  2AR0 A;  5E2D A;  5AXS A;  1NF6 A;  2YJK A;  3GVY A;  3PVT A;  3PW1 B;  5J9V A;  5LG8 A;  5C6F A;  3QHB A;  4ETR A;  4TW3 A;  4LYX A;  4CVT A;  3C23 A;  3EZU A;  3R2O A;  4CY9 A;  4ZKX A;  3BT5 A;  4MKU A;  1SQ3 A;  4TOH A;  2YW6 A;  3R2H A;  4ZKW A;  3SE1 A;  5CMR A;  1JYB A;  3PVR B;  2XJN A;  3E1Q A;  3VVA A;  3R2R A;  3WNW A;  2W0O A;  4DYY A;  2PYB A;  1TJO A;  2WTL A;  1QGH A;  4YXM A;  4CYB A;  2UX1 A;  2F7N A;  1DPS A;  5HQO A;  5HU6 D;  3U90 A;  2JD8 0;  2C6R A;  4W4K B;  1ZUJ A;  4ML5 A;  1JIG A;  4ITW A;  4CYA A;  4EVD A;  4MJY A;  5FFC A;  1FHA A;  3GGY A;  3R2M A;  3QZ3 A;  1LKP A;  2YW7 A;  2ITB A;  4LPM A;  5JKL G;  2Z5Q A;  3GGZ A;  4DE6 A;  3E2C A;  1NF4 A;  2VXI A;  3Q4R A;  4E40 A;  2WLA A;  3PVY A;  1RYT A;  3WVW A;  5JKM G;  4ZJK A;  3NP2 X;  4MUD A;  4RC7 B;  4U3G A;  4X0J A;  4W4L B;  4XGS A;  3RD0 A;  2V2I A;  3C1Z A;  1YUX A;  5GN8 B;  2C2U A;  2V2S A;  4RC6 A;  3HL1 A;  3QHC A;  2X17 0;  1VJX A;  3UOF A;  3E6R A;  3KDQ A;  2Z6M A;  4XKS A;  3T9J A;  1MOJ A;  4TOE A;  2D5K A;  1L8I A;  3IQ1 A;  3LKD A;  5FEJ A;  5JKL A;  2C41 A;  3AK9 A;  3R2L A;  4TOB A;  2IU2 A;  3E1J A;  4E6K A;  3O7R A;  3E1M A;  2CLB A;  4TOC A;  4DAS A;  2XKQ A;  5LBH A;  5CMQ A;  4XKU A;  3ISF A;  1GWG A;  2CF7 A;  1UMN A;  3Q4N A;  3F37 A;  3F34 A;  2CN7 A;  5I4J A;  3UNO A;  2V2O A;  3L0M A;  4RC5 A;  2XGW A;  4PG1 A;  3PVT B;  5JAC A;  4IWK A;  1J30 A;  1EUM A;  3QD8 A;  1TK6 A;  4EVC A;  5K53 A;  1JI5 A;  5D8O A;  3QVD A;  2BJY A;  3AK8 A;  2V8U A;  2OH3 A;  3IS7 A;  3EGM A;  4ISM A;  4QUW A;  3SHX A;  3VV9 A;  3FRR A;  2ZG7 X;  5JDO A;  3RAV A;  2ZG8 X;  5D8R A;  4A25 A;  4M34 A;  1RCE A;  5D8S A;  3F33 A;  5GU2 X;  2CHP A;  2CN6 A;  3RE7 A;  1QYB A;  3AF7 X;  2BKC A;  2FHA A;  4CMY V;  4DYX A;  3VNX A;  4REU A;  3AJP A;  5ERK A;  1KRQ A;  2FG8 A;  4R42 A;  1VEI A;  3WVV A;  4II4 A;  3AF9 X;  2V2J A;  3BKN A;  1IES A;  3Q4Q A;  3NP0 X;  4IXK A;  1VEL A;  3M6J A;  2V2M A;  3UFB A;  1Z4A A;  4KVR A;  1RCD A;  3A9Q A;  2C2J A;  4ISP A;  1XZ3 A;  2ZA7 A;  5D8Y A;  4DYZ A;  1B71 A;  5D8Q A;  1AEW A;  1S3Q A;  4KVQ A;  1LB3 A;  5LG2 A;  4ZMC A;  2HTN A;  3KXU A;  4MXP A;  3AJQ A;  5IX6 A;  2FG4 A;  4Z5S A;  3MPS A;  4ZKH A;  3PVY B;  2XJM A;  2HR5 A;  2V2L A;  1IER A;  4PGK A;  1DAT A;  4M33 A;  4AM4 A;  2Z5R A;  2FFX J;  3SH6 A;  3EZ0 A;  3PW8 C;  1BG7 A;  2IY4 A;  1Z6O M;  1DVB A;  2VZB A;  4ZLW A;  3FVB A;  5J93 A;  2N02 A;  4RC8 A;  5CZU A;  4PG0 A;  3Q4O A;  4M32 A;  3E1O A;  4IWJ A;  1Z6O A;  1SOF A;  4LPJ A;  4LQV A;  2V15 A;  3KA4 A;  1BFR A;  5GU1 X;  2C2F A;  4M35 A;  4P18 A;  4TOF A;  1VLG A;  3KWO A;  2V2P A;  4LYU A;  2RBD A;  4EVE A;  2V2R A;  2V8T A;  1RCC A;  2XJO A;  2ZUR X;  2GYQ A;  3HIU A;  3OJ5 A;  2JD7 0;  3PWF A;  4MY7 A;  4LQH A;  5FFD A;  3FI6 A;  2YJJ A;  2Z90 A;  4LQJ A;  5J8W A;  3PWQ C;  3R2S A;  3RBC A;  5K52 A;  2G38 B;  2QQY A;  1O9R A;  2CEI A;  2WLU A;  1OTK A;  2V2N A;  1R03 A;  4RC5 B;  1LKM A;  1F30 A;  4LQN A;  3SID A;  4Y08 A;  5J8S A;  3BVK A;  4XKT A;  1UVH A;  2BW1 A;  3ISE A;  1JGC A;  1TKP A;  2QF9 A;  1JTS A;  1L8H A;  3D19 A;  3PW1 A;  4TO9 A;  2WWX B;  3KA3 A;  1ZS3 A;  4ZL5 A;  3C1Y A;  2JD6 0;  1JKU A;  1HRS A;  2FJC A;  4AM2 A;  2CLU A;  1S30 A;  3W54 A;  1YV1 A;  3KX9 A;  3PW8 A;  2Z5P A;  3RGD A;  2OKC A;  3GE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...