3EZ0A

Crystal structure of protein of unknown function with ferritin-like fold (yp_832262.1) from arthrobacter sp. fb24 at 2.33 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
216
Chain Sequence
TSPADTARYNRFVADLFGMMAYGELSAFERFSADARYSPTLHDRAVLGRIAVVEFRHYELVSARLEAMGIDAEDAMLPFQAAVDYFHSRTRPADWYESLMKAYVIDTVSADFYRAISRYVDAGTRDVIEQIQASDETTEVLRERLRSALADDPRLASRLALWGRRLLGEALTQAQRVSYEHAFLGSLIAAAKELVSGLIAGLAEKHSKRMTQLGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein with ferritin-like fold
publication title Crystal structure of protein of unknown function with ferritin-like fold (YP_832262.1) from Arthrobacter sp. FB24 at 2.33 A resolution
rcsb
source organism Arthrobacter sp. fb24
molecule tags Structural genomics, unknown function
total genus 81
structure length 216
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13794 MiaE_2 tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ez0A00
1S30A 2D5KA 2GYQA 4ERUA 1JGCA 2FFXJ 1FHAA 2FG8A 1L8IA 2V2SA 3UOFA 2FG4A 2FHAA 2V2OA 2YW7A 4XKUA 3BT5A 3E1LA 1NF4A 2YW6A 4TOHA 5LG8A 2XJNA 3E1PA 5JKMG 3E6SA 2V15A 3WVUA 3HIUA 5FFCA 1LB3A 1NNQA 4LQNA 3RBCA 2Z90A 5J9VA 4MJYA 3SHXA 4EVEA 3KA3A 5LS9A 3GVYA 1YUZA 4RC5A 2QF9A 2BW1A 2WTLA 2V2LA 2Z5PA 3GE4A 5GU2X 3KXUA 1JIGA 3F38A 3E6RA 2CN6A 5IX6A 2IU2A 3ISFA 3Q4OA 1S2ZA 3R2RA 1XZ3A 2RBDA 3FVBA 4ZJKA 4P18A 4TOBA 4RC8A 4DZ0A 4Z3BA 3SE1A 1VEQA 4XKTA 5HJFA 1ZS3A 2FKZA 5K53A 1QYBA 4PGIA 2YJJA 2Z5RA 3FI6A 3F34A 2PYBA 4CYAA 3A9QA 3BVLA 1IERA 2CF7A 2C6RA 3UOIA 2JD70 3WVVA 4MUDA 2HR5A 5FFEA 2VXIA 4RC6B 5D8XA 4ISPA 5D8YA 4KVRA 4AM4A 4ETRA 4TOAA 4CVTA 4M35A 4Z5SA 4LPJA 1DPSA 3ERZA 4MKUA 5D8RA 2CIHA 2OH3A 1LKMA 3RD0A 3PW8A 4II4B 1BG7A 3PWQA 1F30A 4CVRA 4IWJA 1RCGA 5CZUA 3F33A 2V2MA 1S3QA 3SH6A 3OJ5A 1DVBA 4DE6A 1BFRA 4YKHA 3Q4QA 1RCCA 4KVQA 5J8WA 1Z6OM 4OYNA 3Q4NA 3NP0X 3KA4A 2Z5QA 4IWKA 4E6KA 1YV1A 5AXSA 5LBHA 3GHQA 2CLUA 3E1NA 4M34A 5HQOA 1TKOA 3PVTB 2OC5A 3BVEA 3BVFA 4TW3A 3HL1A 1SQ3A 2GYDA 3PVYB 1RYTA 3OGHA 4REUA 3EZ0A 3E1MA 3WVWA 4CMYA 4TOGA 1MOJA 3BVIA 2ZG8X 4DYYA 2WLUA 3NP2X 5K52A 1KRQA 1JI4A 1JKVA 3KX9A 4ZKWA 3IQ1A 3A68A 2ITBA 1F33A 3PZAA 4XKSA 3F37A 2W0OA 4EVCA 5D8QA 2XGWA 3KA9A 3PVTA 1JKUA 1LKOA 5LG2A 5D8OA 4LQVA 3KA6A 3PVYA 3R2OA 5C6FA 5JACA 3AJPA 4RC7B 3EZUA 1VLGA 1TJOA 5HJHA 1IESA 3PW8C 4AM5A 2Y3QA 5JKMA 1MFRA 2C2UA 1LKPA 3PWQC 2CLBA 2CEIA 4ZMCA 2C41A 1JI5A 2ZA8A 2X170 2BKCA 3AK9A 5D8SA 4MN9A 2XJOA 4LPNA 1AEWA 2C2FA 4TODA 2ZA7A 2C2JA 4EVBA 3E1QA 2IB0A 5JKLG 3T9JA 1HRSA 2FZFA 4A25A 4KVSA 1UVHA 4RC7A 4LYXA 3QVDA 2V2RA 1DATA 3E2CA 1ZUJA 1TKPA 3O7SA 1O9IA 5J8SA 3SIDA 3R2LA 4PG0A 4DI0A 2CHPA 1J30A 3AF7X 4TOCA 3PVRB 4CYBA 3AJQA 4RC6A 3R2MA 5GOUA 3NOZX 4Y08A 3KWOA 2XJMA 4XGSA 1JYBA 4TO9A 3U90A 4DYUA 3AF8X 4CVSA 2F7NA 4ML5A 4MY7A 4RC5B 5CMQA 2ZURX 3QHBA 4II4A 3BKNA 4R42A 1VJXA 5GN8B 3Q4RA 3PW1B 4LYUA 4LPMA 2V2NA 2IY4A 4AM2A 1O9RA 4ITTA 1SOFA 2ZG7X 5ERJA 2XKQA 2VXXA 3ISEA 3FSEA 3RGDA 3R2HA 3PVRA 3KA8A 3WNWA 4DYXA 2ZG9X 5E2DA 2V2IA 1RCIA 1GWGA 1OTKA 5GU1X 5FEJA 3TA8A 3EGMA 1VELA 5FFDA 2VZBA 5ERKA 4M32A 4U3GA 5GN8A 3E1JA 4DASA 3AF9X 3PW1A 2GS4A 3IS7A 3O7RA 3AJOA 4TOFA 4CVPA 3PWFA 4TOEA 3QHCA 3RE7A 2Z6MA 5E1UA 3F32A 5J93A 3H7GA 4LQHA 3QD8A 1B71A 4PGKA 1NF6A 1BCFA 4CY9A 2UX1A 1QGHA 1Z4AA 2YJKA 4ISMA 3QB9A 1JREA 4PG1A 4ZKHA 4ZLWA 5GU0X 5CMRA 2HTNA 2V2JA 4CMYV 3R2KA 3QZ3A 3IS8A 3UNOA 2BK6A 2G4HA 4QUWA 4EVDA 1VEIA 1EUMA 2FL0A 2JD60 2V2PA 3R2SA 4ZKXA 1RCEA 2WLAA 1JTSA 3RAVA 2CN7A 1L8HA 5I4JA 1NFVA 3MPSA 2BJYA 3F39A 2CHIA 1RCDA 3BVKA 5D8PA 1R03A 3ES3A 1Z6OA 2QQYA 4ZL5A 5FFBA 2ZA6A 4ZL6A 3E1OA 1YUXA 4ZTTA 1UMNA 2JD80 1H96A 5FFAA 1N1QA 3AK8A 3F36A 4ITWA 3VNXA 4IXKA 5GU3X 4M33A 2FJCA 4LQJA 1TK6A 5JKLA 4DYZA 3F35A 1XZ1A
chains in the Genus database with same CATH superfamily
2CWLA 1S30A 2D5KA 2GYQA 4ERUA 1JGCA 2FFXJ 1FHAA 2FG8A 1L8IA 2V2SA 3UOFA 2FG4A 2FHAA 2V2OA 2V8TA 2YW7A 4XKUA 3BT5A 3E1LA 1NF4A 2YW6A 4TOHA 4YVZA 5LG8A 2XJNA 3E1PA 5JKMG 3E6SA 2V15A 3WVUA 3HIUA 5FFCA 1LB3A 1NNQA 4LQNA 4MXPA 2Z90A 3RBCA 5J9VA 4MJYA 3SHXA 4EVEA 3KA3A 5LS9A 3GVYA 1YUZA 4RC5A 2QF9A 2BW1A 2WTLA 2V2LA 2Z5PA 3GE4A 5GU2X 2V8UA 1JIGA 3KXUA 3F38A 3E6RA 2CN6A 5IX6A 2IU2A 3ISFA 3Q4OA 1S2ZA 3R2RA 1XZ3A 2RBDA 3FVBA 4ZJKA 4P18A 2N02A 3UFBA 4TOBA 4RC8A 3W54A 4DZ0A 4Z3BA 3SE1A 1VEQA 4XKTA 3FRSA 5HJFA 1ZS3A 2FKZA 5K53A 1QYBA 4PGIA 2YJJA 2Z5RA 3FI6A 3F34A 2PYBA 4CYAA 3A9QA 3BVLA 1IERA 2CF7A 2C6RA 3UOIA 2JD70 3WVVA 4MUDA 2HR5A 5FFEA 3JZ9A 2VXIA 4RC6B 5D8XA 4ISPA 3VV9A 5D8YA 4KVRA 4AM4A 4ETRA 4TOAA 4CVTA 4M35A 4Z5SA 4LPJA 1DPSA 3ERZA 4W4KB 4MKUA 4E40A 5D8RA 2CIHA 2OH3A 1LKMA 3RD0A 3PW8A 4II4B 1BG7A 3PWQA 1F30A 4CVRA 4IWJA 1RCGA 5CZUA 3F33A 2V2MA 1S3QA 3SH6A 3OJ5A 1DVBA 3M6JA 4DE6A 1BFRA 4YKHA 3Q4QA 1RCCA 4KVQA 5J8WA 1Z6OM 4OYNA 4X0JA 3Q4NA 3NP0X 3KA4A 2Z5QA 4IWKA 4E6KA 1YV1A 5AXSA 5LBHA 3GHQA 3JZAB 2CLUA 3E1NA 4M34A 5HQOA 1TKOA 3PVTB 2OC5A 3BVEA 3BVFA 4TW3A 3HL1A 1SQ3A 2GYDA 3PVYB 1RYTA 3OGHA 4REUA 3EZ0A 3E1MA 3WVWA 4CMYA 4TOGA 1MOJA 3BVIA 2ZG8X 4DYYA 2WLUA 3NP2X 5K52A 1KRQA 1JI4A 1JKVA 3KX9A 4ZKWA 3IQ1A 3A68A 2ITBA 1F33A 3PZAA 4XKSA 3F37A 2W0OA 4EVCA 5D8QA 2XGWA 5JDOB 3KA9A 3PVTA 1JKUA 1LKOA 5LG2A 3GGZA 5D8OA 4LQVA 3KA6A 5HU6D 3PVYA 3R2OA 5C6FA 2OKCA 4YXJA 5JACA 3AJPA 4RC7B 3EZUA 1VLGA 1TJOA 5HJHA 1IESA 3C23A 3L0MA 3GGYA 3PW8C 4AM5A 2Y3QA 5JKMA 1MFRA 2C2UA 1LKPA 3PWQC 2CLBA 2CEIA 4ZMCA 2C41A 1JI5A 2ZA8A 2X170 2BKCA 3AK9A 5D8SA 4MN9A 2XJOA 4LPNA 1AEWA 3FRRA 5JDOA 2C2FA 4TODA 2ZA7A 2C2JA 4EVBA 3E1QA 2IB0A 5JKLG 3T9JA 3VVAA 1HRSA 2FZFA 2MGYA 4A25A 2WWXB 4KVSA 1UVHA 4RC7A 4LYXA 3QVDA 2V2RA 1DATA 3E2CA 1ZUJA 1TKPA 3O7SA 1O9IA 5J8SA 3SIDA 3R2LA 4PG0A 4DI0A 2CHPA 1J30A 3AF7X 4TOCA 3PVRB 4CYBA 3AJQA 3C21A 4RC6A 3R2MA 2AR0A 5GOUA 3NOZX 4Y08A 3LKDA 3KWOA 2XJMA 4XGSA 1JYBA 4TO9A 3U90A 4DYUA 3AF8X 4CVSA 2F7NA 4ML5A 4MY7A 4RC5B 5CMQA 2ZURX 3QHBA 4II4A 3BKNA 4R42A 1VJXA 5GN8B 3Q4RA 3PW1B 4LYUA 4LPMA 2V2NA 2IY4A 3DBYA 4AM2A 1O9RA 4ITTA 2Y44A 1SOFA 2ZG7X 5ERJA 2XKQA 2VXXA 3ISEA 3FSEA 3RGDA 3R2HA 3PVRA 3KA8A 3WNWA 4DYXA 2ZG9X 5E2DA 2V2IA 1RCIA 1GWGA 1OTKA 5GU1X 3D19A 5FEJA 3TA8A 3EGMA 1VELA 3N6OA 5FFDA 2VZBA 5ERKA 4M32A 4U3GA 5GN8A 3E1JA 4DASA 4YXMA 3AF9X 3PW1A 2GS4A 3IS7A 3O7RA 3AJOA 4TOFA 4CVPA 3PWFA 4TOEA 3QHCA 3RE7A 2Z6MA 5E1UA 3F32A 5J93A 3H7GA 4KXRB 4LQHA 3QD8A 1B71A 4PGKA 1NF6A 2G38B 1BCFA 4CY9A 2UX1A 1QGHA 1Z4AA 2YJKA 3C1YA 4ISMA 3QB9A 1JREA 4PG1A 4ZKHA 4ZLWA 5GU0X 5CMRA 2HTNA 2V2JA 4CMYV 3R2KA 3QZ3A 4W4LB 3IS8A 3UNOA 2BK6A 2G4HA 4QUWA 4EVDA 1VEIA 1EUMA 2FL0A 2JD60 2V2PA 3R2SA 4ZKXA 1RCEA 2WLAA 1JTSA 3RAVA 2CN7A 1L8HA 5I4JA 1NFVA 3MPSA 2BJYA 3F39A 2CHIA 1RCDA 3C1ZA 3KHKA 3BVKA 5D8PA 4WJG4 1R03A 3ES3A 1Z6OA 2QQYA 4ZL5A 5FFBA 2ZA6A 4ZL6A 3E1OA 1YUXA 4ZTTA 1UMNA 2JD80 1H96A 5FFAA 1N1QA 3AK8A 3F36A 3V3KB 4ITWA 3VNXA 4IXKA 5GU3X 4M33A 2FJCA 4LQJA 1TK6A 5JKLA 4DYZA 3KDQA 3F35A 1XZ1A
chains in the Genus database with same CATH topology
2CWLA 1S30A 2D5KA 2GYQA 4ERUA 1JGCA 2FFXJ 1FHAA 2FG8A 1L8IA 2V2SA 3UOFA 2FG4A 2FHAA 2V2OA 2V8TA 2YW7A 4XKUA 3BT5A 3E1LA 1NF4A 2YW6A 4TOHA 4YVZA 5LG8A 2XJNA 3E1PA 5JKMG 3E6SA 2V15A 3WVUA 3HIUA 5FFCA 1LB3A 1NNQA 4LQNA 4MXPA 2Z90A 3RBCA 5J9VA 4MJYA 3SHXA 4EVEA 3KA3A 5LS9A 3GVYA 1YUZA 4RC5A 2QF9A 2BW1A 2WTLA 2V2LA 2Z5PA 3GE4A 5GU2X 2V8UA 1JIGA 3KXUA 3F38A 3E6RA 2CN6A 5IX6A 2IU2A 3ISFA 3Q4OA 1S2ZA 3R2RA 1XZ3A 2RBDA 3FVBA 4ZJKA 4P18A 2N02A 3UFBA 4TOBA 4RC8A 3W54A 4DZ0A 4Z3BA 3SE1A 1VEQA 4XKTA 3FRSA 5HJFA 1ZS3A 2FKZA 5K53A 1QYBA 4PGIA 2YJJA 2Z5RA 3FI6A 3F34A 2PYBA 4CYAA 3A9QA 3BVLA 1IERA 2CF7A 2C6RA 3UOIA 2JD70 3WVVA 4MUDA 2HR5A 5FFEA 3JZ9A 2VXIA 4RC6B 5D8XA 4ISPA 3VV9A 5D8YA 4KVRA 4AM4A 4ETRA 4TOAA 4CVTA 4M35A 4Z5SA 4LPJA 1DPSA 3ERZA 4W4KB 4MKUA 4E40A 5D8RA 2CIHA 2OH3A 1LKMA 3RD0A 3PW8A 4II4B 1BG7A 3PWQA 1F30A 4CVRA 4IWJA 1RCGA 5CZUA 3F33A 2V2MA 1S3QA 3SH6A 3OJ5A 1DVBA 3M6JA 4DE6A 1BFRA 4YKHA 3Q4QA 1RCCA 4KVQA 5J8WA 1Z6OM 4OYNA 4X0JA 3Q4NA 3NP0X 3KA4A 2Z5QA 4IWKA 4E6KA 1YV1A 5AXSA 5LBHA 3GHQA 3JZAB 2CLUA 3E1NA 4M34A 5HQOA 1TKOA 3PVTB 2OC5A 3BVEA 3BVFA 4TW3A 3HL1A 1SQ3A 2GYDA 3PVYB 1RYTA 3OGHA 4REUA 3EZ0A 3E1MA 3WVWA 4CMYA 4TOGA 1MOJA 3BVIA 2ZG8X 4DYYA 2WLUA 3NP2X 5K52A 1KRQA 1JI4A 1JKVA 3KX9A 4ZKWA 3IQ1A 3A68A 2ITBA 1F33A 3PZAA 4XKSA 3F37A 2W0OA 4EVCA 5D8QA 2XGWA 5JDOB 3KA9A 3PVTA 1JKUA 1LKOA 5LG2A 3GGZA 5D8OA 4LQVA 3KA6A 5HU6D 3PVYA 3R2OA 5C6FA 2OKCA 4YXJA 5JACA 3AJPA 4RC7B 3EZUA 1VLGA 1TJOA 5HJHA 1IESA 3C23A 3L0MA 3GGYA 3PW8C 4AM5A 2Y3QA 5JKMA 1MFRA 2C2UA 1LKPA 3PWQC 2CLBA 2CEIA 4ZMCA 2C41A 1JI5A 2ZA8A 2X170 2BKCA 3AK9A 5D8SA 4MN9A 2XJOA 4LPNA 1AEWA 3FRRA 5JDOA 2C2FA 4TODA 2ZA7A 2C2JA 4EVBA 3E1QA 2IB0A 5JKLG 3T9JA 3VVAA 1HRSA 2FZFA 2MGYA 4A25A 2WWXB 4KVSA 1UVHA 4RC7A 4LYXA 3QVDA 2V2RA 1DATA 3E2CA 1ZUJA 1TKPA 3O7SA 1O9IA 5J8SA 3SIDA 3R2LA 4PG0A 4DI0A 2CHPA 1J30A 3AF7X 4TOCA 3PVRB 4CYBA 3AJQA 3C21A 4RC6A 3R2MA 2AR0A 5GOUA 3NOZX 4Y08A 3LKDA 3KWOA 2XJMA 4XGSA 1JYBA 4TO9A 3U90A 4DYUA 3AF8X 4CVSA 2F7NA 4ML5A 4MY7A 4RC5B 5CMQA 2ZURX 3QHBA 4II4A 3BKNA 4R42A 1VJXA 5GN8B 3Q4RA 3PW1B 4LYUA 4LPMA 2V2NA 2IY4A 3DBYA 4AM2A 1O9RA 4ITTA 2Y44A 1SOFA 2ZG7X 5ERJA 2XKQA 2VXXA 3ISEA 3FSEA 3RGDA 3R2HA 3PVRA 3KA8A 3WNWA 4DYXA 2ZG9X 5E2DA 2V2IA 1RCIA 1GWGA 1OTKA 5GU1X 3D19A 5FEJA 3TA8A 3EGMA 1VELA 3N6OA 5FFDA 2VZBA 5ERKA 4M32A 4U3GA 5GN8A 3E1JA 4DASA 4YXMA 3AF9X 3PW1A 2GS4A 3IS7A 3O7RA 3AJOA 4TOFA 4CVPA 3PWFA 4TOEA 3QHCA 3RE7A 2Z6MA 5E1UA 3F32A 5J93A 3H7GA 4KXRB 4LQHA 3QD8A 1B71A 4PGKA 1NF6A 2G38B 1BCFA 4CY9A 2UX1A 1QGHA 1Z4AA 2YJKA 3C1YA 4ISMA 3QB9A 1JREA 4PG1A 4ZKHA 4ZLWA 5GU0X 5CMRA 2HTNA 2V2JA 4CMYV 3R2KA 3QZ3A 4W4LB 3IS8A 3UNOA 2BK6A 2G4HA 4QUWA 4EVDA 1VEIA 1EUMA 2FL0A 2JD60 2V2PA 3R2SA 4ZKXA 1RCEA 2WLAA 1JTSA 3RAVA 2CN7A 1L8HA 5I4JA 1NFVA 3MPSA 2BJYA 3F39A 2CHIA 1RCDA 3C1ZA 3KHKA 3BVKA 5D8PA 4WJG4 1R03A 3ES3A 1Z6OA 2QQYA 4ZL5A 5FFBA 2ZA6A 4ZL6A 3E1OA 1YUXA 4ZTTA 1UMNA 2JD80 1H96A 5FFAA 1N1QA 3AK8A 3F36A 3V3KB 4ITWA 3VNXA 4IXKA 5GU3X 4M33A 2FJCA 4LQJA 1TK6A 5JKLA 4DYZA 3KDQA 3F35A 1XZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S30 A;  2D5K A;  2GYQ A;  4ERU A;  1JGC A;  2FFX J;  1FHA A;  2FG8 A;  1L8I A;  2V2S A;  3UOF A;  2FG4 A;  2FHA A;  2V2O A;  2YW7 A;  4XKU A;  3BT5 A;  3E1L A;  1NF4 A;  2YW6 A;  4TOH A;  5LG8 A;  2XJN A;  3E1P A;  5JKM G;  3E6S A;  2V15 A;  3WVU A;  3HIU A;  5FFC A;  1LB3 A;  1NNQ A;  4LQN A;  3RBC A;  2Z90 A;  5J9V A;  4MJY A;  3SHX A;  4EVE A;  3KA3 A;  5LS9 A;  3GVY A;  1YUZ A;  4RC5 A;  2QF9 A;  2BW1 A;  2WTL A;  2V2L A;  2Z5P A;  3GE4 A;  5GU2 X;  3KXU A;  1JIG A;  3F38 A;  3E6R A;  2CN6 A;  5IX6 A;  2IU2 A;  3ISF A;  3Q4O A;  1S2Z A;  3R2R A;  1XZ3 A;  2RBD A;  3FVB A;  4ZJK A;  4P18 A;  4TOB A;  4RC8 A;  4DZ0 A;  4Z3B A;  3SE1 A;  1VEQ A;  4XKT A;  5HJF A;  1ZS3 A;  2FKZ A;  5K53 A;  1QYB A;  4PGI A;  2YJJ A;  2Z5R A;  3FI6 A;  3F34 A;  2PYB A;  4CYA A;  3A9Q A;  3BVL A;  1IER A;  2CF7 A;  2C6R A;  3UOI A;  2JD7 0;  3WVV A;  4MUD A;  2HR5 A;  5FFE A;  2VXI A;  4RC6 B;  5D8X A;  4ISP A;  5D8Y A;  4KVR A;  4AM4 A;  4ETR A;  4TOA A;  4CVT A;  4M35 A;  4Z5S A;  4LPJ A;  1DPS A;  3ERZ A;  4MKU A;  5D8R A;  2CIH A;  2OH3 A;  1LKM A;  3RD0 A;  3PW8 A;  4II4 B;  1BG7 A;  3PWQ A;  1F30 A;  4CVR A;  4IWJ A;  1RCG A;  5CZU A;  3F33 A;  2V2M A;  1S3Q A;  3SH6 A;  3OJ5 A;  1DVB A;  4DE6 A;  1BFR A;  4YKH A;  3Q4Q A;  1RCC A;  4KVQ A;  5J8W A;  1Z6O M;  4OYN A;  3Q4N A;  3NP0 X;  3KA4 A;  2Z5Q A;  4IWK A;  4E6K A;  1YV1 A;  5AXS A;  5LBH A;  3GHQ A;  2CLU A;  3E1N A;  4M34 A;  5HQO A;  1TKO A;  3PVT B;  2OC5 A;  3BVE A;  3BVF A;  4TW3 A;  3HL1 A;  1SQ3 A;  2GYD A;  3PVY B;  1RYT A;  3OGH A;  4REU A;  3EZ0 A;  3E1M A;  3WVW A;  4CMY A;  4TOG A;  1MOJ A;  3BVI A;  2ZG8 X;  4DYY A;  2WLU A;  3NP2 X;  5K52 A;  1KRQ A;  1JI4 A;  1JKV A;  3KX9 A;  4ZKW A;  3IQ1 A;  3A68 A;  2ITB A;  1F33 A;  3PZA A;  4XKS A;  3F37 A;  2W0O A;  4EVC A;  5D8Q A;  2XGW A;  3KA9 A;  3PVT A;  1JKU A;  1LKO A;  5LG2 A;  5D8O A;  4LQV A;  3KA6 A;  3PVY A;  3R2O A;  5C6F A;  5JAC A;  3AJP A;  4RC7 B;  3EZU A;  1VLG A;  1TJO A;  5HJH A;  1IES A;  3PW8 C;  4AM5 A;  2Y3Q A;  5JKM A;  1MFR A;  2C2U A;  1LKP A;  3PWQ C;  2CLB A;  2CEI A;  4ZMC A;  2C41 A;  1JI5 A;  2ZA8 A;  2X17 0;  2BKC A;  3AK9 A;  5D8S A;  4MN9 A;  2XJO A;  4LPN A;  1AEW A;  2C2F A;  4TOD A;  2ZA7 A;  2C2J A;  4EVB A;  3E1Q A;  2IB0 A;  5JKL G;  3T9J A;  1HRS A;  2FZF A;  4A25 A;  4KVS A;  1UVH A;  4RC7 A;  4LYX A;  3QVD A;  2V2R A;  1DAT A;  3E2C A;  1ZUJ A;  1TKP A;  3O7S A;  1O9I A;  5J8S A;  3SID A;  3R2L A;  4PG0 A;  4DI0 A;  2CHP A;  1J30 A;  3AF7 X;  4TOC A;  3PVR B;  4CYB A;  3AJQ A;  4RC6 A;  3R2M A;  5GOU A;  3NOZ X;  4Y08 A;  3KWO A;  2XJM A;  4XGS A;  1JYB A;  4TO9 A;  3U90 A;  4DYU A;  3AF8 X;  4CVS A;  2F7N A;  4ML5 A;  4MY7 A;  4RC5 B;  5CMQ A;  2ZUR X;  3QHB A;  4II4 A;  3BKN A;  4R42 A;  1VJX A;  5GN8 B;  3Q4R A;  3PW1 B;  4LYU A;  4LPM A;  2V2N A;  2IY4 A;  4AM2 A;  1O9R A;  4ITT A;  1SOF A;  2ZG7 X;  5ERJ A;  2XKQ A;  2VXX A;  3ISE A;  3FSE A;  3RGD A;  3R2H A;  3PVR A;  3KA8 A;  3WNW A;  4DYX A;  2ZG9 X;  5E2D A;  2V2I A;  1RCI A;  1GWG A;  1OTK A;  5GU1 X;  5FEJ A;  3TA8 A;  3EGM A;  1VEL A;  5FFD A;  2VZB A;  5ERK A;  4M32 A;  4U3G A;  5GN8 A;  3E1J A;  4DAS A;  3AF9 X;  3PW1 A;  2GS4 A;  3IS7 A;  3O7R A;  3AJO A;  4TOF A;  4CVP A;  3PWF A;  4TOE A;  3QHC A;  3RE7 A;  2Z6M A;  5E1U A;  3F32 A;  5J93 A;  3H7G A;  4LQH A;  3QD8 A;  1B71 A;  4PGK A;  1NF6 A;  1BCF A;  4CY9 A;  2UX1 A;  1QGH A;  1Z4A A;  2YJK A;  4ISM A;  3QB9 A;  1JRE A;  4PG1 A;  4ZKH A;  4ZLW A;  5GU0 X;  5CMR A;  2HTN A;  2V2J A;  4CMY V;  3R2K A;  3QZ3 A;  3IS8 A;  3UNO A;  2BK6 A;  2G4H A;  4QUW A;  4EVD A;  1VEI A;  1EUM A;  2FL0 A;  2JD6 0;  2V2P A;  3R2S A;  4ZKX A;  1RCE A;  2WLA A;  1JTS A;  3RAV A;  2CN7 A;  1L8H A;  5I4J A;  1NFV A;  3MPS A;  2BJY A;  3F39 A;  2CHI A;  1RCD A;  3BVK A;  5D8P A;  1R03 A;  3ES3 A;  1Z6O A;  2QQY A;  4ZL5 A;  5FFB A;  2ZA6 A;  4ZL6 A;  3E1O A;  1YUX A;  4ZTT A;  1UMN A;  2JD8 0;  1H96 A;  5FFA A;  1N1Q A;  3AK8 A;  3F36 A;  4ITW A;  3VNX A;  4IXK A;  5GU3 X;  4M33 A;  2FJC A;  4LQJ A;  1TK6 A;  5JKL A;  4DYZ A;  3F35 A;  1XZ1 A; 
#chains in the Genus database with same CATH topology
 2CWL A;  1S30 A;  2D5K A;  2GYQ A;  4ERU A;  1JGC A;  2FFX J;  1FHA A;  2FG8 A;  1L8I A;  2V2S A;  3UOF A;  2FG4 A;  2FHA A;  2V2O A;  2V8T A;  2YW7 A;  4XKU A;  3BT5 A;  3E1L A;  1NF4 A;  2YW6 A;  4TOH A;  4YVZ A;  5LG8 A;  2XJN A;  3E1P A;  5JKM G;  3E6S A;  2V15 A;  3WVU A;  3HIU A;  5FFC A;  1LB3 A;  1NNQ A;  4LQN A;  4MXP A;  2Z90 A;  3RBC A;  5J9V A;  4MJY A;  3SHX A;  4EVE A;  3KA3 A;  5LS9 A;  3GVY A;  1YUZ A;  4RC5 A;  2QF9 A;  2BW1 A;  2WTL A;  2V2L A;  2Z5P A;  3GE4 A;  5GU2 X;  2V8U A;  1JIG A;  3KXU A;  3F38 A;  3E6R A;  2CN6 A;  5IX6 A;  2IU2 A;  3ISF A;  3Q4O A;  1S2Z A;  3R2R A;  1XZ3 A;  2RBD A;  3FVB A;  4ZJK A;  4P18 A;  2N02 A;  3UFB A;  4TOB A;  4RC8 A;  3W54 A;  4DZ0 A;  4Z3B A;  3SE1 A;  1VEQ A;  4XKT A;  3FRS A;  5HJF A;  1ZS3 A;  2FKZ A;  5K53 A;  1QYB A;  4PGI A;  2YJJ A;  2Z5R A;  3FI6 A;  3F34 A;  2PYB A;  4CYA A;  3A9Q A;  3BVL A;  1IER A;  2CF7 A;  2C6R A;  3UOI A;  2JD7 0;  3WVV A;  4MUD A;  2HR5 A;  5FFE A;  3JZ9 A;  2VXI A;  4RC6 B;  5D8X A;  4ISP A;  3VV9 A;  5D8Y A;  4KVR A;  4AM4 A;  4ETR A;  4TOA A;  4CVT A;  4M35 A;  4Z5S A;  4LPJ A;  1DPS A;  3ERZ A;  4W4K B;  4MKU A;  4E40 A;  5D8R A;  2CIH A;  2OH3 A;  1LKM A;  3RD0 A;  3PW8 A;  4II4 B;  1BG7 A;  3PWQ A;  1F30 A;  4CVR A;  4IWJ A;  1RCG A;  5CZU A;  3F33 A;  2V2M A;  1S3Q A;  3SH6 A;  3OJ5 A;  1DVB A;  3M6J A;  4DE6 A;  1BFR A;  4YKH A;  3Q4Q A;  1RCC A;  4KVQ A;  5J8W A;  1Z6O M;  4OYN A;  4X0J A;  3Q4N A;  3NP0 X;  3KA4 A;  2Z5Q A;  4IWK A;  4E6K A;  1YV1 A;  5AXS A;  5LBH A;  3GHQ A;  3JZA B;  2CLU A;  3E1N A;  4M34 A;  5HQO A;  1TKO A;  3PVT B;  2OC5 A;  3BVE A;  3BVF A;  4TW3 A;  3HL1 A;  1SQ3 A;  2GYD A;  3PVY B;  1RYT A;  3OGH A;  4REU A;  3EZ0 A;  3E1M A;  3WVW A;  4CMY A;  4TOG A;  1MOJ A;  3BVI A;  2ZG8 X;  4DYY A;  2WLU A;  3NP2 X;  5K52 A;  1KRQ A;  1JI4 A;  1JKV A;  3KX9 A;  4ZKW A;  3IQ1 A;  3A68 A;  2ITB A;  1F33 A;  3PZA A;  4XKS A;  3F37 A;  2W0O A;  4EVC A;  5D8Q A;  2XGW A;  5JDO B;  3KA9 A;  3PVT A;  1JKU A;  1LKO A;  5LG2 A;  3GGZ A;  5D8O A;  4LQV A;  3KA6 A;  5HU6 D;  3PVY A;  3R2O A;  5C6F A;  2OKC A;  4YXJ A;  5JAC A;  3AJP A;  4RC7 B;  3EZU A;  1VLG A;  1TJO A;  5HJH A;  1IES A;  3C23 A;  3L0M A;  3GGY A;  3PW8 C;  4AM5 A;  2Y3Q A;  5JKM A;  1MFR A;  2C2U A;  1LKP A;  3PWQ C;  2CLB A;  2CEI A;  4ZMC A;  2C41 A;  1JI5 A;  2ZA8 A;  2X17 0;  2BKC A;  3AK9 A;  5D8S A;  4MN9 A;  2XJO A;  4LPN A;  1AEW A;  3FRR A;  5JDO A;  2C2F A;  4TOD A;  2ZA7 A;  2C2J A;  4EVB A;  3E1Q A;  2IB0 A;  5JKL G;  3T9J A;  3VVA A;  1HRS A;  2FZF A;  2MGY A;  4A25 A;  2WWX B;  4KVS A;  1UVH A;  4RC7 A;  4LYX A;  3QVD A;  2V2R A;  1DAT A;  3E2C A;  1ZUJ A;  1TKP A;  3O7S A;  1O9I A;  5J8S A;  3SID A;  3R2L A;  4PG0 A;  4DI0 A;  2CHP A;  1J30 A;  3AF7 X;  4TOC A;  3PVR B;  4CYB A;  3AJQ A;  3C21 A;  4RC6 A;  3R2M A;  2AR0 A;  5GOU A;  3NOZ X;  4Y08 A;  3LKD A;  3KWO A;  2XJM A;  4XGS A;  1JYB A;  4TO9 A;  3U90 A;  4DYU A;  3AF8 X;  4CVS A;  2F7N A;  4ML5 A;  4MY7 A;  4RC5 B;  5CMQ A;  2ZUR X;  3QHB A;  4II4 A;  3BKN A;  4R42 A;  1VJX A;  5GN8 B;  3Q4R A;  3PW1 B;  4LYU A;  4LPM A;  2V2N A;  2IY4 A;  3DBY A;  4AM2 A;  1O9R A;  4ITT A;  2Y44 A;  1SOF A;  2ZG7 X;  5ERJ A;  2XKQ A;  2VXX A;  3ISE A;  3FSE A;  3RGD A;  3R2H A;  3PVR A;  3KA8 A;  3WNW A;  4DYX A;  2ZG9 X;  5E2D A;  2V2I A;  1RCI A;  1GWG A;  1OTK A;  5GU1 X;  3D19 A;  5FEJ A;  3TA8 A;  3EGM A;  1VEL A;  3N6O A;  5FFD A;  2VZB A;  5ERK A;  4M32 A;  4U3G A;  5GN8 A;  3E1J A;  4DAS A;  4YXM A;  3AF9 X;  3PW1 A;  2GS4 A;  3IS7 A;  3O7R A;  3AJO A;  4TOF A;  4CVP A;  3PWF A;  4TOE A;  3QHC A;  3RE7 A;  2Z6M A;  5E1U A;  3F32 A;  5J93 A;  3H7G A;  4KXR B;  4LQH A;  3QD8 A;  1B71 A;  4PGK A;  1NF6 A;  2G38 B;  1BCF A;  4CY9 A;  2UX1 A;  1QGH A;  1Z4A A;  2YJK A;  3C1Y A;  4ISM A;  3QB9 A;  1JRE A;  4PG1 A;  4ZKH A;  4ZLW A;  5GU0 X;  5CMR A;  2HTN A;  2V2J A;  4CMY V;  3R2K A;  3QZ3 A;  4W4L B;  3IS8 A;  3UNO A;  2BK6 A;  2G4H A;  4QUW A;  4EVD A;  1VEI A;  1EUM A;  2FL0 A;  2JD6 0;  2V2P A;  3R2S A;  4ZKX A;  1RCE A;  2WLA A;  1JTS A;  3RAV A;  2CN7 A;  1L8H A;  5I4J A;  1NFV A;  3MPS A;  2BJY A;  3F39 A;  2CHI A;  1RCD A;  3C1Z A;  3KHK A;  3BVK A;  5D8P A;  4WJG 4;  1R03 A;  3ES3 A;  1Z6O A;  2QQY A;  4ZL5 A;  5FFB A;  2ZA6 A;  4ZL6 A;  3E1O A;  1YUX A;  4ZTT A;  1UMN A;  2JD8 0;  1H96 A;  5FFA A;  1N1Q A;  3AK8 A;  3F36 A;  3V3K B;  4ITW A;  3VNX A;  4IXK A;  5GU3 X;  4M33 A;  2FJC A;  4LQJ A;  1TK6 A;  5JKL A;  4DYZ A;  3KDQ A;  3F35 A;  1XZ1 A; 
#chains in the Genus database with same CATH homology
 2CWL A;  1S30 A;  2D5K A;  2GYQ A;  4ERU A;  1JGC A;  2FFX J;  1FHA A;  2FG8 A;  1L8I A;  2V2S A;  3UOF A;  2FG4 A;  2FHA A;  2V2O A;  2V8T A;  2YW7 A;  4XKU A;  3BT5 A;  3E1L A;  1NF4 A;  2YW6 A;  4TOH A;  4YVZ A;  5LG8 A;  2XJN A;  3E1P A;  5JKM G;  3E6S A;  2V15 A;  3WVU A;  3HIU A;  5FFC A;  1LB3 A;  1NNQ A;  4LQN A;  4MXP A;  2Z90 A;  3RBC A;  5J9V A;  4MJY A;  3SHX A;  4EVE A;  3KA3 A;  5LS9 A;  3GVY A;  1YUZ A;  4RC5 A;  2QF9 A;  2BW1 A;  2WTL A;  2V2L A;  2Z5P A;  3GE4 A;  5GU2 X;  2V8U A;  1JIG A;  3KXU A;  3F38 A;  3E6R A;  2CN6 A;  5IX6 A;  2IU2 A;  3ISF A;  3Q4O A;  1S2Z A;  3R2R A;  1XZ3 A;  2RBD A;  3FVB A;  4ZJK A;  4P18 A;  2N02 A;  3UFB A;  4TOB A;  4RC8 A;  3W54 A;  4DZ0 A;  4Z3B A;  3SE1 A;  1VEQ A;  4XKT A;  3FRS A;  5HJF A;  1ZS3 A;  2FKZ A;  5K53 A;  1QYB A;  4PGI A;  2YJJ A;  2Z5R A;  3FI6 A;  3F34 A;  2PYB A;  4CYA A;  3A9Q A;  3BVL A;  1IER A;  2CF7 A;  2C6R A;  3UOI A;  2JD7 0;  3WVV A;  4MUD A;  2HR5 A;  5FFE A;  3JZ9 A;  2VXI A;  4RC6 B;  5D8X A;  4ISP A;  3VV9 A;  5D8Y A;  4KVR A;  4AM4 A;  4ETR A;  4TOA A;  4CVT A;  4M35 A;  4Z5S A;  4LPJ A;  1DPS A;  3ERZ A;  4W4K B;  4MKU A;  4E40 A;  5D8R A;  2CIH A;  2OH3 A;  1LKM A;  3RD0 A;  3PW8 A;  4II4 B;  1BG7 A;  3PWQ A;  1F30 A;  4CVR A;  4IWJ A;  1RCG A;  5CZU A;  3F33 A;  2V2M A;  1S3Q A;  3SH6 A;  3OJ5 A;  1DVB A;  3M6J A;  4DE6 A;  1BFR A;  4YKH A;  3Q4Q A;  1RCC A;  4KVQ A;  5J8W A;  1Z6O M;  4OYN A;  4X0J A;  3Q4N A;  3NP0 X;  3KA4 A;  2Z5Q A;  4IWK A;  4E6K A;  1YV1 A;  5AXS A;  5LBH A;  3GHQ A;  3JZA B;  2CLU A;  3E1N A;  4M34 A;  5HQO A;  1TKO A;  3PVT B;  2OC5 A;  3BVE A;  3BVF A;  4TW3 A;  3HL1 A;  1SQ3 A;  2GYD A;  3PVY B;  1RYT A;  3OGH A;  4REU A;  3EZ0 A;  3E1M A;  3WVW A;  4CMY A;  4TOG A;  1MOJ A;  3BVI A;  2ZG8 X;  4DYY A;  2WLU A;  3NP2 X;  5K52 A;  1KRQ A;  1JI4 A;  1JKV A;  3KX9 A;  4ZKW A;  3IQ1 A;  3A68 A;  2ITB A;  1F33 A;  3PZA A;  4XKS A;  3F37 A;  2W0O A;  4EVC A;  5D8Q A;  2XGW A;  5JDO B;  3KA9 A;  3PVT A;  1JKU A;  1LKO A;  5LG2 A;  3GGZ A;  5D8O A;  4LQV A;  3KA6 A;  5HU6 D;  3PVY A;  3R2O A;  5C6F A;  2OKC A;  4YXJ A;  5JAC A;  3AJP A;  4RC7 B;  3EZU A;  1VLG A;  1TJO A;  5HJH A;  1IES A;  3C23 A;  3L0M A;  3GGY A;  3PW8 C;  4AM5 A;  2Y3Q A;  5JKM A;  1MFR A;  2C2U A;  1LKP A;  3PWQ C;  2CLB A;  2CEI A;  4ZMC A;  2C41 A;  1JI5 A;  2ZA8 A;  2X17 0;  2BKC A;  3AK9 A;  5D8S A;  4MN9 A;  2XJO A;  4LPN A;  1AEW A;  3FRR A;  5JDO A;  2C2F A;  4TOD A;  2ZA7 A;  2C2J A;  4EVB A;  3E1Q A;  2IB0 A;  5JKL G;  3T9J A;  3VVA A;  1HRS A;  2FZF A;  2MGY A;  4A25 A;  2WWX B;  4KVS A;  1UVH A;  4RC7 A;  4LYX A;  3QVD A;  2V2R A;  1DAT A;  3E2C A;  1ZUJ A;  1TKP A;  3O7S A;  1O9I A;  5J8S A;  3SID A;  3R2L A;  4PG0 A;  4DI0 A;  2CHP A;  1J30 A;  3AF7 X;  4TOC A;  3PVR B;  4CYB A;  3AJQ A;  3C21 A;  4RC6 A;  3R2M A;  2AR0 A;  5GOU A;  3NOZ X;  4Y08 A;  3LKD A;  3KWO A;  2XJM A;  4XGS A;  1JYB A;  4TO9 A;  3U90 A;  4DYU A;  3AF8 X;  4CVS A;  2F7N A;  4ML5 A;  4MY7 A;  4RC5 B;  5CMQ A;  2ZUR X;  3QHB A;  4II4 A;  3BKN A;  4R42 A;  1VJX A;  5GN8 B;  3Q4R A;  3PW1 B;  4LYU A;  4LPM A;  2V2N A;  2IY4 A;  3DBY A;  4AM2 A;  1O9R A;  4ITT A;  2Y44 A;  1SOF A;  2ZG7 X;  5ERJ A;  2XKQ A;  2VXX A;  3ISE A;  3FSE A;  3RGD A;  3R2H A;  3PVR A;  3KA8 A;  3WNW A;  4DYX A;  2ZG9 X;  5E2D A;  2V2I A;  1RCI A;  1GWG A;  1OTK A;  5GU1 X;  3D19 A;  5FEJ A;  3TA8 A;  3EGM A;  1VEL A;  3N6O A;  5FFD A;  2VZB A;  5ERK A;  4M32 A;  4U3G A;  5GN8 A;  3E1J A;  4DAS A;  4YXM A;  3AF9 X;  3PW1 A;  2GS4 A;  3IS7 A;  3O7R A;  3AJO A;  4TOF A;  4CVP A;  3PWF A;  4TOE A;  3QHC A;  3RE7 A;  2Z6M A;  5E1U A;  3F32 A;  5J93 A;  3H7G A;  4KXR B;  4LQH A;  3QD8 A;  1B71 A;  4PGK A;  1NF6 A;  2G38 B;  1BCF A;  4CY9 A;  2UX1 A;  1QGH A;  1Z4A A;  2YJK A;  3C1Y A;  4ISM A;  3QB9 A;  1JRE A;  4PG1 A;  4ZKH A;  4ZLW A;  5GU0 X;  5CMR A;  2HTN A;  2V2J A;  4CMY V;  3R2K A;  3QZ3 A;  4W4L B;  3IS8 A;  3UNO A;  2BK6 A;  2G4H A;  4QUW A;  4EVD A;  1VEI A;  1EUM A;  2FL0 A;  2JD6 0;  2V2P A;  3R2S A;  4ZKX A;  1RCE A;  2WLA A;  1JTS A;  3RAV A;  2CN7 A;  1L8H A;  5I4J A;  1NFV A;  3MPS A;  2BJY A;  3F39 A;  2CHI A;  1RCD A;  3C1Z A;  3KHK A;  3BVK A;  5D8P A;  4WJG 4;  1R03 A;  3ES3 A;  1Z6O A;  2QQY A;  4ZL5 A;  5FFB A;  2ZA6 A;  4ZL6 A;  3E1O A;  1YUX A;  4ZTT A;  1UMN A;  2JD8 0;  1H96 A;  5FFA A;  1N1Q A;  3AK8 A;  3F36 A;  3V3K B;  4ITW A;  3VNX A;  4IXK A;  5GU3 X;  4M33 A;  2FJC A;  4LQJ A;  1TK6 A;  5JKL A;  4DYZ A;  3KDQ A;  3F35 A;  1XZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...