2OKCA

Crystal structure of type i restriction enzyme stysji m protein (np_813429.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
424
Chain Sequence
QSLTKKVWNLATTLAGQGIGFTDYITQLTYLLFLKMDAENVEMFGEESAIPTGYQWADLIAFDGLDLVKQYEETLKLLSELDNLIGTIYTKAQNKIDKPVYLKKVITMIDEEQWLIMDGDVKGAIYESILEKNGQDKKSGAGQYFTPRPLIQAMVDCINPQMGETVCDPACGTGGFLLTAYDYMKGQSSKEKRDFLRDKALHGVDNTPLVVTLASMNLYLHGIGTDRSPIVCEDSLEKEPSTLVDVILANPPFGTRPAGSVDINRPDFYVETKNNQLNFLQHMMLMLKTGGRAAVVLPDNVLFEAGAGETIRKRLLQDFNLHTILRLPTGIFYAQGVKANVLFFSKGQPTKEIWFYDYRTDIKHTLATNKLERHHLDDFVSCYNNRVEIYDAENNPQGRWRKYPVDEIIARDKTSLDITWIKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Type I restriction enzyme StySJI M protein (NP_813429.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Transferase
molecule keywords Type I restriction enzyme StySJI M protein
total genus 133
structure length 424
sequence length 425
chains with identical sequence B
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
A PF12161 HsdM_N HsdM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.30 Mainly Alpha Up-down Bundle Ferritin Ferritin 2okcA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2okcA02
2HMYB 1QAQA 2H11A 1Z3CA 5LSAA 3WSTA 4BP3A 3KPVA 3LX6A 1G55A 2GLUA 2HV9A 5BW5A 5F2NA 5HOQA 3HM2A 2ZZMA 5HILA 4B17A 5K0FA 1X1AA 1N2XA 3CVOA 3MCTA 1KIAA 2PWYA 3E8SA 1P39A 2CKDA 2ZBQA 4C06A 1SG9A 2CMGA 3P2IA 4PWYA 4EKIA 2PLWA 2QY6A 3HCFA 3JWJA 4GC5A 4RV9A 2PXCA 1EAMA 3A4TA 3EEYA 2NP7A 1VQ1A 5CVUA 5EMJA 2PT6A 5FA5A 4E70A 1R8YA 2B3TA 3CGGA 4KDCA 1FP1D 2EJTA 3ELDA 1OR8A 4AZWA 3KPJA 1P1CA 2GS9A 5T64A 5KVAA 4HGZA 2K4MA 4WVLA 2WA2A 2G1PA 4YUZA 3AXSA 3C3YA 3ID6C 1ORIA 1YZHA 5EKUA 2OYRA 3TPZA 1QAOA 3G5TA 5LQAA 4RTMA 1FJXA 1KPHA 4KWCA 3E23A 2NXNA 3LCCA 3BKXA 2PKWA 3I53A 5DRTA 4E2YA 1VIDA 4RVGA 1NW3A 2O06A 2OBFA 1AQJA 1KPIA 1NV8A 3B7PA 1RJGA 2EG5A 1IY9A 4DA4A 3GWZA 4GC9A 3GRUA 3PFHA 2IBTA 3T0IA 1ORHA 2ONYA 2P7HA 1VE3A 2EFJA 3LPMA 3REOA 4DM3A 3E05A 5DTMA 3HCAA 2AOTB 1RJDA 1G8AA 3PX3A 3FPEA 3DH0A 5E1BA 5EHIA 5EKXA 5LQKA 1Q0SA 5DTRA 4DZRA 2AOTA 1QYRA 2VP3A 2IP2A 1ZQ9A 3THRA 1JTEA 2XVMA 3P2EA 4QPPA 2P41A 4GOND 2ZZNA 4IV8A 3ME5A 2ZSUA 2A14A 3UJ7A 1NW6A 2JHPA 4OQDA 2IBSA 4PYOA 1KR5A 2YTZA 4QDJA 3SSOA 2GA9A 4M7RA 3G8BA 3LKZA 1RI1A 3HP7A 3KU1A 2I9KA 3ER8A 1U2ZA 3GO4A 4PINA 3BWMA 3MTIA 1JG1A 3MTEA 3M6XA 4JXJA 5G02A 4A6DA 5DM4A 4ER0A 3PLAE 5EC8A 3M6WA 1P1BA 2PJDA 2ONZA 2FYTA 3IEIA 1YB2A 1ZGAA 5U4XA 3G2PA 2BM8A 5GOZA 1O9GA 2Z6AA 2I6GA 3RODA 2EX4A 1WG8A 2ZTHA 5FQOA 3FUWA 4M37A 4KRGA 5GIPE 1JSXA 5K09A 2Z6UA 1O9HA 2WK1A 1EJ0A 2B2CA 3EVZA 4FS8A 3HA3A 1G6Q1 3EVFA 5K01A 3LL7A 4PYIA 5FHRA 4AX8A 2ZCJA 1PRYA 2BM9A 3G2QA 3LHDA 4KW7A 4QTTB 3TMAA 4QDKA 5LQNA 4RTPA 3O7WA 5GIOE 3TRKA 2P3QA 4PIPA 4P7KA 2IH2A 1KP9A 2PVCA 3HA7A 4YUYA 4RTNA 1F38A 4F85A 2OO3A 3KHKA 2OB1A 4PGHA 5CUQA 4CKCA 3B5IA 1O54A 4IKPA 2HWKA 5DWQA 4AZTA 4KIGA 2UYHA 5MHTA 1YFJA 5EMKA 3SM3A 2QYOA 2JHCA 4X61A 5CVVA 1X19A 4PYKA 3O4FA 3GJYA 2H1RA 5E1MA 3H2BA 4K6MA 5D1HA 5K0CA 3A27A 2VZ9A 1TPYA 5DXJA 8MHTA 2VS1A 1G8SA 2AOUB 3GRVA 3NJRA 1IM8A 1EJ6A 1ZKDA 4YUVA 3NTVA 4A6EA 5EIWA 5ICEA 2IGTA 3I9FA 2G72A 5E2AA 3PVCA 3KQVA 5D1NA 4LECA 3TKAA 4MHTA 4U7TB 1BKYA 2XBMA 3P8ZA 4PGGA 3B3FA 3LBYA 1F3LA 3UJAA 2IH4A 5K0BA 2UYQA 1Q0TA 1YZ3A 4QQKA 2IPXA 4GBED 4PYLA 5K0JA 2YX1A 3DXYA 2R6ZA 2QRVA 4ISCA 2XVAA 3P9IA 3M33A 3TKYA 3LCUA 3UJCA 3CKKA 3SSNA 1KYWA 2AOXA 3EVEA 4QVKA 3NDJA 3PX2A 2G8NA 2O05A 1L1EA 5K0GA 2B9EA 1XCJA 4RTSA 3S68A 1BOOA 5CCBA 3D2LA 4RYLA 3GRYA 2Y1WA 1INLA 3HVIA 4F86A 4YV1A 5LR6A 5GP1A 4RTOA 3FRHA 3MAGA 1FP2A 3DMGA 3AWIA 4Y2HA 3GCZA 4GOLD 3I5UA 5FTWA 4POOA 1JG3A 1SKMA 2F8LA 5CVDA 4GF5A 3KQYA 2BR5A 5K8VA 5LQCA 1R6AA 2QE6A 3GU3A 2JG3A 4M38A 5LQJA 4C4AA 5C0OE 3V8VA 1DL5A 5FWAA 4E33A 5CIYA 5DSXA 1NBHA 4EQZA 3LKDA 2AN4A 1M6YA 2PX8A 1I9GA 3HCCA 1UFKA 3KKZA 3P97A 2FHPA 3LCVB 3OPNA 5CCXA 4RTKA 3GRZA 5DT2A 2P35A 3C6MA 3NWEA 4EVIA 2ZWAA 2ZBRA 3P9KA 1N7IA 2YUIA 2PSSA 5FHQA 3CC8A 4R6XA 1EIZA 2ESRA 2JH8A 4G56A 3UZUA 3FPFA 5E9JA 3NVMB 5EG5A 3QOWA 1SQGA 1VP9A 2VDVE 3OZSA 1VBFA 3BGVA 3EMBA 3P9NA 4MWZA 3UA3A 3EEOA 3V97A 5EQJB 3DMHA 5CVEA 1WZNA 3P71T 2AR0A 4Z2YA 3RIEA 5DXAA 5CD1A 3LSTA 3KQQA 4PONA 4WXHA 4AUKA 4DCGA 2ERCA 3G5LA 2DPMA 3BKWA 1XVAA 1MHTA 3Q87B 4RTRA 4PCAA 2XYVA 3UJDA 5BXYA 5BW4A 2Z6QA 2BR4A 4PYQA 5BP7A 3QOXA 2P8JA 1HNNA 2AS0A 3LDUA 4HG2A 3DXZA 5E1DA 2GPYA 4AZVA 3FUTA 4FP9A 4YUWA 3FRIA 4CKBA 5E1OA 3TR6A 3Q7EA 4DQ0A 3JWHA 3IHTA 5EVJA 2PBFA 4ER5A 3R9XB 3HVJA 3PB3A 4OA8A 5EMMA 3UA4A 2PY6A 1AQIA 4P58A 4CTJA 2Y1XA 1RI5A 5HEKA 5T67A 5K05A 2PV0A 2NXJA 2VDWA 3TLJA 2ORED 3HCDA 3KQOA 5EZSA 3SX0A 1ZG3A 3DUWA 4BLVA 5FUBA 3ER9A 2C7OA 4OBXA 2FRXA 4QTUB 1JG4A 4OBWA 1NT2A 1JSZA 1TW2A 1WY7A 4ER3A 2V74B 2N47A 2ZW9A 3EGIA 3OE5A 4YV0A 4RVHA 3AJDA 1NE2A 4O29A 2P1DA 5GWXA 5LQRA 3BGIA 1UIRA 3BWBA 4XUEA 4BP1A 3K0BA 1JR4A 5EEGA 4HH4A 5ERGB 1RJEA 2EJUA 3BUSA 3DXXA 4ATNA 3F4KA 1YF3A 2IDJA 4R8RA 3FPGA 1AF7A 2FK8A 2PT9A 4KVZA 3KQWA 2FCAA 3LDFA 2IIPA 3E7PA 5HIMA 2VDUE 2ZVJA 3G89A 2ZIEA 5DRYA 5EMLA 5DM1A 3G2OA 3HA5A 3P2KA 2JHAA 3SMQA 4OA5A 4F84A 3EGEA 5DSTA 1HMYA 4C03A 4HC4A 1M6EX 4IWNA 5F2OA 5GINE 1X1CA 3PT9A 2PWPA 3MHTA 1QANA 1TW3A 4V0RA 4RWZA 1L3BA 5DX0A 5EGSA 3SVZA 3O31A 5HZMA 1NW7A 4ER6A 2PX5A 4PYNA 2ZULA 5K0LA 3U81A 2H00A 4UOEA 2UYCA 4YMHA 3T7SA 4YV2A 2CWWA 5IKMA 4CKEA 2HR1A 1D2HA 1V39A 4GOOD 4OX9Y 5DM2A 2QRVB 5E8JA 5HIKA 1XTPA 4P7JA 4PIMA 4X63A 1RI3A 3KPYA 4IV0A 5DM0A 4BY9E 3G8AA 3I64A 4RTQA 3HTXA 3FYCA 4BLWA 1BHJA 4DF3A 3CJQA 3BT7A 1SUSA 4LWOA 5FULA 5T6BA 1R00A 3KPUA 1KXZA 1QZZA 2ZWVA 4RVDA 5FQNA 4CXMA 3DOUA 3AY0A 3SXJA 3LGAA 3HVKA 5DX8A 3OCJA 3C6KA 1VPTA 2OB2A 4U7PB 3HCEA 3ANXA 4MQ4A 5GM1A 5C1IA 1KYZA 4X1OA 2OXTA 3X0DA 3ELUA 2YXLA 3C3PA 4KIFA 5KQRA 3NDIA 2BR3A 1NW5A 2G70A 1BC5A 4HTFA 4KDRA 4MIKA 3UJBA 3KR9A 1JQ3A 2PX4A 1I1NA 1N7JA 1WXWA 5EHGA 4PYJA 1XJ5A 2ZLBA 4PYMA 5ICGA 1P91A 3NVKI 3FUVA 2O57A 4E32A 2NXCA 2R3SA 2GAFA 2ZIFA 1SVUA 3MB5A 3THSA 1XCLA 5HIIA 2C7PA 1XDUA 3P9CA 3PFGA 3R24A 5P8WA 5H02A 2HNKA 4FT2A 3UJ8A 4XUDA 1H1DA 5CM2Z 1B42A 3MQ2A 4E31A 5IH3A 3BWYA 4RTLA 2YVLA 4PCLA 1WXXA 1MJFA 1L3IA 1G38A 4QQNA 4C05A 3KQTA 3FTCA 3GRRA 2PXAA 2PXXA 5DLYA 3TFWA 5JR3A 3VYWA 3VC2A 5M5BA 4XCXA 3I58A 4FZVA 5F2KA 2C7RA 4QVGA 4R6WA 1ZHFA 2PGXA 1VP3A 3IV6A 1X1BA 1DUSA 3JWIA 1WS6A 5JUWA 2PX2A 2C7QA 3QV2A 9MHTA 4P7FA 2XYRA 3OU6A 5GM2A 3HEMA 2AN3A 4YUXA 3BWCA 3JWGA 4GQBA 1D2GA 5FCDA 2ZZKA 3B3GA 3DP7A 4GUAA 1R8XA 5E8RA 1VLMA 5B1SA 2IH5A 3B89A 3KR1A 2CL5A 5K0NA 1SUIA 3ELWA 3OZTA 5CVJA 3CBGA 3M70A 1IXKA 3EVCA 3FUXA 2WA1A 3DMFA 2P3OA 1XDSA 2ZIGA 3NW9A 3UJ9A 4EKGA 2I62A 3DLCA 2I7CA 3NWBA 3OFJA 2ADMA 2YQZA 5FADA 3FTEA 3CJRA 2V7EA 4CTKA 1NBIA 2P7IA 3KQMA 3KQPA 4HSGA 4HTFB 4NECA 5LQUA 4QPNA 1VL5A 3KPWA 4FSXA 2OY0A 4HRAA 3M6UA 5E9WA 2DULA 3OU7A 4OQEA 3TOSA 3CCFA 2GB4A 1QAMA 2AVNA 2BH2A 3EVBA 4FGZA 2OKCA 4DKJA 2AN5A 4HGYA 1XDZA 5ICFA 3RW9A 2AVDA 3EGVA 1FBNA 2IDKA 3FUUA 3LBFA 2NYUA 5DTQA 2FPOA 1FPQA 2B78A 3C0KA 3PS9A 4GOMD 3ERCA 4E30A 3M4XA 2KW5A 1M0EA 5KYGA 2YXDA 3GNLA 3BGDA 3MCZA 3DLIA 1R74A 3OE4A 2O0LA 5DX1A 5FWDA 4AZSA 3GIWA 4E2ZA 5EEHA 5KS2A 2NXEA 3TQSA 3DULA 2JJQA 3SSMA 3VSEA 3OU2A 1X1DA 2QM3A 1EQAA 1DCTA 4DCMA 2BZGA 2IFTA 5ICCA 1JG2A 3ELYA 4RX1A 1SQFA 3LECA 4FT4A 3BXOA 3FTFA 3KR0A 3G2MA 4E2WA 1KPGA 2NP6A 4CWAA 4R8SA 2AOUA 3M6VA 4ER7A 4P7GA 5K03A 1JQDA 4ZTBA 5EOVA 2XYQA 3EVGA 2UYOA 1NV9A 3PTAA 2OPBA 2B25A 3TM4A 4X41A 2OZVA 4H0NA 3FYDA 5K0EA 3L8DA 4C04A 3EPPA 3UWPA 2O07A 4BLUA 3LDGA 1I4WA 4GEKA 4RSRA 4RTJA 1L9KA 2HTEA 3FPJA 3UBTA 4Y30A 3NMUF 2Q41A 3UJ6A 5E9QA 3EVAA 2AOWA 1YFLA 3HVHA 2GH1A 5HFJA 4YMGA 3T7RA 1L3CA 3TM5A 3HCBA 1PJZA 3G7UA 4RVFA 1NKVA 1YUBA 4C07A 1RJFA 2YR0A 2FK7A 3FTDA 3AXTA 3R3HA 3IYLW 4C08A 1AV6A 1EG2A 1JQEA 3GGDA 1T43A 5EIFA 7MHTA 2CMHA 3CJTA 4LG1A 4DMGA 1XXLA 4E2XA 3G88A 3GXOA 2ZFUA 4XUCA 1KHHA 1R18A 3SGLA 2P40A 3KQSA 5HIJA 3DR5A 1G60A 1NW8A 3MGGA 2YXEA 4FSDA 10MHA 3GDHA 3KR2A 2NNWB 3OZRA 4M36A 5E2BA 1RI2A 3HNRA 4MTLA 4R05A 3SR4A 3T7TA 3R6TA 1D2CA 3VC1A 3B3JA 3A7DA 4X60A 4L7VA 3FPHA 4V0QA 3UFBA 3A26A 1JTFA 2ZBPA 2AOVA 3EVDA 5C9ZA 1RI4A 3OFKA 3DTNA 1Y8CA 4LWPA 3A25A 2UZ4A 2JH9A 2LD4A 4FR0A 4EK9A 1ZGJA 2E5WA 5FA8A 5KQSA 5EPEA 3FZGA 1UWVA 2AZTA 3R0QA 2G71A 2P3LA 4PNEA 3EMDA 4EMSA 5DPMA 3K6RA 3ORHA 5EZQA 3BZBA 3A7EA 3MERA
chains in the Genus database with same CATH superfamily
1S2ZA 3RVQA 3SMVA 2GCNA 1G8FA 4CY9A 4OYHA 2PUAA 2KE5A 4CTOA 5AKKA 2DKFA 1Z4NA 3KPVA 4IUCS 3UMBA 1AHHA 1J07A 4TWRA 1XNHA 4DS3A 1ZCFA 4QD3A 3ZS9A 1PJ3A 3A6ZA 1N2XA 1I0ZA 4JB0A 2XDQB 4D5GA 4LZAA 5EJ6A 5IDQA 1XZEA 2O2CA 1G59A 2W93A 4R2XA 1E0AA 4HF7A 2V4UA 2HT6A 4JLBA 4X62B 2YKGA 1B00A 1RQLA 2WD7B 5IF9A 2PZAA 1Y5NA 1J33A 4MDFA 4UOQA 1UC5B 4JI0B 2YIMA 3IS3A 3SWWA 1ZGCA 3DTVB 3FGPA 3C21A 2W6IA 3G9TA 2MWMA 3AUXA 1NZFA 4FYVA 1X8XA 3H7GA 2VHWA 1YUMA 1F2TB 3QE3A 1VKNA 4RMHA 4P80A 4U5XA 4WVLA 2JLWA 1N2OA 4ILEA 1QF7A 3MF4A 1SBZA 1X13A 3CLSC 5CIWA 1CS0A 1T1SA 5KNLA 3NTQA 3E3OA 4P81A 4BGDA 3ASZA 5JSZA 5KVSA 3D5EA 5GU2X 3ZCPA 1WP4A 5ECWA 4B31A 5H4HA 3FCUB 4D43A 2XA9A 3F7TA 4E21A 4RPJA 3NOOA 3JZAB 4K9PA 4XB1A 2K7ZA 2E5FA 3AF0A 1I9CA 3PLNA 1REQB 2DT5A 2GM5A 1JREA 2GZ1A 3P5BA 5BSTA 2IS4A 1KZYC 3M83A 4B8WA 1E2MA 2O8EB 2GMWA 1F2DA 4J07A 2GO1A 4E07A 4ZL6A 3RSLA 4J03A 1BMTA 2WZQA 2IHTA 1Z4IA 4ZL5A 3D5QA 4OP1A 2G07A 5LB4A 3QBJA 4EENA 2ODTX 4DIBA 5CDFE 1PZEA 1TUBA 5FO0A 3L18A 3OQ1A 4Q4JB 3GMDA 2PVSA 3HHEA 4X54A 5DOZA 1F5SA 1LTQA 1ULBA 2TYSB 4BB6A 2P41A 3VYUB 4IV8A 3KOUA 4MQ6A 1BH2A 3Q4GA 1XTRA 2QM7A 3HWSA 4UMDA 1RRFA 2CHVA 3SU8A 4XA8A 3VPCA 1G1MA 3OF2A 4KO3S 4Q9AA 1S3IA 5LJLA 3KLOA 3MJEA 3Q98A 4K2HA 1E7SA 5ADHA 4WZZA 2J3EA 3ZNNA 3EEFA 1RM0A 4J4BA 3TVDA 1HWYA 2ZCUA 3SY8A 1OE0A 5U4XA 1EM6A 3FSGD 3HDYA 4MN9A 3T7KA 1ZIYA 3TZKA 2EHJA 2A0XA 3LPNA 1Z9BA 1W4LA 2B6HA 2JEYA 3NWJA 4O08A 3C48A 4QOEA 3V5NA 3WIDA 1QCYA 4IXWA 3E1SA 1F2TA 3AY3A 4MH0R 5ALDA 1KDYA 4FDAA 1H1LB 3GZTB 3MNFA 2QU8A 4HZUB 4XGSA 4I5EA 4KRGA 1YRWA 4OAQA 2WQ6A 3SFVA 3BB4A 2D5BA 2JBAA 4Q4AB 3LUCA 4AX8A 4HQOA 4MV1A 3FYSA 4BGVA 3EASA 4G97A 3AM1A 5G0TA 3HWRA 5A9TA 3E3MA 3FTQA 4DYXA 3OZGA 4R7ZA 3S44A 2X7XA 3FPLA 2BPOA 4PYRA 2AJBA 1PZNA 1LLDA 3A9SA 1CV2A 2UYHA 1KZ7B 5C46F 4UTNA 1T5DX 2WMDA 3GP3A 2OXIA 5JCOC 4M9SA 2BGGA 5CVVA 2IZOA 1BHQ1 2G6BA 4REUA 3ES9A 1L8LA 1N6PA 3GJYA 4K6MA 5D1HA 1DRWA 3DZHA 4A7PA 4EOGA 1DEHA 3DAPA 4F4DA 4PG4A 3ZWXA 5JJCA 3ZV3A 4G8BA 3R2JA 1W34A 4EVEA 1DCMA 5JBNA 2DPHA 1EFRA 3KQVA 3PG5A 4INPA 1G8YA 4LECA 4OQFA 5KI6A 2HMWA 1V9LA 1PK8A 3C8ZA 3H9CA 3P8ZA 2J32A 1QH1A 2X3UA 3BZWA 1EHCA 4CDGA 1QTQA 4IIDA 4YAOA 3HXKA 3L0BA 4YRJA 4E40A 4IICA 4CDMA 5J2UB 3CLHA 3HMQA 4A03A 5HJFA 4E46A 9ABPA 3DJFA 3EZ0A 1Z6YA 2JJ1A 4KSYA 4Y1RA 5F5NA 1G3UA 2VDOB 4NIMA 1PZGA 1TZ2A 2XGGA 4M0CA 3UJCA 2C31A 1YGYA 2J7PD 3OPMA 1E4EB 3FG9A 1A4IA 2FSPA 4UCQA 3WVWA 1GILA 3NDJA 1GG2A 1GAEO 4Z99A 5E3IA 4URXR 1P7ZA 1PD0A 2A7XA 4OGGA 2R47A 1YE5A 2J0EA 3B52X 2HO5A 2XCRB 4JBIA 4BP9A 2BJVA 1QSGA 5T3YA 4MRRA 5ALJA 2V1UA 5FPQA 1XRSB 3IKJA 4A0QA 5BSEA 2CFSA 1MHPA 4ZI7F 5A71A 4AMZA 4II4A 2APJA 4L9RA 1K66A 4MW2A 4U7TB 4NL4H 1WOYA 5D86A 2FE1A 4CFYA 3EDQA 1OT3A 1DVBA 2Y1FA 2XJ9A 2Y71A 2ZI3A 3C7TA 3D6HA 3DZGA 4JEMA 1GUDA 3QH4A 4OMFG 2FN7A 4PX9A 1UMCB 5B7PA 5JFOA 2DHQA 3WL3A 4K2AA 2PH7A 4TROA 1Y34E 4DG9A 2IHUA 5LDGA 1HETA 1W25A 1XZ8A 3AY7A 3MK31 3TW8A 4ALKA 3P97A 1M2EA 4GHWA 3QWBA 4LJ7A 4DCCA 4EDHA 2Y3QA 4GE0A 2JLRA 4JXKA 4PG5A 2QT1A 5AVRA 5K6TA 2VTVA 3ESZA 3BK1A 3TLKA 1L6RA 4PVCA 3CXUA 4QQ8A 3DQQA 4ZVPA 2BMEA 5UKDA 4I6JA 4F4IA 4K87A 4OFWA 4TX1A 3TG2A 4RE5A 4B4OA 5A7GA 2PD3A 4ESOA 1KEKA 2GZHA 3LLUA 2IWRA 1NVGA 3O8OA 3EXIB 1OYYA 1FLAA 2RG7A 3I0ZA 5CVEA 3WGZA 2XGSA 5AVQA 1C0PA 1DEAA 4PAWA 3LY5A 4RVUA 1BEUB 2O2SA 2IE8A 2ERCA 2V2LA 1WNFA 3TIIA 3WHIA 4TTPA 2DPYA 4MDHA 3SYRA 3ZC3A 4MB0A 1I4EB 1Z7WA 3QB9A 4P4GA 1Z17A 3AUFA 3R2MA 1QVAA 5E1DA 5FTJA 2COEA 3F9IA 3A1FA 5E0KB 4RM3A 4KVQA 4CHTA 1G291 5GU1X 3FHLA 1UXJA 1C7IA 2Y27A 2Q6IA 3VGJA 1Y3FE 1ZL2A 2KX7A 1A0OA 3FSRA 4ARVA 1R8SA 4K88A 3ABQB 3DBHB 3TNDA 2W2LD 1AQIA 1SU7A 4TV8F 1V35A 2QMZA 4L6AA 4UEWA 4B76A 4EPRA 1APBA 1RI5A 4Q1FA 2DBVO 1RCEA 3IAEA 3UT5B 1PJAA 4IM7A 2G88A 4P35A 4KZKA 1RRMA 3QVOA 4WNIA 3RJZA 3BVKA 4D3XA 1EBUA 1JXAA 4MZXA 8ATCA 5LOVB 1XPRA 1I4LD 2D2EA 2QRJA 2WIKA 4OBXA 5EPOA 4JI1B 3RAFC 2FRXA 3VPAA 3BDVA 1T25A 2B8EA 2GD0A 4DIMA 3TDMA 4B3SB 4Y9SA 1VMIA 3DWFA 4B79A 3DPSA 1UXIA 1Q3HA 2YS6A 2OWDA 1FLVA 1NVUQ 2F67A 1SBHA 1EU1A 1Y63A 2AB0A 4M88A 4R51A 3IO5A 4QYWA 1JR4A 1C8KA 2V8OA 3UMSA 4DJEC 3FBWA 4ARBA 3EULA 3L7JA 1W2HA 4B3IA 2XB8A 3I04M 3Q8MA 1VBMA 4L4SA 1CEXA 1YWGO 3TOVA 3WDSA 4AW9A 4INAA 1J8YF 1DBIA 1UJ6A 3AC0A 2XHEA 5E6RB 5J2UF 4BNVA 3NDPA 2BSAA 4IJUA 5KYVA 3EXIA 4CPDA 4E0BA 2WJAA 5B7QA 3CH7A 1DIHA 3MLAA 4X3PA 1JB1A 1Q17A 4YALA 3QBVA 5DWDA 3VR5D 1N1DA 3CWQA 4R0VA 5HZMA 5LG2A 1HMPA 1ZJZA 3K2BA 1Z8NA 3PW1A 2ZJ3A 2PX5A 4V2IA 3X3HA 3OQIA 5HJ7A 1DXYA 4BLQA 4E1BA 1L7AA 1FNNA 4CKEA 1S8OA 4LQLA 4PGMA 3CVJA 4GOOD 1YMQA 4ZQEA 1TO1E 5REQA 1W581 1W36C 3PC8C 2XTJA 1QHXA 1SM4A 1PLKA 5DM0A 2B4TO 2NZWA 1S0UA 1FTGA 1NI3A 3NJ4A 4FC7A 4MK4A 5ALFA 1VJRA 5DLPA 3HTXA 3NG1A 3RAVA 1NHGA 2JASA 4YR7A 5KTOA 8ADHA 2CHIA 3KPUA 3TTWA 1CUVA 1PZXA 2RKWA 1TVEA 2QU7A 2VWGA 1L5HA 1FQOA 1ICIA 1JDTA 4QUHA 3U4GA 4D41A 2XUOA 4LCBA 1HNWB 1VPTA 3UCFA 2FPKA 3RS2A 1KYXA 3BH6A 2FPIA 2VP6A 4LIPD 4O2AB 1TL7C 3L1JA 4B3FX 5BWLA 2C04A 2H4HA 4N6GA 2PX4A 2D74A 2ZYAA 3L9XA 4JA2A 4MUFA 2IEAA 3WP1B 4D0LB 3V6LA 4TYWA 1FNBA 1ML3A 1I3NA 1Z8DA 3F78A 1U0RA 2JD2A 3NU1A 3STHA 1DDIA 2FUKA 3DTVD 1GR0A 4TMFA 3THSA 1KOFA 2GK3A 2H1LA 5BR8B 4K0RA 1G5HA 4AECA 3DJYA 3PFGA 3WNBA 1A8IA 2D1SA 1N5JA 2IZ1A 2ZSFA 3TFOA 3COYA 2B4YA 5A1TA 5IT9A 3CH5A 4FTWA 2OE2A 1IRIA 4D9BA 4BAGA 5JI2E 2JL1A 4NPCA 2BFFB 3MD0A 2E89A 3ZR4B 3T99A 4D82A 2NO4A 4S3MA 4EHKA 2OFXA 2NTYC 3FNFA 3LFHA 4XCXA 4G0MA 5EYPA 3PEWA 4R6WA 1MN6A 1G3MA 1XMVA 1TM2A 1WF6A 3WMGA 4EJFA 3V3KA 4LPMA 3BB1A 2VNJA 3JQFC 3S5JA 1DDOA 3WTCA 2ZJ7A 3WHPA 3SI7A 4NMHA 1DPFA 3CT4A 2G09A 3QMVA 4NPHA 2IYTA 5DXFA 3IEXA 1M1NB 5A3VA 1LJLA 2RI0A 1M1ZA 5TJHA 1JALA 4Y2QA 2XHZA 2GYQA 1TYEB 3PPIA 1P2FA 2Z2XA 4R9SA 2LUOA 2CZGA 3WA7A 3NTLA 2GYWA 3GLKA 1Q1NA 3N2YA 5FADA 5KKCA 3UWDA 3QHQA 2II6A 4OHCA 4RKRA 4P5DA 1S4QA 4OI4A 4I8DA 4MLPA 2Q07A 5J63A 2FW7A 4ME6A 5KVVA 2WJJA 1ESNA 3UUGA 2F3TA 3K15A 2R1UA 3DMNA 2ONKA 1BVRA 2CVQA 4GVXA 2GPSA 3X44A 5IZCC 4FVTA 2ORYA 1H69A 1ZD4A 4HWTA 4WUTA 5GADl 2D3TA 4HGYA 1XDZA 1CJCA 4RSMA 4CQNA 1W8DA 3NCTA 2PSFA 4MVJG 4NZOA 4Q1BA 4WW0A 1Z5VA 3IAS1 4H6WA 16PKA 1H8ED 1KO1A 1BEEA 4BU0A 1NSTA 4GPIB 3BMQA 2RHCA 1QP8A 2QRHA 2EX1A 5I4IA 5HMLA 4CG0A 4AZSA 2ZAGA 1P80A 3ROGA 4GSKA 3OCWA 5CRIA 4Q18A 5JTUA 5ITVA 1J0BA 4RY8A 4B0OA 2Z4TA 2NYVA 4RDCA 4HH1A 3A3PA 4DEYA 3RUFA 1SHJA 3HB7A 4JP2A 4Z7OB 1YT5A 2BZGA 2NPFA 2CHPA 4U2GA 3HUDA 5EIEA 3PW1B 1OXMA 4RF4A 4CT0A 1GAXA 3ELYA 4S24A 3WRYC 4BYMA 4W4KB 2AUNA 2XXAA 1SPXA 2POQX 3H99A 2QNRA 4FJ2A 3DMTA 1J2TA 2JVKA 3A9VA 3G2MA 2ZJ6A 2ZS8A 4YRQA 4E2WA 1T5BA 1PGOA 1X38A 2AUTA 3DUFB 3OT1A 1XVLA 4HNAB 1OB2A 3TAUA 4U7HA 1UKAA 2XYQA 4BRWA 4G0OA 3MJ4A 3GGPA 1VPVA 4HAZA 4QICA 3T1QA 4BNYA 1HYHA 3NOZX 1MH9A 1ZGBA 3N2GB 1S02A 3CY6A 3IBGA 3G9ZA 5DW3A 4TRNA 1A8HA 3F73A 4CEHB 2FZWA 4OIMA 4IBOA 4RK5A 3JVIA 4LDJA 3AFHA 2P0YA 1WHTB 3QLUC 2NTEA 2PLFA 3IKMB 5I8WA 5ED0A 4YXMA 1P73A 4MHSA 2J3KA 1EGQA 4QJIA 4LV5B 1BW9B 3SVLA 3NS7A 4BS9A 5ENDA 5F5XA 1Q7GA 2N42A 3U13A 3W5UA 5I51A 1YKGA 1A82A 2CMHA 3P52A 4BNUA 1X86B 3PWQA 1E66A 1VTKA 3MC1A 1GV0A 3CNHA 4FGKA 5EIHA 4AS2A 5B58C 5IULC 3GXOA 3T1TA 2YS7A 3PVRA 5CXUA 2C42A 1RWMA 3Q9UA 3AETA 2ZB2A 1TT7A 1XAGA 4FEEA 4RABA 3AY6A 2GILA 1ZAKA 2IYRA 3MGGA 3UMCA 3IOCA 3A11A 3WZMA 5CITA 3AF4A 4WPGA 3KAKA 2B8WA 4ZOLB 1DO8A 2UZIR 2MMCA 1BD3A 2VPXA 2QJRA 2X6TA 4ZAGA 4A0RA 4HZIA 3U9SA 3FI6A 4Q0MA 3PNSA 2SNIE 4D6PA 1KYVA 3HKCB 3HY3A 4QBGB 3TXXA 5EJIA 3A26A 3C87A 3AUSA 1C0LA 1L4FA 4CM9D 3DZKA 1BDMA 1Z33A 4H08A 1KO5A 4KNYA 2ZPAA 4S1WA 4EK9A 4CV1A 2IP1A 3ZDDA 4OEHA 3I30X 2PUDA 4M35A 1V1RA 2VJLA 3BULA 3RKSA 4CNQA 5E0OA 1TIBA 1BE0A 1UWVA 2ZTMA 1ZN2A 3TZLA 4PGIA 1Q1GA 5EIBC 4AWXA 3ORSA 1ZR4A 3D6NB 3KWLA 1NC3A 4P83A 5EXSA 2BE7A 1DKUA 3N0WA 3GLHA 4CIWA 1FRFS 1PU2A 2A3NA 4XARA 2IZ0A 3BTUA 2XGMA 3A2LA 2Y44A 3KE9A 3I04A 4PPNA 3ZDRA 3NTOA 4B17A 2NZYA 4KXVA 1L1FA 3T3IA 2ZQYA 3EDYA 4ZT4A 5A3QA 1YZTA 3TZHA 1LDEA 1FDOA 3CVXA 4EYEA 3KTDA 1NURA 2FW1A 2I6XA 4HOYA 2BMAA 2EWWA 1KK2A 2G6TA 5KNBH 5LA6A 1PK7A 4GC5A 2BAGA 3TI7A 3HR8A 1U31A 4IXNA 4EUKA 5A5FA 2CLFB 1TIPA 1OGIA 4IKOA 2G0NA 1L9XA 2XRFA 4KQFA 1LLFA 4E70A 4MP6A 1XVTA 3B2QA 2BRUC 3H04A 5LP6B 3KPJA 1WXGA 3OF5A 4HH3C 4UU8A 2J8ZA 1Y89A 2D5CA 3KVYA 3WK9A 5IW8A 1HG0A 4FXOA 3BGOS 4FNAA 4B43A 1G0OA 4CLOB 2ASEA 4MPDA 3IDOA 2XDWA 1JR3A 3HCWA 1KEVA 3AFNA 3I01M 4YVFA 2NWQA 1CVIA 2D7DA 1DWQA 2QGNA 4OB7A 5IEJA 4FYWA 5FBKA 2GVDC 3ADOA 1ZMXA 3OPQA 1GN9A 1YJQA 4RC9A 3SLGA 3WYCA 2QW8A 1K92A 1A95A 1NW3A 2O06A 3NXSA 3U2QA 3E9QA 4F6RB 1JHAA 1TKRA 2PL1A 2HUPA 4GC9A 3E2IA 2ZIAA 2HC9A 3SR3A 5FJJA 1E2IA 2C4VA 4R68A 1D6JA 4NICA 4YXFA 1C8BA 4MQFA 3UQYS 2YVUA 5HWSA 3LVRE 3WMWA 2D5KA 3SJUA 4BNJA 2YWDA 1E3EA 4OHPA 3FVRA 4TS3A 1OU4A 2G8LA 2YIDA 3CNBA 1N3LA 4KMOA 4XE5A 1SVLA 2F3QA 4NCHA 2ZZNA 1UM9B 4G1MB 5KYXA 1M7GA 2PGOA 2X5XA 4O2BB 1NW6A 5A6VA 1F17A 4DPMA 1ADBA 1KR5A 1OXVA 4M7RA 3TE6A 3ZKWB 3W3AH 2FI1A 3PZBA 3EIEA 5U4QA 3UV7A 3NV7A 5KCMA 4KFTA 3TJRA 3OJFA 2QAGA 2RBEA 4TN5A 4XCQA 3ZHOA 2AG1A 2DFLA 1E92A 5ADVA 2NVUA 4RD2A 1IUPA 4BKMA 3ZDFA 4RC6B 4C9BA 4KK3A 3RSOA 4C7MA 3IERA 2J5BA 3FJ1A 4ZI7B 5IXYA 4XIGS 2YC4C 1O5OA 3RODA 4MVJM 1ZA2A 3HSYA 3LP6A 3D1JA 3W5AA 1JEEA 3FUWA 1D4AA 1BFRA 1IPEA 1P61B 4NOLA 4XD7D 4FKMA 4S0ZA 4FFMA 4ZCPA 3ETDA 2XQJA 5DNVA 4RF5A 4I9FA 1W4ZA 2YMPA 2YWJA 4IRUB 3KRTA 4MAFA 4IHKA 1DP4A 3MMNA 1KH3A 4QTXA 4TT3A 5K4AA 4QYMA 3V4RA 1BDHA 2ZCJA 4QTTB 3ZZ1A 5JARA 3T5MA 4FMBB 2RH4A 3D4BA 1NF6A 1A7JA 1F38A 3SC3A 3TRIA 1D3AA 3UNXA 2PYIA 1TM4E 1THZA 3CX3A 1XP5A 1WW2A 2IXFA 5HCNA 5DK4A 3RFVA 3WLTA 1FUIA 2G38B 1HT2E 1XFDA 2WVAA 1Z6TA 4PYKA 2PQ2A 2PUGA 1V6AA 2Y2UA 5LB2A 2FUCA 3I09A 2VTKA 3WGMA 2VZ9A 4NBKA 5D85A 4L0CA 4B83A 1NUUA 2DPXA 1MR3F 2MYUA 4B2LA 4WNYA 4P92A 5EGNA 5H83A 4BQRA 4DPLA 4YHHB 2QTMA 3OH8A 2G72A 3JQBA 4KU4A 3PVCA 4N49A 1SHLA 1VMDA 2FV8A 4FILA 3ZHUA 3PWFA 2IP4A 3HDTA 3LBYA 3JRXA 4TTSA 1KZHA 1X74A 3TPFA 3QPBA 2YJ3A 1NXTA 3LUAA 1T9KA 3T9EA 4ENWA 1B73A 1DAIA 1KF0A 4Y2UA 1F6WA 2BFMA 3N0TA 5AWFC 4DWJA 4YY3B 3KFXA 3L79A 4IDFA 1EEXB 4F2HA 1POWA 3LCUA 1RYMA 3CZPA 1CQXA 3JYOA 1L4MA 2YZ7A 4PZAA 5KYYB 1AQLA 1JKVA 4IIUA 5I9NA 2FETA 4G1CA 5JNUA 3PX2A 2C61A 3V2IA 2VOEA 3W1EA 3D7SA 4KFSA 4NDAA 4TSKA 1HR0B 4LYDA 3EFEA 5KDDA 1TTHA 1NVEA 3KTFA 3KWOA 1H42A 2PS0A 4JR1A 3ZE9A 5I3ZA 4IV5A 3SE1A 1KSHA 4F72A 1MG0A 4M32A 1EP1B 3PHCA 4GYKA 4TW3A 1BXKA 1HDEA 2DQSA 4HS4A 4BKUA 1VLGA 2WV9A 1TUEA 1BQ3A 1CCWA 4NAUA 4U00A 5B30A 1S8FA 1KDOA 1ULUA 3UPUA 4GMGA 4M1SA 4X1YA 1T5HX 2HNBA 3QYAA 4GF5A 2BR5A 5G4LA 2GXSA 4FOOA 1I94B 1U5AA 3CLTD 4Q4JA 3QKSA 2JG3A 1J22A 4N9WA 2EV9A 3W7VA 3EZFA 4K9OA 5CIYA 2OL4A 3N07A 2Y1GA 5ANRB 2PGNA 3GFPA 2N02A 1JLKA 3HCCA 1KYYA 1LQ2A 2XMZA 2W6PA 3KKZA 2HRBA 4J0HA 4M1QA 4YO8A 5JAOA 3EZLA 3COPA 2XITA 1RNLA 4E5YA 4XVCA 3MJRA 4KGXA 1O5TA 4FD3A 2A1UB 2R8PA 2PSSA 2YUIA 3JVDA 3NBYC 3MPSA 2VDWB 4G6ZA 1UC4B 3BE6A 2QX6A 3DHNA 1VPDA 1HA3A 3BN3A 3FFXA 3TEJA 1M5RA 1NAIA 4UXHA 2IYPA 5FUYA 5SY9A 3AF9X 1U3TA 4FMDF 1H2YA 4M1ZA 2QTWB 1G7TA 1YZGA 3NAZA 1VP9A 4HQNA 4PLZA 2UU9B 3PXDA 3D0QA 4OXXA 1GUAA 4TTJA 5KMGA 1WA5A 1ZY2A 4FONA 4URUR 1V16B 5IABA 3P71T 1A5ZA 3AM4A 4JNCA 3C45A 4U2FA 3FMFA 3QEMB 3WLOA 5C5DA 4DCGA 1E3DA 1KJ8A 3Q87B 4RTRA 3IMGA 1PSWA 4LHEA 1ETHA 1JAIA 4BZWA 4K3UA 2IIQA 4BLOA 4JI5B 3ZDXB 2WSSA 3QOXA 2P8JA 1G8MA 3OJCA 2VHYA 5ESXA 4TUYA 2QLFA 3EIFA 3QFTA 2LCIA 4YMIA 3TR6A 3OIWA 3W79A 1G98A 3ZE0B 3W9BA 3DFKA 3EIXA 5JH7F 1UXGA 4AKEA 1BE8A 2A4KA 2ATVA 5ALZA 3K0EA 2IOFA 2WYIA 4YLYA 4Q9DA 4AY4A 4XDGA 4JJ7A 1QO0A 1NNI1 4ITWA 4X85A 3KT6A 3PVZA 4CYAA 3KX2A 3B9RA 4LWQA 3NBQA 3GWGA 4MYTA 3AVOA 1DFIA 5DK6A 1KZ6A 1WVGA 2HU8A 3I12A 3IQIX 5LLSA 4AROA 3B8HA 1UMBB 1I3OA 4DLPA 3R2RA 2QMQA 1Y9EA 2FQXA 3A37A 3JWEA 4ZO8A 1W85B 1T8UA 1EXMA 2E9SA 4DOMA 2OLKA 3MBOA 4WHMA 1DG1G 2BP7B 5DW0A 4AJJA 5F64A 4M0KA 4JEHA 1MAAA 3OA2A 2CLLB 3EXAA 4F4UA 1XPUA 1ZD8A 1V8FA 1GTZA 1M1NA 1NASA 2VPTA 3HBNA 5BSGA 1Y33E 3A6EA 3R75A 1B8PA 3TTVA 1VLQA 1JHPA 2WMYA 1FUYB 2IIPA 1A8UA 1HI9A 4OOFA 4C6RA 4KSCA 5LP6C 2XY4A 2DR2A 5HJEA 5DSTA 1LKOA 5LG8A 1K88A 2OD2A 2W8ZA 3QKRA 4IGFA 2NV6A 3O31A 4RFSB 1VJTA 4ER6A 4QBIA 4A2WA 1D6SA 4AJ9A 3OBBA 2NLOA 4Y2RA 5DBOA 3QXGA 2R79A 1SBQA 1O58A 3PGKA 2CV0A 4GXRA 3VKVA 1R6DA 1BU5A 1UZUA 1XRMA 1BX3A 3GL9A 4RH3A 4X90A 5D8DA 3VR5H 4UPEA 2Q8QA 1SC1A 4YH1A 5EZ6B 3IVCA 4NTZA 4BGEA 3T06B 2C20A 5BPHA 3T3NA 1VGRA 2AC2A 3DYVA 5DMHA 3L7DA 5G3ZA 2GHTA 3NRJA 1TO6A 3T38A 3FWPA 3VTZA 3S8YA 2TMDA 4O02B 4ML5A 4RVDA 1SUBA 3NGLA 2DE0X 2PUCA 4YREA 1OUMA 4JIMA 1YJBA 3PJRA 2FJCA 3T5GA 3W8NA 1GADO 4DWOA 1YK1A 3ANXA 5LP6F 2QSZA 3KZNA 4L74A 2BGUA 3P27A 1KZ1A 2H1IA 3EW9A 3HSKA 4J0CA 5AW3A 3B38A 1Z26A 2RHOA 1E6LA 3QHCA 2J6BA 3KB6A 4LK3A 4QDTA 4CDRA 4ZJYA 2ZA8A 1MG5A 3HLTA 3I39X 1UZNA 5G40A 3ZWAA 3I5YA 4X93A 5KWSA 2A8YA 3NTXA 3AUUA 3T1NA 2AZ4A 4DBVO 2GAFA 4A15A 2PK3A 3EIUA 3NHRA 3W4IA 5DYTA 3AYZB 3MG9A 5B2FA 3QWAA 2N1BA 4EF6A 3VR4A 5IXJA 1T4BA 3BSWA 4RTLA 3FHTA 1KO4A 3RS7A 3BWYA 4MP3A 1E18A 3FVVA 1QB7A 2HQSA 4CF4A 1AMOA 3FKSA 4DWVA 1JEAA 2XNJA 5D7NA 4MQ5A 1ZH0A 3I58A 5DLDA 1N5DA 1HQKA 2ZB3A 4A8PA 1VCMA 3KJFA 3PF9A 4N40A 4JBWA 3KZCA 3IV6A 4DARA 4KXNA 2I7DA 2WU4A 3WBKA 1N34B 2FPXA 1E3MA 4H27A 4MPJA 4FJ1A 1BN7A 1NVTA 1RM3A 3UHAA 5A0VA 2J9YB 2PJUA 4GQBA 2ERYA 2W2KB 2QF9A 1FSPA 4LRQA 4TPKA 5H8WA 4BNFA 4GUAA 2UVDA 1W9MA 1WUJS 1NVXQ 5EWJB 1Y8ZA 4C21A 4X1KA 3IXMA 1XU4A 2GEJA 3L92A 4XW2A 3ROEA 1IEQA 4MYDA 5K3DA 4AJ4A 4DG5A 3PDCA 1G20B 1TJOA 4KDFA 2WRZA 3GOHA 2G04A 5F9MA 3IXQA 1E5XA 1TAHA 1RKVA 3A4MA 7ADHA 2F55A 2QI9C 2I62A 2WFMA 2X2EA 1U2TA 3JQ7B 3O91A 4LKOA 2PVPA 1HH4A 4C0XA 3KD2A 3H5RA 3MT8A 3KQPA 3HC7A 4C43A 4ZJZA 3CMCO 5H7XA 3ZWYA 3GUHA 4YX9A 3U6KA 2OP0A 1RZVA 1YA4A 4PZYA 3M3DA 5FWYA 5JE8A 5IX8A 1HORA 4L75A 2TSYB 3KDPA 4INZA 3T7JA 4Y6GB 1KMIY 1MX1A 2C9OA 4ETNA 1J7KA 3EVBA 1L8XA 2FX5A 1Z28A 3BFVA 3V3KB 2PIDA 1THMA 2XQIA 1M2OA 3BCSA 3CF0A 5FFEA 1ODKA 2XUFA 3B6EA 3KT8A 3MWEA 4YAGA 3KZKA 2YV5A 4FFBA 1LQUA 3FFTA 1FP7A 3EPLA 2XB6A 1AEWA 3BGDA 3K72B 1JLMA 3PC3A 3RS5A 4CV0A 3VZQA 3RANA 2WG0A 1XF9A 1XTZA 3FMVA 4UNPA 4EVSA 1X9GA 4FNOA 1PG2A 4YP6A 5JJLA 2NV2B 2GCEA 2QYHA 3AGQA 1X1DA 3ZWDA 4BFZA 3OTQA 1MJ5A 3RU2A 2E18A 4TMZA 1PVOA 2J07A 4LVNA 1G18A 4YMWA 4G4IA 4R01A 3PW8A 3G6KA 4CMJA 4NXNB 4WNAB 3DKPA 3R2SA 1P3Y1 3TLGB 1QE0A 3QUQA 1QHEA 1QOQB 1SD5A 3Q0EA 4P7GA 5EMNA 1OFIA 1ZUHA 5B12A 4RYDA 2Q4RA 4LJLA 3GROA 3USZA 3OZXA 3IRUA 1C9NA 1GZVA 1QBGA 2ZVPX 4MV5A 1JSRA 1Z2DA 4TVKA 3T12A 4M2LA 1X80B 5IFLA 5JPDA 4XRRA 3BA6A 3DHEA 3VR4H 1SXQA 3L8DA 3TNJA 4QC2A 2A86A 3JY6A 1S7GA 3E9NA 4I3GA 421PA 2GEFA 1U5BA 2RBKA 4LRUA 1C3JA 4K9MA 3FPJA 4KRXA 2GBPA 3ZE1B 3SQWA 3BXPA 5EERA 5KOIA 3HA2A 3E3NA 3ZW8A 2V5AA 2JARA 3FXAA 3IPRA 4LXYA 4N8SA 4NK4A 3TSAA 3V1YA 4H1UA 1W88B 3SHXA 1SHZA 1Q7RA 1QV6A 2NQTA 5HDBB 2E3JA 2W2QA 3QTLA 4J6EA 2IZ7A 4HNRA 1GG5A 3R3HA 3EGMA 2NT3A 3EFBA 7MHTA 5A7HA 3R2LA 1QONA 1EX7A 5JAIA 2F2TA 1IQUA 2DC1A 2OK8A 5JYCA 1LSUA 4OQPA 3OE1A 1E9BA 1EVJA 2WWWA 1SG6A 1G5PA 4AF8A 4HZGA 1QF6A 2BIFA 3CTMA 4NJOA 3QI7A 4XGKA 3KQHA 4LI3X 2J09A 2HXYA 4J0IA 2Z1NA 4MLZA 1O6CA 2C3UA 2QVLA 1PL8A 3BC1A 3GDHA 2VSNA 2ZSKA 1TZBA 4JU8A 4XYGA 3URMA 4DCSA 1RI2A 4J8PA 1CC1S 4R05A 1UBLS 3DBLA 3JQ9A 4RMGA 3R6TA 2X0FA 3T7TA 2XOKA 4IDQA 4M1KA 3NUGA 1SKAA 1KJWA 2JATA 1GWGA 3A36A 3K20A 4W6ZA 4PZCA 4BPRA 1YK0A 2JRCA 2ZRGA 3B7GA 3DT8A 4PR3A 4E08A 4C0BA 1H5NA 1VPLA 3PRHA 4CQMD 5C9ZA 4CM3A 1TGVA 2OZPA 3B8EA 1ZVJA 5M04A 1E9EA 3H5NA 3A25A 3KKQA 1K7CA 1NXVA 2CNBA 2NUTB 1MPTA 4Q34A 2VAPA 4DDWA 3H16A 1UK9A 2CMFA 1YB4A 4B73A 1X7YA 5KYUB 1ODCA 2AZTA 2FEPA 3GX1A 2R7MA 5I01A 2JK0A 6NULA 4GR9A 1A9QA 3A7EA 2HR5A 4FQ7A 5B3JA 1G6KA 5CPFA 1H1TA 1D2RA 3KJGA 5EZYB 5KTTA 4UBMA 4AI6A 3JTEA 4FINA 2FHSA 4FUQA 4J3NA 3K0KA 4ZDJA 3LY8A 3LRTA 1KIAA 1CRLA 1AXRA 1AVTA 1VG1A 1JHYA 3WL6A 5JSZB 5A4DA 1JEDA 2OOSA 4Z7JA 2IU3A 2PLWA 1FDUA 4UDYX 2PXCA 3THYB 1BYIA 1M0SA 1DS6A 1YZNA 1ZVQA 2QLLA 1ID8A 5FA5A 4I6GA 3SZOA 1ZWLA 2EJTA 4K26A 1QIKA 3FVBA 1PT7A 1F8FA 1I6WA 2E21A 3HO6A 3FMPB 3IDFA 1W87A 1J24A 1Y1LA 5I7OA 4FM9A 2WA2A 2G1PA 1UUFA 3UW1A 5J5VA 1UQRA 3OP1A 3QHBA 1PFGA 3G8CA 4IINA 2QEQA 4OXKA 3AL0C 1I2AA 4QDZA 2WTBA 2WD7A 4M0UA 4QSMA 1JA9A 4CVPA 4C4ZA 4QJ5A 3KJHA 4MW1A 3RAGA 3OC0A 1JBEA 1XZCA 4HFRA 2NXNA 5C1DA 2HLPA 4Q9IA 5K0TA 1I33A 3VR6D 3UF0A 2B69A 1P7CA 4JHXA 1AQ6A 3C3AA 3DNPA 2W0MA 1L7DA 4KXWA 3ZKWA 2Q9BA 2J67A 2Z2YA 4G5FA 4MQEB 4CLRA 1XAIA 4DA4A 3TZQA 5H70A 1LPOA 3ZJYA 2CBXA 4HMOA 2YYSA 3BVEA 2GCPA 2GD6A 4HXFB 5DCWA 4DM3A 3LK6A 3UAOA 1ZJWA 4S2EA 1RJDA 2I2XB 5GONB 3O0DA 3BVLA 3CRNA 3II6X 1EVIA 4Z4EA 1NXSA 2X22A 5DTRA 3D7LA 3R76A 4DZRA 2JFGA 1E58A 4X6YA 5EKTA 4WESB 1SGWA 1PLLA 5HKBA 1ODSA 2XVMA 1KSGA 3RC7A 1U0NA 5C80A 3ECCA 3KEGA 5D00A 1P6QA 3OTHA 2ZSUA 2Z83A 3WI7A 3F46A 2R8YA 4PGAA 1U1EA 1X80A 4QDJA 3WQBA 2GA9A 1U04A 4TS4A 5AK6A 3LKZA 1IC6A 121PA 2Z43A 4ZRNA 4Q6WA 3EZYA 2NYRA 2BOVA 3M6XA 2JGJA 5EC8A 4YJFB 1AO0A 4I1SA 4BLSA 5KU7A 3DVAA 2BELA 4ZVRA 4BMVA 1KXJA 4YGXB 4I50F 4B9EA 4M60A 1XXHB 3F34A 2R62A 2YHBA 3IVRA 4KUHA 1G2OA 1WG8A 2JJ8A 5TB5A 4U2EA 1L5LA 2MOKA 3A06A 5C5EA 4PANA 2V58A 4H1VA 3UJ3X 2IU4A 2JIRA 3AFIA 4NNPA 5HF6A 5HPYB 3WK6A 3LM8A 4GBMA 1Q95A 4BMYA 1Z5WA 3TZ6A 2PSDA 4QU9A 3QVLA 4TL7A 4P4UA 4DQUA 2F4VB 3UK7A 3ZCXA 1TIKA 2IH2A 1AH2A 2V45A 5BN4A 4U02A 3QVDA 3NDRA 2GZAA 2Z2JA 4IFEA 4PVDA 4UEKA 1HF3A 5KYWA 3HB9A 1HV8A 2BM1A 2PBRA 3MJSA 1OB5A 3NHJA 4IMIB 4GI7A 4R5HA 2ZXUA 1X19A 4KQ2A 3G9XA 4ZQGA 2I54A 2O2YA 1NF9A 4R3NA 1GTMA 1NOJA 2WUGA 5KTKA 4DA8A 2H5EA 1U0HC 3IAXA 3G0HA 2CWLA 4OGLA 4BEVA 1EFUA 4W8GA 3KJXA 2XCLA 4QZVA 1J0DA 2AOUB 2R6FA 3X1MA 2VQ3A 1KI6B 2D5AA 4ZWNA 3AR7A 4CI9A 4R8VA 3K2IA 4G41A 3ADDA 3NOQA 1WKCA 1ORDA 3BIWA 1E1NA 4UJ3A 3S7TA 2INGX 2UYQA 4NP6A 3WIOA 2RGNC 2BT4A 2Y05A 3VSAA 1FFCA 3LI2A 4GBED 3GW8A 4CN8A 3PGVA 3WK4A 2OGSA 3K5PA 1ATIA 3VU3A 3EBPA 3GLVA 3MINA 4YYZA 2C4KA 1FVHA 1H94A 2B1IA 3FUCA 1P4HA 1YR9A 3JD2A 4HB4A 3J81A 2PUTA 4HAOA 1QPZA 2QTBA 4WZBE 3DMYA 5J4LA 1P1JA 3EXG1 3F5QA 3U39A 2JVJA 4BUCA 4DJDC 4EY5A 5KKNB 1HE3A 1NONA 3PEFA 4C5CA 8AT1A 2H0QA 2ETXA 2NGRA 3IXLA 3NAQA 4QASA 3BXEA 1ZS3A 1BOOA 4DWWA 3I72A 2BRUA 1GTL1 1KYQA 3GRYA 3HS3A 5EQFA 1H4QA 2BFCB 3A6KA 1J9ZA 1V5FA 2HWXA 4LKRA 1RYYA 2G7ZA 4PNPA 3DVQX 4HDAA 5DI3B 4D5EA 4W5RA 1NY5A 1CUJA 1OYOA 2OHVA 2C41A 2GERA 3FZEA 1T2NA 5DEOA 4WOBA 3WGHA 3P1JA 3I5UA 4JYCA 9GPBA 3DLHA 2LWIA 2PKRA 3MIIA 3EF0A 4R2HA 4WBNA 2PZJA 2QD2A 3H0KA 5AI0A 1VPEA 3FCXA 1DAOA 3NORA 5EP2A 1D0VA 4R71A 2IY8A 3O1HB 2I29A 4CVSA 3L7OA 2XIJA 5C0OE 3EVNA 1LGYA 3HWX1 5F35A 1GFWA 3KV1A 1N0UA 2AK3A 2FHPA 4KQ6A 1O87A 4DJAA 4XIIA 4RTKA 5JKMG 1YKFA 2BEWA 4FQ5A 4IILA 4N82A 2EWVA 2P35A 3GFQA 2BJWA 3MS4A 1LV7A 5E1UA 3KZMA 4LVUA 4ZEXA 4BN5A 3PUIA 4IWKA 2COKA 3VM6A 3VI3B 5B3KA 2OGZA 2HDHA 3Q7RA 4LRTB 1PR4A 4Q93A 4YQYA 3RBXA 5JC1A 4J29A 4MKUA 4O1MA 2XDAA 3EOAI 1KZ9A 1LSSA 3KKLA 4B3DA 1F8XA 1B2RA 2ZSAA 3THOA 2WHPA 1O1YA 3K8ZA 3KOWA 3OOSA 2O2JA 3TLCA 3MTBA 3T5BA 1H2AS 1U0SY 1USGA 2W2PA 5CLGA 2AA3A 2VZBA 1RQ7A 8LDHA 1YBVA 1JDUA 3TGWA 3ZDEA 4Z51A 2QLNA 4CV3A 5JH7B 1MTZA 1O97C 1S7CA 2XYVA 5BXYA 5K6AA 3EIQA 5C37A 1SKQA 2V7BA 4BNWA 5IG2A 3GUZA 2YASA 2BR4A 4KDEA 2HCFA 5EQDA 1VPWA 1NN0A 4TRMA 3ICEA 2NO9A 3BAFA 3O74A 5ELXA 3W90A 3FNEA 2EZ4A 3MZ0A 1A76A 5CFZA 1W0KD 4QGAA 5BQFA 1WU8A 2H1VA 3BERA 1YA8A 3K1YA 3DOOA 4L8FA 2PANA 2REXB 4AJ2A 2H4XA 2ZYDA 3BREA 3V4SA 2DQKA 3NPAA 1IFXA 2QPAA 2DR3A 2H2AA 3DUWA 4XQEA 3QA9A 2UUCB 4MRMB 4EA8A 1DQNA 3AFGA 1YNSA 4IMRA 1AKYA 3T41A 2FLWA 1IU9A 1NT2A 3LBNA 1PKEA 2YN4A 4KI7A 2V74B 4PXSA 1XMSA 4E7OA 2QUZA 2VXIA 3RFFA 4BNLA 1EVKA 1ZU5A 3E4CA 4WSOA 3FH0A 3G17A 1ZI8A 4HVAA 1KVRA 2H5IA 4XDHA 2IDMA 1AIPA 4FPXA 3VU0A 1AT1A 1BWSA 1RABA 2GXAA 4QA9A 4DTIA 5JZOA 4QJBA 3BCRA 5FRDA 1G41A 2OCPA 4QXRA 3NIFB 2PWAA 1WV1A 3WBJA 4F5YA 2VDUE 4QRHA 2I4OA 5ES3A 5DYYA 2ACVA 3F35A 4G26A 1AKUA 1SA0A 1WMSA 5JAQA 1SXIA 1N2SA 1NMEA 3GG2A 4YN3A 2A0FA 4ZPXA 1D2MA 4HDKB 3EQ2A 3BFKA 4C3ZA 3K0CA 2QV0A 2ECKA 1XTVA 4QXAA 4ZCMA 2OFWA 4UOEA 3OQOA 3T7SA 2Z8ZA 3ITEA 2I99A 1Z0SA 2QTFA 1UXHA 1NVFA 2ZREA 1TEXA 3Q5EA 2QQ5A 4J6FA 2V2IA 4TUYB 1PW7A 5HIKA 1WMFA 1NU6A 3H5OA 2Z6MA 4JY7A 3TK1A 4YT8A 3BQ9A 3QKWA 1Q11A 1Z6PA 3K35A 3BT7A 4LE0A 2O1EA 5FULA 3TKLA 4JI2B 4BX0A 2ZRJA 3N8KA 3QYJA 4DSTA 2A5DA 3BS4A 4CF5A 4N6NA 4ZKDA 1CLEA 3VH4A 1JIUA 2YVAA 3FVQA 5BV8A 3HCEA 3AJAA 5C2JB 1P1KA 2VNSA 4AN0A 3VHRA 1E6WA 3RUDA 3LS2A 5B6IA 2PRYA 2YBEA 1QRUA 2H1CA 2VTEA 4JJ6A 1LBSA 2QAJA 4OQ4A 3GE4A 1KH1A 4L16A 3C3PA 4G5YA 4HXYA 2F00A 4Y7CA 4AO8A 2BJHA 3ZY3A 4LZLA 4ASUD 4X65B 3TLGA 4YFVA 3SBEA 3VYRB 3VUFA 1HQCA 4F1KA 2AMFA 1A9ZA 1QR6A 4UXJA 3K9WA 1TA9A 3VZBA 4DABA 2E55A 3GF4A 1RHJA 3KXIA 3A05A 5ALXA 1H1DA 2FN3A 1U2PA 4I4TB 3RNOA 4DAOA 2DUNA 4CFSA 1JLHA 5IJ0A 4CFZA 1V8OA 1DBSA 1KIMA 3L43A 5HKLA 4YDRA 1UT6A 2OHOA 5DI3A 3QY0A 4HEQA 1I0LA 5F2KA 4LF4B 1LKMA 2ZJ0A 2CUKA 1NVVR 1RZUA 1RCCA 4GGMX 2OAP1 1GPH1 4PSAA 1GNSA 1JKUA 1RW4A 4QPCA 4UXIA 3ECSA 5JUWA 4MYUA 3PPWA 2VQEB 4W1SA 2X6QA 4MUHA 4UBKA 4URVR 5CGZA 3ABZA 4NU5A 5HK9A 1QDLB 3EEQA 5BSKA 3JYPA 3INYA 4JT8A 1TQHA 3RNLA 2OBYA 1Q20A 4JSTA 3WNQA 3IH5A 3FNBA 2OYSA 2V7QA 1KDPA 2VJDA 3AR3A 3V2GA 1DOZA 2L2QA 5CA0F 4FGJA 1H2HA 1E0KA 1I30A 2O9JA 4LCJA 2WPDD 3FUXA 3CG4A 2DP4E 3QG1A 4KWIA 1R4ZA 4QULA 3FM9A 1RWWA 1RHKA 3U48A 4E12A 3M5CA 2P4QA 3OFJA 3ANYB 2FR1A 2CXXA 3VZRA 4NCNA 3REFA 4EFDA 4XR9A 3ETNA 3U62A 3DFMA 4KN5A 4N41A 3S29A 3X1WA 3VR2A 3L8GA 4IQ0A 5AW0A 5BORA 1ZZGA 2HBQA 4D92A 1KP2A 1NP6A 2HJSA 5M34A 4ZDIA 3PYMA 2C83A 5BMVA 2IHBA 3U9LA 1GZ4A 5GONF 1N5LA 1ZI9A 4RGBA 2FW6A 3NHSA 5B7GA 2GK7A 4C6TA 1C9JA 1KORA 1RRVA 2BONA 5E4FA 2CJXA 3ZU2A 4V0KA 4PIVA 1SKBA 2C2YA 2IDKA 3K0CC 1KU6A 2YHUA 4TQ9A 4BO0A 2JA1A 1EH5A 5L7TA 3CVWA 1CZOA 1JE0A 4P3PA 1XZ3A 1SURA 4XDYA 1M0EA 4NFLA 3QPWA 1J1IA 1V41E 4LDPA 1IRXA 4UBLA 2HU7A 4TV9F 3CURA 5EEHA 1VL8A 3TW0A 2GZRA 4ZJPA 4ARUA 1XT6A 4GP9A 3A1TA 1P9LA 3FOWA 3LSYA 5JZSA 2C2ZA 2UUAB 5AM0A 2W00A 3DZDA 4IL5A 4ON9A 4Q47A 5CFRA 1JLSA 5JSHA 2R6R1 2RBGA 3KA8A 4TOFA 2Q28A 2DB3A 3FCSB 1KJ9A 5F51A 4XKSA 4ZVUA 1MZVA 1SBYA 2FP3A 3T52A 821PA 5ADUS 3KB8A 1D9XA 2IZ6A 2BDUA 1NUSA 2HMUA 4S05A 4JB3A 5CB8A 3AF5A 3PQEA 4ISPA 2PKXA 1JYSA 1Y3BE 3G2LA 4IIXA 5DO9A 3ZY4A 4RC8A 2BSQA 1TQDA 2C2FA 1A3CA 1DRJA 4GKAA 3RGGA 4OH1A 5CYFA 1I4WA 1XMXA 1II0A 2FFJA 5H0IA 2YW7A 3MWGA 1QGED 1QTRA 1XJCA 2QZPA 1MO4A 3U6BA 3HRHA 1DWOA 1R5OA 3MA0A 4IYRA 3TLZA 4OHXA 3X43A 4YAKA 2WKPA 1PJZA 2IOYA 2PZMA 2ITBA 1VE6A 3E7XA 1TJ4A 1VKJA 3KEOA 1EG2A 5EIFA 2V65A 2G1AA 1RTTA 4HQKA 2A0YA 4UEQA 4G1FA 2R1TA 3THWB 4HCJA 1E5DA 2Q3FA 2ZFUA 3OTGA 2OCIA 2X0DA 3U7HB 2HJRA 3C1AA 7REQB 1F14A 5JFGA 2RIPA 2P40A 3WYAA 1MVLA 4L2IB 3S1AA 1Q1QA 1WZUA 2BDEA 4B32A 4EG7A 3A04A 3BXGA 5DMXA 3RREA 3QV1A 3OKFA 5FWXA 3FYTA 3ZQKA 3RRNA 3ISJA 4ZPJA 2Q50A 1YNOA 2C8JA 1ZJ6A 2XNHA 3EXEA 3ZNOA 1OFUA 4UOZA 1K8YB 3B2EA 2WIJA 3A9UA 3PDIA 1TK9A 2QTNA 4B8YA 5F3DA 2GBGA 2VUSA 3NHFA 3BRWA 2O3QA 2M6RA 4MP8A 3THYA 5KSPA 4IF4A 2BUBA 3C3DA 2EIHA 3LJKA 4DEVA 4L4YA 5AW7A 5BSUA 1DTSA 4UAUA 3RBZA 4BV2A 4PG7A 4YJDA 1E8NA 4XWTA 4B85A 5KQSA 1E7QA 3GT7A 4II4B 5CGQB 3FWKA 5L6LB 3DKVA 4Z4IA 3U4DA 2P65A 2YJ4A 2NNLD 2WF6A 1U2GC 3A3NA 2P2LA 2HMYB 3MERA 1KI9A 4HJRA 1D6NA 4Q4LA 1X1RA 4W99A 4DC0A 1RE1A 3PC8A 3WSTA 2BM0A 3VHLB 4DHEA 1GPNA 1CQJB 2HV9A 3IIJA 3QXHA 4ZA2A 1TPZA 3RIYA 1U6JA 1WXDA 2PFSA 1T4CA 2G25A 3DV2A 5K0FA 1ULZA 1FFBA 2RGXA 4MCIA 4CCAA 2J7KA 2IYSA 3L4JA 1MX9A 2PKCA 2WJ4A 2VK4A 3PE3A 3THXB 2YIVX 3JWJA 1DU4A 3LMKA 2O4CA 3OCUA 1E7YA 5FPPA 5E7JA 1A50B 4HH0A 1FMLA 2WD9A 1SNYA 4XIFA 4PSUA 3K1TA 3ELDA 5HCIA 1P1CA 1KR2A 1RWXA 4J2OA 3SDZA 1D4FA 3TL2A 1DNPA 1Z0DA 2IYOA 2MYTA 2XWPA 3L7BA 1I1HA 4X94A 2R2AA 4LRWA 2XQFA 2EGGA 1BRMA 5LQAA 2R6JA 4JYAB 3VKWA 3ZCRA 3K0AA 2H4FA 2NSLA 4NCIA 4Q9JA 3C1YA 1J2RA 2QL5A 3SXUB 4C7XA 2PKWA 1UBOS 3SYLA 3A9QA 2Q8NA 1VIDA 1SXGA 4LOHA 2NVOA 4QUJA 3UFXB 1IN5A 1RTKA 4HWSA 4MWTA 4MRVA 4JBHA 4MEBA 3B7PA 3O9VA 2DQZA 5CFQA 3UMJA 3RVNA 1KO8A 3V32A 2CBGA 4EGAA 4A92A 4W5JA 4D56A 5LMZA 1JFVA 2F48A 4EARA 3REOA 4DN6A 2O14A 1SUEA 2V6JA 4ZYTA 3PLRA 2ZR0A 4RKQA 1ES9A 1U9ZA 5EKXA 2PLRA 1QO9A 5JDIA 2LV8A 3JVUA 1QGDA 4MV7A 2FH5B 3IAUA 2E2WA 4ALIA 1ABFA 3CIOA 1EZ1A 5IJ9A 4LXIA 4MULA 3ME5A 1BRTA 1L8QA 1KC3A 4IG4A 4MUJA 5BQ5A 3VX4A 4B4DA 1RAFA 2YNMA 3O7MA 5I8ZA 3WLSA 2JCBA 4DGSA 3FWHA 3Q3GE 3W78A 2I9KA 3Q11A 1YJXA 4NBUA 3S2YA 4IVRA 4DBZA 3GG9A 1KYTA 3L8ZA 3OKCA 4PF1A 3A1DA 3LQ4A 4BEBA 2ABWA 4R2JA 1ZP6A 1P1BA 3REQB 2ZJZA 4OQNA 1P5HA 1RP1A 3OSZA 3R5TA 1ZMTA 3E5MA 4JOSA 1NBMA 2ZSIA 5EKDA 4ZAYA 5CB0A 1Z6XA 2VPIA 3NT2A 4PICA 1WHSB 1QB8A 3DEIA 3U7GA 3R7DA 2BFDB 4C6HA 4MS3A 5I4JA 2RK3A 3OHSX 2PL5A 2QVXX 4YJGA 3MN1A 1THGA 2NZUG 1OVGA 1Q83A 1RIFA 4KSBA 1IERA 1HYGA 2QENA 2BBTA 3GZNB 3FFAA 3EZNA 3G1TA 5E6SA 1OX5A 4K9KA 4DUYB 1L0BA 3ISTA 5THQA 1E2KA 5CLFA 4CL0A 4PWZA 4PYIA 3GVYA 4D4IA 1RWNA 2D2FA 1OLUA 1Q0RA 3A1CA 3B1YA 4DQKA 3ESBA 1QG6A 4EVQA 1TXGA 1AUXA 3K0HA 4P7KA 2IPOA 2REOA 1KMHA 4ZKWA 4HBGA 4MQFB 1NVMB 1ZM4A 1GQSA 2HWKA 1R66A 2UVPA 4JASB 4BX3A 2PZFA 1H0HA 1G8HA 1MF7A 4LVOA 2ZYSA 1W47A 4FLMA 5FFFA 4O4LF 2G80A 3GMTA 3ZW7A 5AKLA 5EMHA 3IURA 1AO3A 1S5PA 1S3FA 2C1EA 3NV9A 2DOKA 4OJKA 4QU8A 3BPSA 2H48A 2IXDA 3QSGA 1A9PA 1T1IA 2PR7A 5F78A 1DXOA 1G4UR 1Q14A 1TT5A 4AXXA 2X9VA 3K70C 1AK9A 2XAAA 2O7QA 4G9BA 2EJCA 2SBTA 1L5HB 1GFSA 3TEMA 3QNWA 2IGTA 2OHJA 4KVFA 1I0IA 4G0XA 4YXWD 4MHTA 3Q4OA 1BCRB 4PGGA 1F3LA 1RCFA 4J7UA 1UQTA 1Q0TA 3HMKA 1YZ3A 2XECA 2JLZA 4LF8B 3VO9A 1SCUB 2Y92A 1HL3A 4GSYA 1M6VA 4JL6A 3PNKA 2LNDA 4XKJA 1PJBA 5IBQA 3SP1A 4C7KA 4W1QA 2JBAB 2V54A 4L76A 2PL9A 3DSRA 1PVDA 3E9MA 4Q4AA 2G7MC 3C43A 4Y6RA 5TX7A 3VOTA 1KQGA 4MEJA 3UWOA 5CNIA 3F3YA 3AT1A 2PRJA 1YTLA 3KJEA 3GV0A 4PXYA 1SRQA 1BA2A 2BCEA 3IEVA 3KUDA 4V02A 5IMSA 4JI8B 3WQQA 4HLNA 1XZPA 1FDSA 1LXCA 1TTPB 2JFFA 3IP6A 5CM9C 4ITVA 5F4ZA 2B9EA 3U61B 1ZS9A 1YS9A 4CEJB 3NTUA 1T91A 2WHQA 4H59A 5K53A 2HTFA 4RTOA 4MGIR 2C5BA 4O2RA 4NF2A 5GP1A 4QATA 3MAGA 1J2UA 3WV5A 4GX0A 2O0MA 2VATA 1MO2A 5CEFA 1GZHB 2B2NA 4GLBA 5JALA 2W6NA 4AQYB 2FZKA 3ILHA 4MRPA 1NJ5A 2JJ1D 5LQSA 1IK6A 4J1TC 1YB1A 4HQRA 1TYDE 5G1NA 4EM6A 2PDAA 1SKMA 1H05A 2F8LA 2X4DA 3PT5A 1OX4A 2EOAA 4RFLA 1CZRA 2Z2KA 4OY3A 2FLVA 3TO5A 1AZSC 2BBWA 2EW8A 1X8LA 3AG5A 1EGAA 1FL9A 3GDFA 2EFGA 4A6XA 1C0IA 3A8TA 5BV0A 2BBSA 5L3VA 1P4AA 2PX3A 2WPNA 3PQ7A 3LKDA 4Q4HA 2QT0A 3IKVA 3D3WB 4KVGA 5E95A 3LCVB 4MJXA 3ROFA 2PE5A 4OHZA 5CCXA 4W8OA 2CXOA 3MRXA 2OHIA 3EHDA 4LJRA 1OFGA 1Y5IA 4QUAA 5LA6F 3ICQB 1RQNA 2M1XA 2Y0PA 3EBLA 2ESRA 4G56A 4NZYA 5LUBA 2Q5QA 3EUFA 3N74A 3I8XA 5E9JA 3GJ6A 4HMQA 1SQGA 3CTPA 3CO0S 1KMNA 1AGPA 1MIOA 1MORA 3FRJA 4I66A 4IDAA 4AAYA 2P9JA 2Z4SA 2L42A 4PLCA 4YPVA 1EP9A 6ABPA 2BVNA 2YZGA 5AI4A 3U40A 1OBFO 1POXA 3OEEA 5H80A 3ZJ4A 2IYQA 1LDNA 1LDGA 4ZQBA 4K46A 4GXQA 1MHTA 2FGKA 4JBLA 1WMBA 1RRKA 4GZLA 5AOAA 5BOVA 1AKVA 1YUNA 4PSKA 5GV7A 3IIIA 4PRLA 4A5SA 2ZM6B 1HT1E 1TKPA 2VNHA 1VFPA 1GARA 1DG9A 3TIGA 1V16A 4PQEA 3P32A 2R5WA 2CBZA 3I4LA 4EABA 5KTPA 1DIBA 2IEZA 2Z08A 3KV3O 4ICIA 2W58A 4H7JA 1FS4A 1WB9A 1HZZA 4F2DA 3W3AD 3TQOA 3CX8A 5ADWA 5JS8A 1OJLA 4JROA 2ZS7A 3TUIC 1CVLA 2AI1A 2DG2A 1WVMA 3ZWKA 4O8ZA 3H3FA 5CYGA 1F30A 1KARA 3LOPA 1G21B 1CIPA 4K86A 4Y2JA 4BQOA 3AW9A 4CMEC 1EXDA 1VHDA 1ST2A 5JIBA 1ZO8A 3A2MA 3PNQA 3CE6A 3ZDZB 2XZLA 1A5AB 3NIGB 1JAZA 4AKTA 5CB6A 3D7KA 1YV1A 2QN2A 2AG5A 2BFAA 1P4JA 2P2DA 3D4IA 1LUAA 2C4UA 3NNDA 5NLLA 4N7JA 3QVWA 3PQFA 2DQ4A 4LDZA 5DP1A 5GJCA 4E4YA 3OOJA 4K9NA 2VJKA 4QM7A 5AXAA 2BMVA 3KALA 3NM6B 5EJAA 5B1IA 4TKMA 3U1BA 5JSQA 2EXXA 1EUQA 3VPGA 4U3JB 3BEDA 4GMDA 2QMYA 1MENA 3IILA 4FE3A 1NN1A 2RJ3A 4LOJA 2AZDA 4EGCB 2PT9A 3JX9A 4QKQA 2BJYA 2ZDQA 5AXDA 3MM4A 1E94E 5IKEA 1Z62A 3OESA 4XEUA 1QHHB 5EMLA 5BUSA 2ZAOA 3HA5A 2JIPA 4L22A 5E3JA 3HEBA 1JSLA 1TF5A 4G5OA 4AFNA 1WXHA 1ENPA 1W6UA 2H2HA 2V6GA 2C94A 1T2EA 4WNAA 3ZU5A 4B5KA 2C5EA 3DONA 3GPIA 1IY8A 4RJKA 2Z09A 4ZOAA 1JQ5A 3C7AA 2DKOA 4QEZA 4MGEA 5C7OO 4EJ2A 1P2TA 3FYUC 1J21A 3Q9LA 2GKSA 3IOYA 3EPHA 1EFTA 2V8UA 1M2KA 3GAMA 1D2HA 3OLWA 4A26A 2QPLA 4LJSA 2ZJ1A 1U7TA 3QJGA 3QLJA 4I50B 1PUJA 3E9EA 3CLTC 1YZYA 3PGLA 4P7JA 4PIMA 2QAGC 4IV0A 4BY9E 4BB5A 1II9A 1Z36A 2DFNA 3MRVA 5FNVF 4X6LA 4CEIB 5TSDA 3ENKA 3RHSA 3I42A 3KOZA 3F33A 1WCYA 4LF6B 1C80A 1R00A 3E58A 1RQGA 2REQB 3GFOA 3WIVA 5AQ1A 2B2XA 4RK6A 2P4UA 1DRUA 5DX8A 3LCMA 4TSFD 2GZDA 1T1RA 2HK7A 2ODBA 4XVRA 4BLRA 4MQ4A 3RB8A 3X0DA 4QOJA 4W7SA 1W2GA 4FIZA 2QL7A 3P7MA 2O52A 4UE2A 1FNMA 3G7SA 4BNMA 1SXJA 2Q0QA 2PJZA 1SBTA 4HTFA 2A5JA 4G5XA 1Z06A 1WXWA 5EHGA 1H0SA 2HA3A 3NYRA 2ZLBA 5DYNA 3UAZA 1IBKB 2FDCA 2O2DA 4FZ3A 4F38A 2CFIA 3D3NA 4NCXA 3T94A 2AWOA 3I6MA 5E4YA 2W70A 1QNFA 3NHMA 5JOQA 1JAXA 1SUCA 1XDUA 2OP1A 4WDQA 2RGRA 2C2OA 1CDZA 1WCIB 1F06A 1YBHA 4IOKA 1Y1QA 4K9RA 4I7EA 4IHQA 5K5EA 1M2WA 1B42A 1FYWA 3KYBA 1PDOA 3D7RA 5AM4A 2XD4A 3KKEA 1CR4A 5EXTA 4ZANA 1QRTA 4OIFA 2B4AA 1XTBA 4HSEA 1WCV1 5BSFA 4CM7A 3V00A 3GRRA 1KS2A 1S2NA 4R9RA 3JZMA 2OKGA 1X7WA 2C7RA 3DMTC 4ZI7A 2Q4BA 2GK4A 2VRCA 2W6JA 2WQZA 3D9QX 3DMRA 3HH8A 3MAAC 3QF4B 3ZVRA 4C20A 1FJXA 1O9BA 2BHNA 1E0SA 4O25A 3NGMA 1E2GA 2XYRA 1ANKA 3HEMA 1Z82A 4G0NA 4MW5A 4P31A 5CXQA 1DELA 4CVNA 4DV3B 2ZZKA 3RIXA 1Q50A 2X8WA 2AYYA 3DP7A 3QLVA 2IOFK 3D8BA 3LV8A 4GMXA 4MQLA 2QQFA 2Z2ZA 3LL4A 3OLYA 4D42A 2NMVA 4RK0A 3ISFA 1ISFA 1QV9A 4HLDA 3I6ZA 4O2BA 4BQFA 2WLSA 3ELWA 4B1FA 3BAZA 4RS4A 1DO0A 5JDIC 1L5FA 4ALJA 4RELA 5CTAA 1UBMS 3MJDA 1ZRNA 1SK9A 1MP0A 1SCUA 2YJZA 2OFFA 2YJJA 2HMVA 3HI4A 1JPNA 4JT9A 3TDNA 4ZK6A 2HK9A 3N86A 2ADMA 3GUYA 2AKYA 1RM4A 2X8LA 2G9RA 1EFKA 4MITA 5ILQA 3IO3A 3NAGA 5AW2A 3ZH2A 2YHSA 4KAFA 2X5OA 1HM5A 2XEXA 1XA4A 5F7OA 1GP2A 2IKSA 2ZSDA 3O26A 4HDRB 2DULA 3OU7A 1JIIA 1E0JA 3D6TB 4FYPA 4Y2GA 3ZD7A 4LX8A 5DIFA 1QTIA 1NBAA 3B51X 1FLNA 3DE3X 2N75A 2OGWA 2V0GA 2GZ3A 4IXKA 3EGVA 2OG2A 4CIVA 4F2GA 3X2FA 5IT0A 2IITA 2DSNA 2W2VA 3SHTA 4H15A 4ZFNA 3ERCA 1ZK0A 4UREA 1U0JA 2LTAA 3ZDQA 2XRZA 3KHSA 1WD7A 4UCFA 4QG3A 2I6SA 2VC2B 4ZZ0A 3R2KA 3UXEA 2NXEA 4IOJA 3TSZA 4V0LA 1JP7A 3W8FA 1B4DA 2Y99A 3C7DB 4M9RA 4JB2A 3C3KA 1AZWA 3ROXA 3SHWA 3P4XA 2GPTA 2A2ZA 5K7SA 2R87A 2CLIB 4X6UA 1S2GA 2J5QA 1BNCA 3GT0A 3F39A 2IYEA 3GT3A 3L06A 2OHHA 2R00C 4FT4A 1Y6QA 4K8OA 1QC5A 1PJ4A 1K06A 5FT9A 2CUTA 5ESRA 1XQXA 2KPOA 4P38A 4CWAA 2WVHA 5K03A 3UAXA 4I08A 1KSJA 4IDCA 2NSHA 5EOVA 4MARA 5LKRA 3A3KA 3L1HA 3QHPA 3UYKA 3ZXUB 4QREA 4BO2A 3P2JA 5EJEA 5LXTB 3ZLJA 1U8FO 4MVJI 4R9VA 1HXHA 4ENTA 4BTLA 2SECE 1T5SA 3W2FA 3ZK9A 1ZLYA 1PEKE 2GKGA 2BI8A 4RZ3A 1YS1X 2C2BA 5IKPA 4L08A 2V55B 4ZYUA 4OKSA 3A1EA 4JIGA 4AUMA 3OUZA 5BN3B 4OK6A 3JQAB 5JWHA 2XUHA 2G17A 4RC7A 1PDVA 3WVUA 1WV0A 4C0KA 4DKXA 1JLRA 1GOTA 1TJ3A 2C2WA 4J90A 1BMFD 3HEAA 4TGLA 2Q3LA 3HYRA 3JD3A 3TTUA 4DYVA 1BGXT 3DDZX 5KEIA 4NHOA 3N7TA 4MQMA 4X20B 1TVKA 4XWGA 3OFSA 3WGKA 4UHDA 5A03A 3VDNB 4LISA 5AOCA 2PMKA 1X1TA 4HDKA 4MYCA 4ARZB 1WNTA 1F0KA 1UJBA 4RC6A 4EYKA 5D3QA 4LBWA 4JOQA 1P2SA 2BW1A 4TWJA 2UZ1A 1VRVA 4FSDA 2HXSA 5EUCA 5JHGB 3H11A 3AJQA 1FMJA 4KUGA 2JIOA 1DC6A 4O4IB 5HTOA 3IE2A 2XGJA 4X44A 2JS7A 1T9HA 4JLNA 1XTTA 3AZOA 4X60A 3DNMA 1N2HA 5HE8A 5J9VA 1AV7A 1Z2PX 4LSGA 3W4JA 4NVRA 4XM2A 3RWMB 5JS7A 3QUBA 1X94A 3KXKA 1E20A 4DJ5X 4FR0A 1R9GA 4DA7A 1XZKA 1SJ9A 2NPOA 4NZNA 4R2IA 3G3EA 3HBJA 4LC0A 4IMJB 4LZPA 3K70B 1GR1A 2P3LA 3R3VA 5LXTA 3LXXA 2DSTA 5JRZA 3D6UA 1SB9A 1NYRA 3FDIA 4UVHA 2TMKA 3RBCA 3K05A 3W9SA 4OX9B 2O5EA 2WVJA 4HL6A 4UZEA 2Z5RA 3EQZA 1QUEA 2VO1A 1UFVA 1G5IA 2R6DA 3HM2A 4I55A 4LV8B 2Q5OA 4TWAA 1X7HA 3FX2A 3RC2A 5D01A 5T41A 4QJ3A 3V4OA 5G41A 1HYBA 3RI3A 1Y3HA 2J3DA 1AKRA 3P2IA 3DBRA 4LYGA 1D04A 1JFSA 1NQTA 1R0KA 3SJBA 2B9VA 1TAUA 4QOIA 5C8ZA 1L5QA 5LD2B 3GYGA 1HTWA 2IEGA 5DHPA 2C97A 4TLDA 2CXUA 1IBSA 1G8JA 2XVXA 3RHFA 1YQEA 4EB0A 1SH7A 5AXBA 3DBLB 2WJ6A 3DOEA 2A7QA 3ND9A 4OM7A 1W19A 3N3BC 5LPNA 1DJLA 4KBYA 1YQWA 4IR7A 4TM8A 5AFSA 2O2XA 4OHKA 3DEZA 3KE8A 1CYEA 3ND5A 4OM8A 3TUZC 1AJEA 3HYTA 4LJ4A 1UMDB 2OVFA 2I91A 1G4AE 2JGDB 3QF7A 4MR9A 1O08A 2YWEA 4RY2A 3LBAA 2DXIA 1U8CB 4KXLA 4WEOA 4ITUA 1T0JB 2W2TA 2C57A 4XM1A 4ZIRA 1BDIA 2RI6A 3QLEA 4OI1A 4UTVA 3O7SA 2QRPA 1AGXA 1U3GA 4EJSB 4I4LA 1BO6A 4EEXA 1LQTA 1ORTA 1WLYA 3E05A 3O4HA 5EHIA 5KSOA 1XRNA 1GD1O 1M2JA 1Y6GA 4HFNA 1K6JA 5K3EA 1LI7A 4WN3A 2A58A 3RT7A 2B21A 3L49A 2B1JA 4MICA 2JIMA 4RH1A 3U56A 1XMOB 4DL9A 5GVSA 5D8YA 1ZOPA 1XHFA 1T15A 4DIOA 4MZDA 2J0QA 2VP2A 4UTXA 4A2CA 4IGIA 3KLBA 4Y7DA 3KD3A 2I4NA 2GUGA 1C2YA 1OX6A 1UBTS 3HI6A 2NN3C 4YRRA 3PLAE 2XE7A 4Z9FA 3Q40A 2QMEA 2AT1A 2X4GA 4OHBA 1YJAA 5JCJD 4FDUA 3O4VA 5D8OA 3RUIA 1FXWF 1PT6A 3HKBB 4EMTA 1KTIA 4DT1B 3UH0A 1C9YA 3UK1A 1ODJA 1P5FA 1O0SA 2W6JD 1GTJ1 2FR0A 2HF8A 4L6CA 4MVJF 5PGMA 1W0JA 1Y37A 2ZBVA 3RSCA 2G36A 3K09C 2HA2A 3PUHA 4G09A 3TAHA 1IMJA 3DNFA 3NP7A 3ISEA 2EX0A 3UVEA 4DV7B 3LL7A 1U2EA 4GUDA 5EHZA 4O4JF 2RGYA 5LQNA 4RTPA 4Q3LA 3WFIA 1CKEA 3A6PC 2C59A 2P3QA 4FMPA 2O4UX 4KQ9A 4NU0A 4RKFA 4RTNA 1PV4A 1PFQA 4IP0A 5CUQA 3T1HB 2YN0A 3CKYA 5BQPA 4C4SA 1QUFA 3KVOA 2BWJA 1VC2A 2JFXA 4D80A 1RWOA 1CR1A 1XPOA 4Z54A 4M55A 1RVV1 2PRKA 2OMEA 4KITB 3GFFA 2A1TR 1J06A 1KJZA