2OKCA

Crystal structure of type i restriction enzyme stysji m protein (np_813429.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
424
Chain Sequence
QSLTKKVWNLATTLAGQGIGFTDYITQLTYLLFLKMDAENVEMFGEESAIPTGYQWADLIAFDGLDLVKQYEETLKLLSELDNLIGTIYTKAQNKIDKPVYLKKVITMIDEEQWLIMDGDVKGAIYESILEKNGQDKKSGAGQYFTPRPLIQAMVDCINPQMGETVCDPACGTGGFLLTAYDYMKGQSSKEKRDFLRDKALHGVDNTPLVVTLASMNLYLHGIGTDRSPIVCEDSLEKEPSTLVDVILANPPFGTRPAGSVDINRPDFYVETKNNQLNFLQHMMLMLKTGGRAAVVLPDNVLFEAGAGETIRKRLLQDFNLHTILRLPTGIFYAQGVKANVLFFSKGQPTKEIWFYDYRTDIKHTLATNKLERHHLDDFVSCYNNRVEIYDAENNPQGRWRKYPVDEIIARDKTSLDITWIKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type I restriction enzyme StySJI M protein
publication title Crystal structure of Type I restriction enzyme StySJI M protein (NP_813429.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Transferase
total genus 133
structure length 424
sequence length 425
chains with identical sequence B
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
A PF12161 HsdM_N HsdM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.30 Mainly Alpha Up-down Bundle Ferritin Ferritin 2okcA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2okcA02
3FUVA 3JWHA 2NP6A 4WVLA 2QM3A 4KVZA 1QYRA 1X19A 2CWWA 1RJEA 2K4MA 2HTEA 2H1RA 3DLIA 4GEKA 4X63A 1BKYA 3DMFA 3KHKA 2VZ9A 3QOXA 1EJ0A 1WY7A 5K0JA 1M6YA 2Q41A 3GNLA 2ZWAA 3HA5A 4U7PB 1D2HA 3MHTA 4RTOA 3UJDA 2IBSA 2IDJA 3KR0A 5ICEA 2V74B 3AJDA 5EPEA 2O0LA 3MGGA 4AUKA 4C08A 2I6GA 4IV0A 5K0LA 1G60A 2G72A 5IH3A 4E2WA 5K03A 2PT6A 3HCBA 3R24A 5GP1A 3UZUA 3IHTA 2WK1A 2QE6A 4GOLD 3C3PA 2YUIA 4X1OA 4GUAA 1P91A 2VDUE 2NXJA 5DLYA 1XCJA 3JWGA 3MTEA 3AXSA 5DX8A 2P40A 1NKVA 2FK8A 2Y1WA 3KQWA 5DXJA 1L3IA 5F2OA 1DCTA 2OKCA 3BGVA 3DULA 1VLMA 5C9ZA 2ZZKA 1ORIA 5KVAA 1NW8A 3G2QA 3G88A 4PIMA 3KKZA 3NW9A 4LECA 1HNNA 3R3HA 4C4AA 3JWIA 3EVAA 2VDWA 4HG2A 5CD1A 4EK9A 3DOUA 2ZBRA 4HGYA 3AY0A 2PX2A 4PYKA 3GDHA 4DMGA 2YXLA 2P35A 1P1CA 3TRKA 2GPYA 3EGIA 3FRIA 5DRTA 3TQSA 4BLUA 4C04A 4YV0A 1SUIA 4C05A 3LECA 1FP1D 1V39A 2OBFA 2I62A 3BXOA 3GU3A 3R6TA 5D1HA 3VC1A 2I9KA 1HMYA 2UYQA 3QOWA 3KPJA 4OQEA 4P58A 2B2CA 5DWQA 4YUVA 5EVJA 1SUSA 1WXWA 2ZLBA 2O07A 1P39A 3FUXA 5FQOA 4DF3A 1VBFA 1NW6A 4R6XA 3CVOA 3KR2A 3SMQA 4PYJA 3CBGA 4FR0A 1QAMA 3AXTA 2OYRA 5C1IA 3U81A 4HSGA 1QAQA 3FTFA 3HVKA 4ER5A 2OZVA 2YXEA 4MTLA 3ANXA 2GS9A 1I9GA 3GRUA 5DRYA 8MHTA 1VPTA 2JG3A 2BZGA 2FYTA 3SX0A 2JJQA 2EG5A 4ER7A 2Y1XA 3FPHA 3GWZA 3LSTA 1XXLA 3OU6A 3EVZA 5CVJA 3A26A 2PWYA 3V8VA 5DM2A 1RJDA 3UBTA 1YZ3A 4O29A 3MCTA 3Q7EA 5EHIA 3DUWA 1I1NA 1NT2A 2NXEA 3TFWA 1VIDA 1MJFA 1VP9A 1XDSA 2H11A 3GRVA 4KIFA 5ICCA 5HZMA 3P9IA 5BW4A 4EKGA 3DMGA 3GO4A 1L3CA 5FTWA 5K8VA 1KP9A 3BWBA 2XYVA 2ZFUA 4MIKA 3OPNA 1B42A 4YMGA 5BP7A 1KIAA 2AOUB 2ZZMA 4PGGA 5EMMA 5K0EA 3LKZA 5BW5A 5HIKA 3KQQA 2JH9A 4M38A 3FPGA 2C7RA 2P7HA 5HIIA 2BR3A 3LBYA 4POOA 4YUXA 2GH1A 3K0BA 1O9HA 4AZTA 5LR6A 5LQKA 2P3LA 2FK7A 1BC5A 3A4TA 3FUUA 4RX1A 5EQJB 1AV6A 2PSSA 4R05A 5E2BA 4RV9A 2G70A 4RTRA 4R8RA 4PIPA 4NECA 5BXYA 4DA4A 1ZKDA 1MHTA 3DXZA 2BH2A 1U2ZA 5F2NA 2XBMA 3UJBA 4LG1A 3KPYA 2IP2A 4Y30A 4GOND 4UOEA 2UYHA 1FPQA 2HV9A 3NVMB 4RVGA 10MHA 1JTFA 1XTPA 1NE2A 2DPMA 1JR4A 3EMDA 5KS2A 3FUWA 5P8WA 3KQMA 5EMJA 1R74A 1XCLA 2OO3A 2QYOA 3LL7A 2PX8A 2PY6A 5EOVA 3DP7A 4AZVA 4A6EA 3HCCA 5EMKA 5F2KA 3PX3A 3RODA 1X1CA 3HCAA 5EIWA 5GOZA 3S68A 3I58A 4MWZA 4WXHA 3SSOA 3M4XA 4ER3A 1N7IA 3UJ6A 3R0QA 2KW5A 3AWIA 4LWOA 1JQEA 1JG3A 4C06A 4YUYA 2I7CA 1WG8A 4FT4A 2IH4A 3LDFA 4JXJA 3ELUA 5FADA 2G1PA 3G5TA 2ESRA 3MCZA 3KPUA 1WZNA 3O4FA 4FGZA 3UJ8A 3LDUA 1EG2A 2YTZA 3KPWA 2GAFA 5E1MA 3BGDA 3E05A 4GC9A 4RVHA 4RTPA 4QVKA 3DTNA 3BWCA 2EX4A 4M36A 1TPYA 4KRGA 3BUSA 4RVDA 3BWYA 3VYWA 1KYWA 3LCVB 3OE4A 5EZQA 2BR5A 3G8AA 3ERCA 5CVDA 3UA3A 3SM3A 4AZSA 3CKKA 4QTTB 2GA9A 5EKUA 3A27A 3GRZA 2AS0A 2ORED 4EMSA 2ZIGA 1QANA 1UIRA 3DLCA 4M37A 4E70A 2ZCJA 1UWVA 3VC2A 3TM4A 4X41A 3D2LA 1VL5A 3LGAA 2ZBQA 1KPGA 3LHDA 2XYQA 1IY9A 2IDKA 4B17A 3O7WA 1P1BA 3DR5A 1WS6A 3M6UA 4FZVA 3T7RA 4DM3A 2Z6AA 4ATNA 1L1EA 2P1DA 3M33A 5ERGB 4CKBA 2NXCA 3ELWA 2C7QA 2FCAA 2YVLA 3MAGA 4XCXA 1EIZA 2IGTA 2AN4A 5HIMA 2CMGA 1JG1A 3PS9A 5E1DA 5HOQA 1R8YA 5T67A 1KR5A 4F86A 3KQSA 3G2OA 3NWEA 2AVDA 4QTUB 3LBFA 3NJRA 4QDJA 2YQZA 3I9FA 2F8LA 1EAMA 4PCLA 1AF7A 2ONZA 3M6VA 3H2BA 1NW3A 3EVGA 4EVIA 5MHTA 5EKXA 2JHCA 3EEOA 5HILA 3B3FA 1PJZA 4F84A 2NNWB 2BM9A 4KWCA 2QRVA 2EJTA 1D2GA 4PYLA 1Z3CA 4DCGA 4XUDA 5GIOE 3FTCA 3HCDA 4RTKA 4E2YA 3ER8A 4RVFA 3KPVA 3UFBA 3OZSA 4GOMD 3V97A 2G8NA 4GQBA 3TKYA 4PNEA 3FPFA 3HP7A 3DMHA 3EMBA 4CTJA 1H1DA 3F4KA 5DPMA 1G8SA 4DCMA 5FA8A 2NYUA 1WXXA 3NWBA 3C6KA 3OCJA 4HTFA 4DZRA 5CCXA 1JSZA 3KR1A 4E2ZA 4QDKA 3NVKI 4MHTA 3BWMA 1JQ3A 3GJYA 1JG4A 3THSA 3NDJA 5C0OE 1RJFA 3IEIA 4IWNA 2UZ4A 4E33A 4P7FA 4U7TB 5DSXA 2P41A 3P71T 1ZGJA 3SGLA 1KHHA 3ME5A 3PLAE 2WA1A 3HVIA 3REOA 4YUWA 2ZTHA 3C6MA 3HA7A 3K6RA 5EC8A 3P8ZA 3FTDA 2IH5A 3HEMA 4HC4A 1JTEA 3EVBA 4AX8A 4C07A 3G89A 4QQKA 3UJAA 3LX6A 2ONYA 2P3QA 2O06A 1F38A 3FRHA 2UYCA 3I64A 2EJUA 3E8SA 3ELYA 3PVCA 4ISCA 4V0RA 1BOOA 4X61A 3CC8A 5U4XA 4E32A 3EVDA 3M70A 1OR8A 2IIPA 2AVNA 1RI4A 2ADMA 2H00A 4RTLA 5FCDA 2A14A 4GF5A 5KYGA 5CVVA 2PBFA 1R18A 3BKXA 1YF3A 5EG5A 1TW2A 4EQZA 1IM8A 5T6BA 3ID6C 3DXYA 2PX5A 2ZULA 2OB1A 3OFKA 1JSXA 2E5WA 2QY6A 3WSTA 2OXTA 2ZSUA 3GRRA 2PWPA 2FPOA 3LCUA 4IV8A 2OB2A 5K0GA 3FPJA 4PYQA 1M0EA 3ELDA 5DX0A 1G55A 2AZTA 3KQOA 3ORHA 4XUEA 5D1NA 3OZRA 2B78A 4OA5A 5DTMA 5T64A 3TM5A 4RTSA 4P7JA 4OA8A 5IKMA 3I5UA 1IXKA 2P7IA 2O57A 2PT9A 3G2PA 1INLA 4YV2A 3LPMA 5GM1A 1NW7A 3BGIA 3M6XA 1O54A 4KDRA 3UWPA 2YX1A 5E1OA 3HCFA 1L9KA 3GIWA 3HVHA 3FUTA 3HA3A 5LSAA 3DXXA 2XVMA 5FHRA 1N2XA 1O9GA 3PFGA 4G56A 2BM8A 3NTVA 5LQJA 4ER0A 5EGSA 3ER9A 1X1AA 3HCEA 3P2KA 5DX1A 3BT7A 4H0NA 4OBWA 3TR6A 5M5BA 4RSRA 3M6WA 3FYDA 4CTKA 4RTMA 4FSXA 4DKJA 2C7PA 5GM2A 5K05A 4RYLA 3NMUF 2UYOA 2ZVJA 5DSTA 1RI2A 2PV0A 3R9XB 5LQAA 3MB5A 3OU7A 4R6WA 2GB4A 4M7RA 4RTJA 2HWKA 3CGGA 3GXOA 3KQVA 5EEHA 1T43A 5JUWA 1SG9A 3PX2A 3EGVA 2PXCA 3QV2A 2VS1A 4BLWA 2JH8A 4OX9Y 3OE5A 2VDVE 2PJDA 2ZW9A 4HH4A 5DXAA 4BY9E 4PYMA 4RWZA 2Z6QA 3P9NA 3SXJA 4E2XA 5E1BA 3NDIA 1NBHA 5DTRA 3B7PA 2BR4A 2IH2A 5EZSA 2CKDA 3UJ7A 3EVEA 4BP3A 1G38A 2N47A 2B9EA 3C3YA 4Z2YA 1BHJA 3LCCA 3OU2A 5K0NA 1YFLA 5CUQA 4XUCA 2NXNA 2PKWA 3EPPA 4OBXA 4V0QA 2IFTA 3G8BA 3E7PA 2FHPA 3HVJA 5DT2A 2B3TA 2CMHA 4YV1A 1FBNA 5FWDA 1VQ1A 4KDCA 1SQGA 2DULA 3UJCA 4DQ0A 2JHPA 2XYRA 5DM0A 5DM4A 1R8XA 5E9QA 2YR0A 1XDUA 2JHAA 2IPXA 2R3SA 5FQNA 4EKIA 4Y2HA 3SSNA 1YB2A 1ZHFA 2AOUA 1L3BA 4X60A 4R8SA 3THRA 2O05A 1TW3A 3UJ9A 2PVCA 4RTNA 1G8AA 5EHGA 1QAOA 2ERCA 1EQAA 4FSDA 2P8JA 3G5LA 4CKCA 1JQDA 5LQRA 4GOOD 3BKWA 4P7KA 2C7OA 5FWAA 3EVCA 4IKPA 2AOXA 4OQDA 4RTQA 3Q87B 3P2IA 5GWXA 3T0IA 3CCFA 3B3GA 3L8DA 1NW5A 2OPBA 3P9KA 3GGDA 5ICGA 2ZWVA 4MQ4A 1KPHA 1SVUA 2YXDA 2ZIEA 4QPPA 1DL5A 1FP2A 3TMAA 5EIFA 4A6DA 4ER6A 2WA2A 5G02A 5HEKA 3EVFA 1XJ5A 4FS8A 3B89A 5H02A 1KPIA 3MERA 1Q0SA 3KQYA 2PLWA 2AOTA 1N7JA 3X0DA 3P2EA 4PCAA 4PONA 5E8JA 1F3LA 2P3OA 2HNKA 3TPZA 3CJTA 4KW7A 3TKAA 4CWAA 3PT9A 2FRXA 4PYOA 3PFHA 2AOVA 3SSMA 4C03A 3P9CA 3OZTA 3B3JA 1M6EX 1NV9A 4L7VA 3HTXA 1JG2A 5K0CA 5E8RA 3OFJA 1RI1A 2G71A 3FPEA 1XVAA 5FA5A 4K6MA 2OY0A 1SQFA 3GCZA 5GIPE 3E23A 3GRYA 3HM2A 4CKEA 1NBIA 3A25A 4HGZA 4AZWA 4PINA 2PGXA 4KIGA 3IV6A 5E9JA 1SKMA 5GINE 1R00A 4PWYA 5CM2Z 3MTIA 3O31A 5DM1A 5DTQA 5FULA 5HIJA 3EGEA 5CVUA 1XDZA 2B25A 3RIEA 1PRYA 5CIYA 4P7GA 1AQJA 2HMYB 1ORHA 5K0BA 9MHTA 5EMLA 2R6ZA 3A7EA 1X1DA 2V7EA 4E31A 2IBTA 4PGHA 3JWJA 4QVGA 3BZBA 4E30A 3FTEA 2ZZNA 1I4WA 2AR0A 1R6AA 7MHTA 4F85A 4FT2A 2PX4A 3SVZA 5HFJA 4QQNA 1KYZA 1QZZA 3I53A 5CVEA 3EEYA 4YUZA 3FYCA 2QRVB 5FUBA 5KQRA 3VSEA 1ZQ9A 1D2CA 2AN5A 4GBED 2GLUA 3TLJA 2EFJA 1FJXA 3G7UA 1EJ6A 2XVAA 5FHQA 5B1SA 5LQUA 1UFKA 3B5IA 2ZBPA 1X1BA 4QPNA 1RI5A 3FZGA 3MQ2A 5E2AA 4FP9A 1YUBA 4BP1A 3CJRA 1AQIA 1DUSA 4GC5A 3T7SA 2HR1A 2PXAA 3UA4A 4CXMA 1RI3A 4HTFB 3SR4A 3CJQA 3KR9A 4BLVA 2AOTB 4LWPA 2CL5A 3DH0A 5ICFA 5JR3A 5CCBA 4ZTBA 1VE3A 3PTAA 3PB3A 1Y8CA 1RJGA 1Q0TA 4YMHA 1VP3A 3LKDA 1ZGAA 2ZIFA 2VP3A 1YZHA 2PXXA 5E9WA 3RW9A 3HNRA 3A7DA 1ZG3A 2AN3A 3C0KA 3KQTA 2NP7A 2LD4A 3IYLW 3KU1A 3LDGA 3KQPA 2AOWA 5EEGA 3G2MA 2Z6UA 1KXZA 1NV8A 3T7TA 5K01A 4PYIA 5K0FA 5LQCA 5KQSA 1YFJA 5LQNA 3P97A 1G6Q1 5K09A 4HRAA 4PYNA 3TOSA
chains in the Genus database with same CATH superfamily
4B75A 2V7QA 2QTBA 1DC8A 4K88A 2ZVQX 2QT0A 3C3AA 3TWOA 5JJBA 2ZCUA 4U9IS 5BRNA 5EUCA 1V43A 3GEGA 1CB7A 3SQLA 2QGNA 3JCZA 5CM9C 1M6YA 2F1HA 2N42A 1M34E 4AW9A 3BXEA 4IR7A 2JBHA 4RCYA 4RKRA 4F7WA 1KY2A 1A4XA 5CPFA 3IKMB 3DBRA 3QNWA 2ACKA 4V3BA 1KZGB 1NUTA 3U31A 3EG5A 1RWOA 1JFSA 2NU6B 2CF7A 3H1TA 4X84A 3LFTA 2CUNA 1HYBA 5DU2A 3ETLA 3ROQA 5EUBA 4RD3A 1WU7A 1MNAA 1D4ZA 4RPHA 4L4YA 3SAJA 1MC1A 4BJ3A 4O4JF 1WBDA 3K2EA 3OQOA 2RCYA 1G8YA 1OXXK 2B37A 1BMTA 1HE4A 1O57A 2J32A 3D0KA 2AFHE 3FDZB 1H65A 4OBEA 5BOVA 5DULA 5F23A 2ZYAA 3B70A 1EFLA 2GEVA 2WNIA 1EFAA 3T52A 3HJAA 1H6DA 2OZLB 1B0PA 2YJTD 3DNMA 4JYPA 4RIIA 2QF7A 3O75A 3AI2A 3KXKA 4G4GA 4ZT6A 3UC5A 4QM6A 5KVVA 4NEGA 5B3JC 2VDWA 4HG2A 4KWTA 1LLFA 3H7IA 4RCVA 2BJYA 1R66A 2W70A 4H4EA 2MR6A 1IXYA 2DFPA 3BA1A 1OV6A 3FB1A 4KO3S 1DHTA 1XTTA 2WU8A 4DMGA 3TQSA 1NY5A 3PTLA 1XN1A 5K3CA 1A9QA 2G04A 1CUHA 2JL1A 3F90A 1YT5A 3UV6A 4M22A 4C0KA 1FFSA 1VFNA 2YZNA 2X9NA 3CZQA 3OPYI 5H68A 1XBTA 3CM0A 4LDAA 1XLUA 2FHSA 4XVQA 1WCIB 2PJRA 1T24A 4URVR 4Y6PA 2PZBA 2BCJQ 1R4NB 2Q29A 3HFJA 1AJEA 2ZA8A 2DJIA 2OENG 1F1BA 4WQMA 3KQKA 3WL6A 1Q3HA 1M74A 1IL0A 3G7NA 4E0BA 1O96A 1Z17A 3GRUA 1I9GA 1WZUA 2BSXA 2AF3C 4MTLA 4XLLA 5GGXA 3UENA 4RZ3A 2JCGA 3R9WA 1F51E 4YRZA 4KO8A 4MR7B 1XXLA 4JKYA 1RLTA 1L8HA 2QMZA 2PKQP 4BVEA 2WD9A 4M0LA 2AEEA 3SQXA 1XMPA 3K5HA 4EHNA 1NDHA 2XA2A 3DFUA 1IXSB 4IG4A 4L1KA 4BFVA 5DNCA 2Q3HA 4F3NA 5JSQA 3OUZA 1YZKA 2JFPA 2P75A 2REBA 3VDQA 1MJFA 2H11A 1EWQA 4X7MA 3QG1A 1NASA 4ZOLA 4P1ZA 4KXWA 4LZWA 4AJ1A 3BRQA 5TQ2A 5FLXA 4R1NA 1PLKA 1L4MA 4J2TA 4N03A 2JCSA 3AESA 2Q3EA 2P11A 3RSLA 3UT0A 4BVKA 4YMGA 1GU7A 1TLFA 2V5VA 3K72B 4I19A 4A8JB 1P3DA 5IZCA 5MN6A 4E13A 4PGGA 5DISB 2C29D 3NT2A 4L28A 4MO9A 4OIFA 3ZJTA 3DGEC 3C3KA 2C7RA 3GLHA 3A1FA 3HCOA 1QBKC 2WTUA 3RAEC 1CR6A 2ZIWB 1HBJA 3H05A 4U7WA 5FEMA 3E1PA 3RR2A 2OD7A 3TH5A 1U6KA 1X8KA 3TX6A 3IIKA 3ZU3A 4G0WA 2P65A 4E15A 3L6UA 1LLQA 2HV8A 3K71B 3H1FA 2B1IA 2G70A 3VVCA 4I1IA 4G5XA 4HYTA 5CX1A 4MVJD 4EY4A 5I9LA 1UM9A 3ZXIA 2FFRA 2HQRA 1MW9X 1AD2A 1A7AA 2ECQA 3FZEA 1YBFA 1SVSA 4K6FA 2Q21A 3KPYA 5J9FA 4UOEA 2O8FA 5AI5A 2AYXA 1W76A 2MIIA 1NF6A 1N7GA 1ZWKA 2FPRA 2PBRA 2IF0A 2ZR0A 1YOVA 2CKMA 3I9MA 4K3UA 5DF1A 3TLXA 4TKVB 3E9YA 1L4HA 4EY5A 1TADA 1L7NA 2M2IA 3AHHA 2ADOA 1VDMA 2AMJA 2WD8A 3AZOA 4O33A 5IJZA 4MGKR 3LF1A 2X0NA 3RJZA 2GNPA 3B2QA 3ZGYA 5AVKA 2VF4X 2ZJ7A 3ZDBA 4DV4B 4BNFA 2JA1A 2NZUG 2QYSA 1DJOA 1OXUA 1RBQA 2FN9A 1JFTA 3DDWA 4OAOA 4H35A 4IZ6A 4DPKA 2KW5A 3AWIA 3IEPA 1L8XA 4K9RA 4QJBA 1D1PA 4WL0A 3KDQA 1D4AA 2HBZA 3C3MA 4DCVA 2XWJI 3A3PA 2ZUUA 1YS7A 2ZI6A 4BVLA 2IJGX 4IJWA 1W47A 2HSWA 3IMCA 4JXJA 4YMIA 3NXSA 1NU8A 3UV3A 3M81A 3UJ8A 3COJA 1V2HE 4HRYA 1WVMA 4RGBA 3ZV6A 5JSFA 2PZ8A 5KWIA 4NZ9A 2NPIA 3K4PA 3G8CA 4ARBA 2I4MA 3O6VA 1ENOA 3DTNA 5BSRA 1TI7A 3VZSA 2XZOA 1G8PA 2QVYX 2Z2KA 1GA6A 2ZRMA 4WZBE 4Q6BA 1HY3A 4JT8A 1FNDA 4RD2A 4XX0A 4BCCA 5EIEA 5JXHA 2WFLB 4ZCPA 1ZH6A 2BDUA 3UCEA 3S8EA 3SY8A 1XTBA 1Z5WA 3E9ZA 1FSGA 4Y1FA 4UZFA 4KVQA 3I05A 4QUWA 3CX8A 3F0TA 3WTCA 3CT4A 1J23A 1JGTA 4E70A 4KX5A 3LHSA 3FD8A 2VJLA 3RRXA 3FBGA 1II9A 2PU7A 4HZIA 2IF2A 2VSNA 2IY9A 3E0QA 4UTPA 3EUWA 3IQXA 1AM4D 2IDKA 3WICA 4DSNA 3B3QA 4J0JA 3KJXA 1G291 4K9OA 3K0CA 4N3AA 1L1FA 3M4JA 3M33A 3A36A 1PQUA 3C74A 4DNFA 2EP5A 2V0CA 3C1TA 3QFFA 3GPLA 3JQBC 2IGTA 3UAYA 1JLLB 1U0FA 4IX9A 3U7EB 4MQLA 5GVRA 2J08A 3SBXA 2X77A 5CDYA 1AVTA 4QU0A 3KYCB 5HQ3B 4MV9A 1SBZA 1XZAA 5I7AA 2Q5OA 5AI0A 2J3JA 4Q3EA 1PNTA 4D4JA 2X1HA 3FSRA 4LZNA 4PCLA 4GMGA 5M29A 4F2HA 4QUAA 1NW3A 1H1TA 2BFDB 2O1XA 4N5LA 4K0KB 2Y0DA 1P2UA 5HILA 2UVQA 1PJZA 2GYQA 2C96A 4EVCA 2HJWA 1UOPA 2QRVA 4IS2A 4M8LA 4F71A 4NATA 2ERYA 3MJDA 1M5RA 1ZA2A 5BOSA 1UJMA 3EA5A 3PQ4A 1U1CA 4EKYA 3GFPA 1Z4NA 4X45A 2H4XA 1C0EA 1R16A 2C5SA 2VHCA 4BNNA 3LGXA 3BMXA 2XT0A 4XD7A 3TW8B 4FFOA 4YFYA 2G8NA 2MR5A 2XITA 5CVCA 5LOVA 3HP7A 3T5PA 2PUDA 3IT1A 4NFSA 4XFKA 4W8OA 3IS8A 1P75A 2XJMA 3EQ2A 4JLSA 3EIOA 4HTFA 1ADJA 3I32A 3KJFA 5K53A 4QDKA 1WHSB 3QY9A 2H2DA 1FK8A 1Z22A 3FOAA 3OM8A 4WUVA 4FYJA 1G7SA 2HK6A 4GE0A 1OA0A 3RUAA 1DZIA 3ZY3A 1TM4E 3B48A 3X43A 4C43A 1JT9A 1UK9A 1V7QA 3IALA 3NV7A 4TWBA 3RTEA 5JYDA 2V6JA 4QL3A 4RAOA 1I7NA 3JQQA 1TKCA 3O3CA 3LT2A 4K9MA 2LE0A 3WB9A 3VDMA 4OXQA 1MA0A 2BV3A 1C30B 4PX3A 3IP6A 1W4ZA 1CZNA 4XPIB 4ZHQF 5LBUA 3IILA 5B64A 2WWTA 2HWXA 1Y34E 5HKKA 1TZKA 3FTDA 4HEA6 2QI9F 4QYSA 4URXR 2NO9A 4Z6KA 4C07A 3WNDA 3LX6A 5F9FA 1LV7A 3DOCA 4HZUB 1KJJA 2CC2A 3R0JA 4W5NA 1Y1KE 1RPNA 1OX4B 1RLJA 2H4JA 4NZPA 1CE8A 4N5HX 3L4KA 2XWQA 2EQ5A 3AVTA 3PP8A 4MB6A 4G0ZA 1AX9A 1SXGA 3KWJA 4MRNA 4BAGA 4JMLA 4LPMA 1FLNA 1XNQB 3GEMA 2XMGA 3OQBA 4L0DA 3K4QA 1QXSA 3SQMA 2BUAA 4AUNA 2XKBA 3RYCB 4Z2AA 3KJGA 1VRCA 4YRPA 2ZCVA 4AO6A 4YPOA 4QVIA 2VBGA 5SYMA 2YRFA 1HR0B 4G9EA 3HYRA 2PWPA 2FPOA 3NIGB 2SICE 4WBXC 1RCUA 3KJIA 3H4TA 2XGSA 1BVHA 4LRUA 3GT3A 1RZVA 4QHTA 5DTMA 4LJSA 4DLNA 3HDGA 3V4RA 2IHVA 4YJ3F 2AJTA 1C3JA 3L7YA 2C4UA 4PZ0A 2FXIA 2HXYA 1VHTA 1WXHA 1Z0JA 3CKMA 5FPYA 1E6UA 3O26A 3L6RA 3TCXB 1T6BY 3AU8A 3BGIA 3VNUA 2BMFA 4JJAA 3KOYA 4GI2A 1GKLA 2XMZA 4PSAA 4OHRA 5CXQA 2QI9C 1RS0A 4I4NA 1Z12A 1FVFA 3COSA 2X2PA 1PR4A 3MOSA 3PDJA 4PO9A 4TLDA 1YNSA 5AKKA 4S35A 3HCEA 4MRRA 4Q7MB 4RDXA 2I71A 1YAHA 1FTYA 5KO2A 3KZ1E 2RCNA 3DYIA 2NQ8A 2WKQA 4G5SA 4XXHA 1U0JA 2VJMB 3CSUA 4QRHA 3BE5A 3OQIA 3VTAA 1QMGA 2B4QA 2PV0A 3EWAA 3JASB 3FPSA 5D6OA 5EHZA 3V80A 1TRKA 3X2SA 2GB4A 1GL7A 1ZKMA 5JPIA 4JV5B 3HZRA 3IUBA 3NYIA 1I13A 2VJYA 5JKMA 4OHCA 3WB1A 3WGNA 3WWYA 2QPAA 3UM9A 4AXBA 4W99A 1AB6A 4FR5A 3TD2A 4OX9Y 1CU1A 3H9GA 4XCQA 3NJ8A 3P5SA 3SXJA 1P0PA 2FJCA 1C3OB 2BR4A 3MT0A 3UJ7A 1JHAA 4ZQEA 2PANA 5CM8B 1P6QA 3FGPA 2VZ0A 1VBMA 2PX0A 3A10A 4R16A 1SHLA 2JIRA 2ZSFA 1G21B 1YZTA 1D7OA 1A72A 2WRZA 3F6PA 1I3CA 3PD7A 5HWSA 2XADA 2XX3A 3B2NA 3SLKA 4F45A 2RG7A 5AVVA 1QX4A 4BZXA 3DDOA 2BHTA 1KC1A 1UL1X 2HDWA 4K9LA 4R8MA 5E9AA 4TXMA 4LOLA 4AJ9A 1FSSA 2Q3CA 4BU0A 2B7BA 1U2DC 2AFIB 5FQNA 3Q88A 1N0HA 2C2KA 3O3NB 3REQA 1VE6A 3P0RA 4ERUA 4J0EA 3FYUB 4H08A 3MWJA 1OAKA 2OG1A 3L40A 5KNDA 5EHGA 4JN6B 3SXUA 2ERCA 1LNZA 2OBLA 1T3TA 4J2OA 4FX2A 4NPHA 3ZQ4A 4RL6A 5A9SA 3I30X 3MWEA 2OWEA 5A3VA 4Q39A 3ZU2A 4CODB 4ZDJA 3J7AC 1J1IA 1OGJA 1Y48E 2GZDA 4FDLA 4H7PA 4INZA 4DLYA 3AHFA 3ZYCA 4Q1DA 5JS8A 3OTWA 3P2IA 4PTLA 1G42A 2R1ZA 2FVXA 3UXMA 2VXIA 3TZBA 3AY6A 4F5YA 1WAMA 2YFHA 5ENZA 4TX1A 2H9IA 3NM5A 3DHWC 5J4KA 4F1KA 4DXHA 2PGAA 2BFWA 4JBNA 4JB0A 2CEIA 3JZIA 4DJAA 4B43A 3W2FA 1G4HA 3ICPA 4KW7A 2EFCB 2J46A 2ID7A 4GPBA 2GT1A 3NHWA 5DCWA 1YS9A 4C03A 3MCAA 5JMTA 1E2IA 3RGWS 1R0ZA 2ZP1A 1HORA 1VJTA 3QVMA 3LUDA 4IAOA 5FF9A 3VR6H 4W4KB 1Q95A 2C4HA 2PUWA 3ORFA 3NR2A 2IEGA 2NO6A 3KAQA 3WYFA 1QHEA 5T3YA 3HA2A 1KI9A 4JR2A 1NVDA 4FLMA 2O2XA 4J90A 3GUUA 1P9LA 1AUPA 4L9SA 5LYYA 3C1AA 2LGJA 4BGVA 1KOJA 2KLHA 1WUYA 5BORA 2KM1A 1XMVA 5I4CA 1SCKA 3ZWDA 5BUSA 2ASEA 2CLOB 4DV2B 3BRSA 3IGFA 2D5AA 4HUQB 4WT7A 3ZDXB 4FYKA 1JHDA 4W1RA 4Z1MD 3BE6A 5CXXA 1Q1ZA 1T2DA 3ETGA 2FX2A 3DS8A 1SBHA 3I76A 1GZHB 2CL0X 3PFKA 4G1EB 4HXEB 4LRXA 4MIYA 2W6OA 3U5ZB 4TN5A 3D81A 2YV5A 3I4FA 5FEJA 2RBGA 1IN7A 3B6KA 4YAJA 1C1DB 5E7QA 4EL5A 4M0MA 5C7IO 4LJ7A 1M2FA 2X86A 2CUKA 4ZAFA 2K7FA 3ZE2B 1T2FA 4WNYA 3M34A 5LS9A 3NORA 4KUEA 4I4CA 4M0EA 4E5UA 4EUNA 2R6FA 1EJ6A 2GHQA 3PIDA 2W2XA 3R5TA 2OR3A 3ICQB 3MQ2A 4Y2JA 4WMLA 1TCVA 4BE4A 1XDDA 2JLQA 4Q7LA 3CJRA 5DTEA 5G1OA 4JI2B 1CK4A 1PK9A 1V1MB 3EMVA 3N8KA 2XMCA 4UM7A 2ECKA 1ZOSA 1KBZA 1EGVB 3HBMA 3IBGA 2WINI 3TLYA 5AW7A 2E4UA 4Q5IA 1XKLA 3WOHA 1RACA 1WR8A 2YWFA 3CHYA 4CM9A 3SX2A 3ZZTA 3HSKA 4P54A 4HVCA 4UCWA 1BMDA 3QB9A 4D4MA 4P0QB 2O19A 2VP3A 1V4NA 2FRVA 2POQX 3DHNA 4GYYA 3HM9A 4WKBA 1HEIA 3DFIA 4S1NA 4N01A 4CF7A 2DT5A 4K87A 4ID3A 2JFYA 4KHZA 3ROMA 2FVYA 5CGZA 3PBKA 4UTVA 5ALUA 3SIRA 3UXHA 1J39A 1RPJA 3HABA 3HY6A 3R2OA 2IEAA 4N5NA 2QQGA 2NVUA 2NPFA 4PYNA 3V7YA 4D43A 3OQ6A 1R4NA 2XJNA 3K73O 2H9AA 3CR7A 3PXCX 5F9MA 2I1LA 1ZIOA 4X00A 5LDGA 4BVAA 3NHBA 1R8JA 2H1IA 4XARA 4EO9A 1WY7A 1PZXA 1Z6ZA 3LV8A 1HDOA 3T4UA 3ZJ4A 1D2HA 2II6A 4ZHQB 4ZGGA 1HFWA 3CISA 3KR0A 1KYVA 5AD1A 4IW3B 4J29A 1UQRA 3MGGA 3O95A 4Z8XA 5K0LA 2QUJA 3BD9A 1XTSA 4E2WA 5LBTA 4EUKA 3E7FA 1KIMA 3KA6A 4II2A 3FNIA 2B7CA 1SB8A 2IHBA 1LQ2A 3GFTA 5D00A 2QRHA 2Z6VA 4MWSA 1TTHA 3AWDA 4DDUA 3ZVRA 2IV7A 4RGQA 3QA3E 1XCJA 4B8WA 3JWGA 4ON9A 3VJRA 2VUIB 4DLXA 2H4WA 3ODPA 1JDVA 2R0QC 3OJ0A 3LYAA 3AJQA 3RVJA 2OE2A 2OKCA 4C6TB 1OT3A 1Q7GA 1VLMA 3DULA 1E7YA 1ORIA 3B6MA 3C15C 4R9NA 1RPZA 4BMOB 1HC7A 1WEHA 1R0BA 3O38A 4WBNA 3L3BA 4L4UA 4UJ5A 4RY8A 3BVFA 2E37A 2G7MC 5K3AA 1U5CA 4NLLA 4WNIA 1I7LA 4L3VA 5ARDA 1BX0A 4MKGA 4O2RA 4AX4A 3OX4A 1A2QA 1E4OA 3AUFA 4GVLA 1GJRA 2ZURX 3GH1A 4YJ3B 4FFMA 3IMEA 3O2SB 3KX9A 3R6TA 4Q3CA 1G1MA 5D5HA 1KI7A 1S7CA 1SUSA 2X5JO 3QE3A 4NNJA 4AWBA 1NMQA 5CA1F 1VBFA 1YBAA 3PUJA 4DV3B 1ZUJA 3E22B 4TKVA 1IN8A 4KQ9A 1GUFA 2OYRA 4E3ZA 5J4YA 4AYTA 4BGEA 2FLWA 4X8OA 5J3JA 1QAQA 4ZU1X 3WFZA 1I7DA 2OZEA 1JPUA 2GZ2A 1ZM7A 3N5CA 4IJ6A 3NU1A 4S1OA 2I7DA 3SX0A 3HU5A 1WDLA 1YACA 5F76A 1W96A 2EBHX 1F0NA 2RHBA 3C39A 5F1PA 3WZLA 1R9MA 4IINA 4AY3A 1G2IA 3CUWA 4FFWA 2YZ7A 4XX0B 2GBLA 4M1MA 2X8JA 1CULC 3UK0A 1G5FA 4X20A 3NV9A 3OCZA 5DMHA 1VG1A 2DB3A 4AMZA 4G63A 4WACA 4Y2RA 4HWGA 3TFWA 3TQHA 4HAUA 5FIUA 3WWDA 4EWLA 1EG7A 4E6PA 3OE1A 4DLVA 4KJXA 5J2TA 3KKPA 5FFFA 1ZCJA 1O89A 4OUDA 5JJIA 1NHWA 2QB5A 1HA3A 2ZFUA 4G5OA 2O7NA 4HLNA 1BVRA 4QT0A 5AJZA 4CL0A 1IERA 1RCDA 1PT7A 1FP4B 1YFZA 2HF8A 2Q0QA 2DHQA 2RGNC 4U39A 2FG7C 1S1CA 3K8YA 3L2OB 1Z38A 5HDQA 1HEYA 2X8LA 4PRLA 4B3CA 4X8MA 1Y81A 4POOA 2D06A 1B41A 1SCIA 4CMAA 1K66A 2YJKA 3U4HA 3GAFA 4LJ8A 3PUVA 3TS1A 4CKCB 2FDCA 1PV1A 2ZSKA 4UUBA 2CNBA 5G4LA 4ALKA 4F4UA 1TA4A 4R05A 3GNTA 4G3XA 4RV9A 5BNIA 1UXOA 3M5CA 5JZMA 1S2GA 2R6HA 2JBAB 3U6BA 3A3OA 3HDJA 3RNOA 3DNFA 4YEDA 4CKYA 1KH3A 5DBIA 2Q5HA 2O1SA 4HN9A 2VTKA 4DBZA 2R62A 3RS2A 4D3YA 1E8DA 4ME6A 3TE6A 3X2EA 2YICA 5EJ4A 2HF2A 4LOHA 2I4IA 2H8GA 1UJCA 4EB6A 1N6PA 1NVXQ 2O4UX 3H5RA 3PUKA 4RSMA 1KQFA 4HQFA 4IGAA 5ADHA 1SOAA 4QOSA 2DHDA 2G0NA 4WA8A 2UZ0A 1Z29A 4CYMA 3D6MA 1T4CA 2RHTA 3FDXA 3HNPA 1E9SA 3M9LA 3PX3A 3SC6A 3U4IA 1NN0A 1SIWA 2HXSA 1OBHA 4B80A 5JROA 5JSZA 3I2YX 3RFXA 4V1CB 1R6TA 3JQ7B 3EZ2A 2JGKA 1E94E 2EKDA 5F2EA 3FMFA 1GCUA 4YRSA 1VCIA 1JHMA 4I9HA 4YCAA 1HDIA 2XKAA 3N7UA 3KKLA 4QUBA 3X44A 5LVAA 1UWLA 2XYGA 4BFLA 5COQA 3WBKA 1CUCA 2FJPA 2Q6IA 4G0VA 2GVDC 5AVJA 2P2GA 3R5XA 1DTEA 4CW7A 2VKQA 2WG1A 1MH1A 4TT8A 3ZWXA 1G0NA 4LGYA 1UPXA 1T13A 3VVAA 3BK2A 4GLLA 5HJHA 3GUHA 4KXYA 4UTOA 5DHTA 3GEBA 3THOA 1Y4SA 2YCLA 3WX0A 1A7KA 1CNFA 1OKKA 2B6HA 1ZSVA 4OH7A 4EEKA 4LMBA 3UHJA 1SO8A 3DV0A 5LKAA 3WVVA 1E63A 1NW9B 3A14A 4ZIRB 4ZFNA 4EG0A 3U7QA 3AFIA 3D6AA 3VPDA 3B53X 4D57A 3UA3A 5CXUA 3IUQA 1SC3A 2NWQA 2FR0A 1D2NA 3E9RA 1NDUA 1N2GA 2YJ5A 4J7AA 2DFVA 4HCJA 4LYHA 4RMJA 1UWVA 3VC2A 1WPQA 1FBTA 4LK3A 1R4AA 3VOTA 4LJLA 4TTAA 1SHZA 5IABA 4LRSB 3GLFB 1B1AA 1C50A 4KB5A 5ADVA 3D8HA 3NAZA 2FJ0A 3H2JA 2V6MA 2H5JA 2WSIA 3R75A 3K7EA 4X71A 3VZBA 3RQSA 1CJMA 3NC1C 3N6VA 3OPQA 3GD5A 4MGIR 5JRJA 2M1XA 4I55B 1DBVO 3FF1A 1CJKC 4L5JA 2EDCA 3PFIA 1NDQA 1X9GA 3QKRB 1UJ5A 3EGWA 3GLGE 3QFRA 3EA0A 1RLIA 4O4JA 3RSCA 1W0CA 2ZJ6A 5BWNA 1J2RA 3LXXA 4E3WA 3R2SA 2O3TA 2G9QA 4Y2YA 2C4TA 1IONA 1SQ5A 3WK8A 1QYXA 1YAJA 2RI1A 2E21A 3R20A 4G0MA 1MAHA 4OFZA 1JIQA 1GSAA 5L4NA 2PO5A 4ZQFA 1M1UA 1IK6A 3FY4A 4QUJA 2XCTB 1EUYA 1OYVA 3O7MA 1IHXA 1SQSA 5FWYA 1B2LA 3T4EA 1ZESA 1XL1A 3OFND 4ERNA 2X7JA 4MLDA 4UEKA 2XQKA 5FBHA 2B0JA 4U3JA 3RHZA 2LDBA 2BK6A 1XDBA 4LDNA 4MJ3A 4RNDB 3FPFA 4CLOB 3GV0A 4M1YA 4PHTA 1QTRA 1J8MF 1H1DA 2RGEA 2WJ3A 4ZVRA 3W04A 1M3SA 5HK8A 4AMYA 1WXXA 4WKPA 3WMFA 3U7QB 5FPSA 1FRQA 1MJGM 2C4WA 2GJ8A 4FZ5A 1YUNA 4JYBA 1KSFX 1O7JA 5K3BA 3V1YA 1UBUS 1HOXA 5JANA 2W42A 1U02A 6NULA 2XYHA 1RJFA 1IEVA 4L8WB 2D5KA 1WB5A 2RI6A 5JASA 4U7TB 2W4MA 3KOZA 2EJVA 4ZEMA 2D1FA 5DNWA 3P4YA 1SY7A 2ID4A 3IIIA 3IPAA 3L01A 2AMVA 3J81k 3BSYA 3DEKA 1ZYUA 2VI5A 4ESHA 4HWKA 3CTMA 1HG1A 2J7KA 1ACMA 2X0FA 5K6AA 1JDTA 2GEDA 4LXQA 1XF1A 3LT0A 4JQCA 2WDPA 1MC5A 2ONYA 2V8OA 5C81A 2X2EA 2P2NA 1K7FB 1CCWA 3K2BA 1Y37A 4JXZA 1W36B 1DT5A 2J9FB 3VO9A 1P0FA 4J75A 5IDXA 1QCYA 4LC9A 1T6ZA 1XQ1A 1C3OA 1O87A 3F2VA 4OGLA 4MS3A 3KYJB 1AGRA 4DYVA 4Z3BA 4LVCA 4C0XA 1K63A 5DK6A 1DKNA 1HX7A 4BKUA 1W5TA 2VRWA 3NAGA 1G21A 4ABYA 1UOEA 3ID6C 2JRCA 3TIIA 2F3TA 3KB6A 3ICEA 4DKXA 2GKSA 4PF1A 2YVKA 4LHXA 3GJRA 1GSIA 1V95A 2JARA 1TM7E 1DDIA 2ZSUA 3CXRA 2PUAA 5GQSA 3DXFA 3NHZA 1BTOA 5JD4A 3A3NA 1NVTA 4UVGA 4CEJB 2HSEA 1JTSA 2B78A 2QJWA 1RRPA 4U6SA 4B8YA 1KC3A 1OASA 1S2OA 2A1UB 1C8VB 1NYQA 2FFQA 2O20A 2X9QA 3GUVA 4HQNA 1IXKA 1SKYB 1TC1A 2YYAA 3WNZA 1CUJA 1T8YA 2W2MA 4PC1A 4BDTA 2WWGA 1LNQA 4KACA 1XZMA 4Y2TA 1PR0A 2RHOA 1YB5A 1SOMA 2Z2ZA 3BBPA 4RK5A 4LBWA 4HO1X 1KSGA 3ZDEA 1XSEA 1SOFA 3LC2O 4HNQA 4Z9AA 4XJTA 1A5SB 3L46A 4IX1A 3ZCPA 6CHYA 3WKCA 1PNVA 5JMWA 2GPAA 2HU5A 5JS7A 1FQJA 1XHFA 1ADCA 1VMIA 1A9YA 1KGDA 2JS7A 1KQPA 1UQTA 2CVZA 2X7HA 3AERB 1O6ZA 3ZZNA 5IVHA 3OQMA 3GGGA 5JLAA 5REQB 3VZCA 5IC4A 1MB9A 2A9KA 5EL0A 1JR6A 3MAJA 1Z5GA 4NARA 2ZVJA 3CH6A 2D5BA 2UV8A 5ELMA 4AJPA 1AQLA 5SY4A 2OECA 3Q8KA 4PXYA 4DSOA 1T9CA 3JQBA 4AVYA 2GJAA 2OO7A 3EF1A 4NS1A 2YYZA 4RTJA 2QNBA 1SVOA 1TU3A 4MRVA 5FFMA 3IDQA 4ECAA 1VLGA 4HB4A 4ODIA 1FTWA 5C5DA 1NAIA 4BLWA 3L1JA 5B4TA 3CRW1 3NIFB 3OOSA 5H9VA 3VVMA 1NP7A 4CIBA 4P3KA 2X1MA 3BHIA 4HH4A 4HOYA 3W1WA 5A62A 3NO4A 4DNXA 4AUEA 5BVHB 1D6JA 1IB0A 3ON5A 4MQ6A 3T0FA 2WT9A 5DTRA 3AK8A 2BONA 4O2AF 1WJGA 5IBRA 1LSOA 4AWAA 4RPIA 4BP3A 5JCPA 1J8VA 2HIAA 4TUYF 4UCXA 1L8LA 2DY1A 4MGHA 4Z2YA 4DA6A 5J23A 2VNKA 3TTXA 2DVMA 2RJ3A 1MV5A 1YUMA 3F34A 3LVFO 5LWQA 1YFLA 1NAHA 4P86A 1CDEA 3UH0A 1JSRA 2WHXA 4A16A 2ZBVA 3T3DA 5B1HA 4B3FX 1GZDA 4HGRA 1N0UA 2P9EA 2MTBA 4CM4B 4HYYA 2AKAB 1Q1BA 4CKXA 5IJ9A 1NI4A 4YCNA 1G9TA 1Q0RA 2ZUEA 4R2IA 2F48A 2JGIA 5F1OA 4TV8B 1IE3A 3EGXA 2CXOA 1QX3A 3K05A 3QVUA 3QW2A 3F35A 1ZHFA 1PDOA 3HZZA 1OTHA 3H6GA 3RUFA 4DJ5X 2IPLA 5AKZA 5DLEA 3UJ9A 4BNWA 5JXWA 3U44B 3SZUA 1NGSA 2EJCA 5BSKA 3IE2A 3CG4A 1CZHA 4YPVA 2V6IA 2C07A 1V6CA 1MOSA 1J21A 4TWRA 5H83A 1ZMXA 2GPSA 2CFIA 3OY7A 5KCZA 2C0QA 4A5SA 1YI1A 2PS9A 3IPLA 1OZGA 3N2EA 1B76A 1N3YA 3Q87B 4MUJA 3O4VA 4R0VA 3T0IA 3QX9A 3X1YA 4HNVA 1GG8A 2OK7A 4QYMA 4YAFA 5MFPA 3O8RA 1UXGA 1FA9A 2VJOA 5AK6A 1JEQB 1DL5A 5H9WA 2VYND 4RESA 5TPZA 3HK2A 3PFBA 1A9PA 1Z2PX 3B89A 3JZDA 4FNMA 4ZI5A 4D3SA 3I2JA 2DKNA 2DWQA 4PONA 3X0DA 5M04A 5JYBA 4BECA 2XWSA 1K0UA 4IIVA 1RMQA 5K2OA 4KR2A 1AKWA 4MJXA 1DXOA 1P45A 2WUDA 3G85A 4OXIA 4ZO8A 3UATA 2XGWA 1SUFA 2P2DA 3B3JA 3N75A 4L7VA 1E89A 3A1CA 3R6GA 4BBZA 3MWYW 3OQVA 2F3PA 2Z9CA 2QE7D 4YRBA 1RXWA 3C6QA 4M98A 3QIVA 2F8SA 3FCXA 2CD7A 5IM5A 4KITB 1X70A 3V7FA 4QTZA 2A8YA 2V7XA 3KB1A 4IIEA 4HGZA 4MQFB 4JWKA 3DOFA 4I1PA 1JXAA 2VAWA 4TS4A 1R00A 2PA0A 2P90A 5L3RA 4PPNA 1Z7BA 3DKIA 2Q99A 2B3DA 3N39C 2AZDA 4H7EA 5D3KA 4L74A 4PZCA 5EHNA 3SN6A 5EP2A 1ZISA 4YRCA 1TEXA 1ORHA 2AG0A 1XPJA 3CX3A 1ODLA 1XNGA 2V7EA 2BC9A 3ZW7A 2PV7A 1E1DA 2IEBA 7MHTA 2BMJA 2P6UA 3F5QA 1VLLA 5F7OA 3GPDG 2BTQB 3SF0A 5KUTA 1JDSA 2WMNB 1XFAA 3B52X 4FYHA 1XWWA 4A0SA 4DGQA 4W63A 1GTJ1 4H1WA 1O6BA 2AN5A 1R4ZA 5JD3A 2DLDA 3JD4A 4YQZA 2ZR9A 4MVJM 4LY0A 4ZDIA 3OLZA 5E6SB 1BWQA 1YOBA 3F49S 2PH7A 1N6LA 1JA0A 1T10A 2B4AA 2EW1A 2WJVA 3I9NA 4RSGA 5KHAA 5DGCA 3NP7A 1Z2OX 4GC5A 4PXSA 5AHOA 3ORQA 1Z33A 4LHWA 2X5NA 4QFBA 4PHFA 4AFNA 1J2YA 2HWYA 3QLUA 4E5NA 5BN5B 4LV5B 2YHUA 3RI3A 2W6PA 3PENA 3U3MA 1JG6A 4WK6A 2FHAA 1IBRA 2PZFA 5BN4B 4XVRA 5I7FA 4KC0A 3PB3A 4EJSC 2B35A 4OQPA 4AN1A 4LZLA 1GA1A 2HIGA 1J0EA 3X1WA 1ZC4A 1H66A 1U2GC 1GFWA 3Q15C 4S0XA 1AS3A 4DLPA 2LP4Y 8ADHA 5KYNA 2C0PA 2JLRA 5K0SA 5LDDC 5LL6P 4C4SA 1UJNA 5D8SA 4B7UA 4M83A 3EGDB 2AR7A 1NJ8A 5K8TA 4GM4A 1OFIA 4BKMA 5CP8A 3VDRA 2JDID 2QIPA 3KJEA 4HF7A 2YJGA 3U61B 2P6RA 1ISRA 4OYYA 4LXHA 5L4SA 1I32A 4DYDA 1VKZA 4L7QA 4QGSA 1NWHA 1U2DA 1I7SB 4KG7A 4I5EA 1QVVA 1JH8A 2YINC 3O03A 3R7FA 1ISIA 1O9IA 1A7JA 3MINB 3FNBA 2C9YA 1KAQA 5K52A 2GBPA 3MNFA 4DVJA 5FUYA 1ZNXA 4GRIA 3K32A 2OOKA 2FPGB 2NOAA 2PEYA 4RK4A 3ZIDA 4KVFA 2CLDX 5ALZA 5EE5B 1C1HA 5ED0A 3QFSA 4MX8A 4TLBA 1IN6A 4X54A 1XAHA 2Y2VA 3F7TA 5L95A 1WD5A 1N8TA 3B5EA 4ND4A 4RZUA 1JQBA 4EELA 2XQIA 5AVRA 4FFPA 4AJIA 2W83A 2Z09A 1SBNE 1TT5A 3I5AA 4KPEC 3URMA 5D8RA 1NC1A 2Z8ZA 2LPMA 3FVWA 2FE4A 3OJEA 4OHUA 2QL9A 3ZZ1A 2P9GA 3PXEA 1Q16A 1VL1A 3IPRA 2Q8QA 1FJ2A 1MX1A 3IUEA 5KVAA 3HY3A 4LAFA 2ZYTX 4NU8X 4WNAB 4C4TA 1P44A 2A9QA 3RS7A 2FWJA 3C6ZA 3HDVA 1V9LA 1DVRA 5SZIA 1WXIA 2O3QA 2ZYWX 4FCTA 4FYVA 1DUIA 3RNLA 4PSCA 2E82A 4DLBA 2PX2A 2JD70 5JQGF 5FFDA 2FFJA 1UBGA 2P35A 1E9FA 3VUFA 3UMJA 2WVAA 2DH5A 3A2NA 4C05A 1OXTA 2WTXA 2X7XA 2OV8A 1TYAE 3TNJA 1ZU5A 3Q7RA 1Z3IX 2OMKA 1QCCA 3OM1A 4OQEA 4P58A 2ZIXA 2JFQA 4BNMA 5HJ5A 1N57A 2GM4A 1GWGA 1E1MA 3CUTA 4Z3OA 3C5CA 1TUGA 3PRHA 2P27A 1OYWA 3TBFA 1ZL0A 3CPJB 3UK1A 1LPOA 1ULBA 5ARCA 1Y5NA 2FEKA 2DWUA 3HVKA 2QYTA 3JQEA 4MGZR 4KSBA 5KX5B 1APBA 2FY8A 4LY3A 2EBFX 8MHTA 3CLUC 4PSKA 1V45E 2C5LA 2EG5A 3H97A 2Y1XA 3JQ7A 4IL5A 2AXQA 2GD1O 2XR1A 4MDHA 1YGYA 3G5AA 2ASVA 3VRHA 1ONBA 5DM2A 5J5VA 1HLGA 5EN4A 3GJ8A 2C5GA 2XMSA 3MCTA 5JFGA 3T5AA 2WAMA 2ALJA 1U9ZA 4B7XA 3ZOZA 4N9QA 3BH6A 4MOWA 1VP9A 3HZOA 3U1BA 3K0SA 4TODA 3JYPA 4P4GA 4S12A 3HL0A 3PW1A 1PWYE 2UZ1B 2ATXA 5FTWA 2VT6A 5AESA 1FTGA 4GHWA 4HNSA 4Q7JB 1U7OA 3QU9A 4BOYA 2CNWD 2XCLA 3AFHA 4O2AB 5IARA 1GGNA 4UVEA 3MWFA 1J0AA 2FWRA 2OK8A 2GPBA 4TUYB 4YECA 3WMEA 3ZXUB 5BW5A 3F6CA 3KQQA 1WP4A 4M38A 3FPGA 1LDNA 3T9DA 3E8XA 1MCZA 3KJQA 4G84A 3EH2A 3HKBA 4EGFA 2Q3MA 3GHHA 5ECYA 1Q7CA 4JH0A 3K0BA 3L18A 1DELA 4DIKA 3N0TA 3AYXB 1U0SY 3CE6A 1BSVA 1Y8QB 2LRHA 4LWQA 3JZFA 1MO4A 2IYYA 4CG0A 4R2XA 4NMHA 4PNZA 4OX9B 2BGGA 3ZIAA 3H04A 3CH4B 2AMLA 3B3AA 1JTVA 4UHBA 4NEHB 2XNCA 2EKQA 3GLFA 3PVTB 4DA4A 1FL9A 2OORC 2YJNA 3RPEA 3ZHSA 4K1XA 1VYUA 1A2KC 2H1SA 3DT6A 2HV9A 3R3XA 4RO0A 2KHZA 2NT4A 4RVGA 2WYOA 1E3QA 4FHGA 1NE2A 4B6RA 4DE6A 3WAGA 3FUWA 2CDAA 2H2IA 2QLFA 4R5MA 3S99A 4E7PA 1UJ4A 3HO8A 1OAOC 2PX8A 5EXDA 4ZL5A 5F2KA 3ISEA 4JLNA 4B45A 4KFCA 1W8IA 4MICA 2Q62A 1VPDA 3Q9NA 4G9BA 4D0LB 3COYA 2VLBA 2PWBA 3RJ5A 3WXMA 3HRHA 4X92A 3E1NA 3RADC 1Z4QA 1DC5A 4V0OA 1YI0A 2BGRA 2WZBA 2ZWMA 3PL5A 3RVDA 1HZJA 4JLDA 4FI3F 1M72A 3U62A 4ZZ3A 2PAFA 3EK2A 1UKYA 2DHRA 2F62A 3DMTA 1FDUA 4AT1A 3ELUA 3HXPA 1BFDA 3RSZA 3QEMA 2YKGA 2P1RA 3S8MA 5A0TA 3T3OA 3GDWA 2FPKA 5C7YA 4G0QA 1G8HA 1UR5A 2VP2A 2Z8XA 5E0KB 2WOOA 5A5VA 5IF3A 2FQWA 4IV5A 2YWDA 4B3XA 3H13A 1JVSA 4URYR 4EJSB 1TPYA 3FB4A 1UC5B 3BUSA 3JQRA 5H3HA 1GAEO 1XWIA 1NSFA 3L06A 1RXUA 4D26A 1KP3A 3QVGB 1W4CA 2XY4A 3GVCA 1RCFA 3TLGA 3WWCA 3QU4A 5EJIA 3LFUA 3ZDRA 1PR3A 4B3GA 2L42A 1K98A 3HJNA 1A9XB 1O95C 1XJ0A 1VPWA 2NSLA 9ABPA 1XUOA 4EVSA 4UAVA 1G6HA 2ZTUA 2HQ1A 2WICA 3KVNA 4IG9A 4J0IA 4JEUA 3LTNC 1E4VA 1NI5A 3EIHA 3DR5A 5BNFA 1IHUA 1USGA 3IAM1 3QY0A 2H7VA 3COPA 3DB2A 3R7AA 1HO3A 1PFGA 1PJ4A 1RM3A 3E0XA 1BGVA 1PJ3A 2CJWB 2H07A 3E7WA 3MAGA 3LPCA 4NMLA 3N70A 3VJKA 4KQ6A 1M1YB 3T4PA 1XX6A 2OYSA 3OMWA 4FI3C 3BIWA 1QFJA 4L0CA 3T7DA 1XPOA 5HOQA 1W36D 3MRXA 5DHRA 3CVWA 4QAJA 1OWOA 3LUJA 5I9TA 3TIXB 4M9ZA 3AKCA 2RGUA 3SFTA 3TINA 1MW8X 1DNPA 4IFIA 3L0DA 1LVUA 2IXEA 1FNNA 2IYOA 3G49A 1SAYA 5CNMA 3FNEA 1E7RA 2MSDB 1XZKA 1NWCA 1W5EA 4KZKA 1SUWA 1A4IA 1OTKA 1UMDB 2IUEA 2JIZD 1KF0A 1P18A 4KOAA 3UEOA 4BRWA 4ZI7F 1T9HA 3FTCA 2RGNA 5FBZA 1U1GA 4J0KA 3LX8A 3UFBA 4Q4DA 4TOGA 1T1IA 1L6RA 1HETA 1GU0A 3MPSA 4JCCA 1GCGA 2A0XA 4N1AA 1QZTA 1UXKA 1DAGA 1VLZA 3F47A 3ONWA 5CA1A 1IN1A 3ANYB 1PGJA 2G4CA 2VDMB 3MILA 4FGUA 1PHPA 3RBZA 4PFJA 3V7NA 4HAWA 4BCBA 5KJ6A 4MHTA 3H0CA 4WJZA 1QZXA 2BBTA 3I04M 5LC1A 4ZQGA 1QYWA 2BFAA 3A68A 1FFYA 2OHFA 2OFXA 4RHUA 3U56A 1PG5A 1ZM2A 1GPBA 1Z4LA 4GG1A 1TJ5A 2C92A 3Q8XB 2XE7A 2ZB8A 3HVIA 4R69A 3R7DA 2ZPTX 5REQA 3SKXA 1SURA 3IAAA 5KOIA 1N7HA 2PRKA 2OAP1 2YNMC 3UHPA 3EPRA 4TQAA 4Q3DA 4J9UE 3KUXA 3QRWA 1ORWA 2ID9A 5KWEA 2VYVA 3C85A 1OF1A 3VZDA 4GD3Q 3F4LA 1RM4A 1HSZA 1YDHA 2QRKA 3H1EA 3GGJA 4OHBA 4JNCA 3WK7A 2QXTA 4IQFA 4NONA 1AEWA 2Z5QA 4OU4A 1UMKA 2QPTA 3W2EA 1L7QA 1SKUA 1AHIA 1Y6GA 1QV7A 3EVDA 3L1UA 2BGNA 1O5TA 1KGSA 4IGFA 2JNWA 4OXKA 4OXXA 4CV2A 4JQYA 4IIGA 2IIQA 2XA1A 2TS1A 1R18A 3K1ZA 4LDPA 3IP7A 4OHOA 5EG5A 1DO2A 1GITA 1Z13A 3I8SA 1E0DA 4UNQA 4EQZA 3W1EA 1KI2A 3U3RA 5T4HA 1AU9A 3DCNA 2MYUA 4QWWA 1R3DA 1Z45A 3OOHA 3W34A 2RE8A 2BL4A 1LKMA 2NU7B 4WESB 5JQGB 1V5FA 5D3MA 2F1IA 4F2DA 1JEYB 1S2LA 4E1AA 4DDMA 2AZTA 1CJSA 4D4KA 3SYMA 1RM0A 2IP1A 2J07A 4MH0R 4U8HA 4OA8A 1JUDA 2OCXA 1EWRA 3HR8A 4A03A 3IR6A 3TA8A 1ZN9A 1HE1C 2D2XA 4UARA 3ZV7A 3N74A 1DCTA 3IEXA 2H92A 3SOPA 5ALFA 4LN1A 4P22A 3ZCRA 3G9QA 4RIEA 1I2DA 4FTWA 4S1VA 4UULA 3AY3A 4ZVQA 4U3GA 1JKFA 1N2XA 1Q1QA 3IODA 2UUPA 3KSMA 5KNCA 1MFZA 3IOYA 1PYOA 2GDJA 2FSFA 2JJ8A 4YDHB 3V42A 3ZWCA 3UQZA 4AYXA 4RTMA 4GAEA 3HRKA 4MCIA 1DMRA 1GPMA 2H51A 2XI4A 5JYEA 1L5RA 1JEQA 2BD0A 4Q4AB 2QBYB 5ICSA 3EGOA 4FOOA 5AW4A 4YDRA 2HRRA 1K8QA 5D51S 4NXMB 3DE0X 3Q11A 1EM8A 3JATA 4I9FA 4N0DA 1NJSA 1UPCA 5TGTA 1P29A 3B1XA 4JOSA 3TJZA 3AHJA 3L93A 3MUFA 2QSUA 4PGIA 1T5DX 1ZNWA 1X7GA 4E2XA 2Y44A 1K2VN 1F4PA 2OXCA 1G38A 3R77A 2WOJA 2DQKA 2H1CA 1NQOA 4Y2XA 2CLEB 2J3QA 5GINE 2C5EA 5G3YA 5TB5A 1F2UB 3LLUA 5IYZB 2V4MA 3D19A 4HLUC 3MN1A 1U3FA 5IAKA 4ZMBA 1F48A 2P8SA 2OCDA 1LBQA 5CW1A 2V4ZA 2VHUA 4K40A 4FN4A 1KEUA 1Y6JA 2ZJFA 3E6RA 1Y8RB 3HWX1 3O92A 4PVDA 1GUDA 4L73A 3G82C 1C29B 5DV9A 2QXUA 1YUXA 1M54A 2JHAA 5B3LA 4Y98A 1U1FA 3CN9A 1XVVA 4GPEA 1MAAA 3CMCO 3D0OA 1T1EA 1L3BA 5KNDH 2PPLA 3RT9A 3A2KA 2QMEA 4TM7A 1VL2A 5A6SB 1Y98A 1NY6A 4IOMA 4C7JA 5IBQA 2FE1A 1WMSA 3HEAA 3RBXA 4B3TB 1DTWA 1LJUA 4E21A 4DC1A 4NYIQ 2F1JA 1TXGA 2ISSD 1PFKA 4GSKA 1FMJA 4MQEB 5K3FA 4TT3A 4FNOA 3A28A 4P38A 4ZP1A 1P5FA 2WJ4A 3B1YA 2GZHA 2RAFA 4AJ2A 3UG6A 2ZWVA 1T2NA 3HADA 2YXDA 1SVUA 1DFGA 1NJ6A 3QF4B 3QXHA 3KOWA 4MQ4A 1K5GA 1Q0ZA 1MJNA 3HE3A 4J4BA 4J03A 2DERA 1XI2A 5IDYA 1IJFA 1R0RE 4G85A 4Z4CA 3F6BX 1V7CA 2ODPA 1M2VA 5DHPA 3GA5A 4UEQA 2EKLA 4B6EA 4CWAA 3ZVMA 3I9LA 1R8QA 1K9VF 2XF2A 4QASA 4WXEA 1AOXA 3FWHA 2GSDA 5E9WA 3DT8A 2H7XA 3V8PA 1N5RA 1VJ1A 3WP0A 5FOQA 3ZKWA 4PICA 4UBIA 1L4UA 3TRIA 3ZWMA 5KTNA 4NMMA 1J0BA 4DCCA 3GJ5A 2X9LA 2G71A 1E3DA 2WSLA 1BCSB 3AUTA 3I9KA 2V2NA 3IKJA 4LQNA 3QE9Y 4EL0A 4DWJA 4KIGA 1ZRNA 3FOZA 4Z7NB 1FUKA 3O4IA 4MO2A 3UXYA 1M5TA 1UODA 2BMAA 2RK3A 2IA5A 4N5DA 4F3CA 5KQMA 1GQFA 1PFYA 2OMEA 1JDZA 2W8BA 3PEUA 3TZQA 3KSUA 4WOPA 3QWAA 1EFPB 1PRYA 2B82A 2JKVA 2QX8A 3LUGA 4LZPA 4O4IF 5JCZA 4F93B 1X7HA 2WF7A 3V33A 3D7RA 3DVLA 1QIMA 2W6QA 3QNMA 3QOYA 1IAVA 3GRFA 3ZI4A 3EAFA 1P6XA 3H4MA 1WW2A 4MGYR 3FPBA 4NHEA 2Z43A 4LV8B 4NBVA 1C4KA 4MI3A 3SVZA 1COWA 1DQRA 2IDZA 2C3UA 3F5MA 3KYDB 3EEYA 3BIXA 1G19A 4L2IA 4X7BA 5FV4A 4R8KA 1PJ8A 4GBED 2ORYA 2Z2JA 3WYEA 1OMOA 2HBRA 4ZL6A 1KNXA 3NBZC 5FHQA 3IT2A 4KE8A 2OCPA 4UMDA 3H3JA 2C94A 3P9RA 1J09A 1F06A 1Y1SA 1YUBA 5CXSA 4YJ2F 1KI6A 1UBFA 3TLAA 1DUSA 4W9RA 3IA2A 3TVDA 4V3CA 3UMFA 3SR4A 4DABA 4GKJB 4R1QA 3GA7A 4LF4B 4N40A 3FAKA 4NCXA 4M88A 3E61A 2O5CA 2WSMA 2A5GA 4LUCA 3UUFA 4HB0A 3ZEIA 4BJHB 1U8FO 5JATA 4DR6B 1VP3A 3OVMA 1X7YB 4RZHA 4PR3A 3ORRA 4IO0A 3O84A 4EHLA 1MO5A 1MB3A 2J3IA 2O6LA 4WINA 3OCVA 3TQQA 1BG6A 4L5AA 3CB4A 3HNRA 3A7DA 4Q9NA 1K6IA 3DMDA 4XPZA 1VPEA 1W46A 5K01A 1CQJB 2RKBA 5K09A 2G9UA 4UQPA 1WM1A 3KD3A 1NZDA 1RRKA 4MRMB 5IRCD 2POCA 2NUAB 3DDZX 5DBGA 2CWWA 2YHIA 3EXHA 2DWOA 1Q11A 3BILA 3CXUA 4RZXA 1NNLA 1FVOA 2VHZA 2VO1A 4ZV7A 1N2CB 4MPJA 1SCNE 2BFPA 3DFMA 2VPQA 1AKEA 4OQYA 4Z86A 5ITVA 3H3FA 1QNLA 5EUMA 3N2IA 2EZUA 2FRDC 3EWNA 3EXIB 3M4YA 3IBYA 4V0NA 5K03A 1ZEMA 3H1GA 1PDVA 3HUFA 4HAXA 3WL5A 3T3HA 2QE6A 1KYYA 1SOWA 2BLLA 5DCLA 3ZS8A 2NUPB 4CTOA 1T0IA 1JZQA 2C2BA 3TMYA 1BDBA 2QRNA 4ZZ1A 1ZK3A 2I29A 4CG3A 4XGSA 2J6IA 1SIOA 2Y1WA 4UQOA 5L3QB 5LD2C 4CEIA 5C3UA 4EGJA 4PN7A 3PFWO 1TIKA 4TYMA 1KK2A 3OLCX 1ZHOA 2E2WA 4OI1A 1AUXA 4BFCA 1CG6A 3ZGZA 4MARA 3G88A 2XDQA 1LC0A 1P0QA 1HURA 4EZEA 3L8GA 4MWEA 3U9SA 3E9MA 3F33A 2P6MA 3IBCA 3N1UA 3VVBA 3O4RA 2ZTLA 4UAUA 1I14A 3OUUA 5JRZA 2BCEA 1H2HA 2O2CA 2ZXFA 3FYHA 4BO2A 4DIOA 2CW5A 4V2UA 3PKZA 3ZDYB 2MSEB 3RE7A 4KVSA 2J3KA 2O07A 3K30A 3UAWA 1P80A 1EK2A 4KE6A 4BHTA 1Y9ZA 3S1SA 1CF4A 2JANA 5FI1B 1TUEA 5CEJA 2VYQA 1GXSB 3Q7IA 3UNXA 2A5YB 2V7WA 4JI3B 4BNKA 1KI4A 4RQTA 2C99A 2OGUA 3ESXA 1QYBA 3PHIA 1RXVA 2PWYA 1P6UA 3PDCA 3RT1A 1JDBC 4HX9A 3UBTA 3E3LA 3W7BA 5DWDA 2HCTA 4K8RB 4KXQA 1V25A 2R1VB 4N12A 1JFVA 1I1NA 1N6NA 3HKDB 4G6ZA 5EHIA 4C5CA 2JGDB 4KIFA 5AWFC 2ZSHA 2GN6A 1JHRA 3NI2A 5J63A 4ZYZA 4XGNA 1YUZA 4Q02A 4ROSA 2PMFA 4ALMA 1A69A 2CB9A 4YP5A 2X5XA 3QHAA 2ODAA 3DZHA 4H16A 4LGVA 4ZT7A 2B1QA 1U7TA 2PFSA 3Q98A 1VJ5A 5HIJA 1JU9A 1N3IA 1ZMBA 4PFKA 4BO8A 2AOUB 3LX5A 4CIDA 1QC5A 4D6YA 3WJAA 1QK4A 2OXRA 3LKZA 5TMEA 2VDQB 1CT9A 2JH9A 1ETUA 2OHJA 3HXKA 2I91A 3AVUA 1M5UA 2VJPA 3A9WA 4C1NA 2COEA 3IT0A 5K1ZA 5JVDF 1U2GA 2BEWB 3ILHA 1CPYA 2RAUA 2QTRA 5CMLA 1ISJA 1E20A 3WJ2A 4M8NE 4XTRA 5I8WA 4RX1A 5K8IA 4CT4B 4J1TA 1DJLA 3GLHE 4XYGA 5CBPB 4N76A 1QIKA 3U3JA 3IJ5A 2GR9A 3KS9A 2VF2A 1A9XA 2R8PA 3FFXA 2Q3JA 4E2FA 5CFRA 3JALA 4QXQA 4Y0AA 1MHTA 4N49A 3DXZA 3IP8A 2HK9A 3OPYA 5LZ4A 3BXPA 3WQHA 2WKRA 1TTTA 4GOND 5AFSA 1FPQA 1IG3A 2M9MA 1B3RA 2W2KA 5DCUA 3SEQA 3AP3A 5CDHA 2W6CX 3LJKA 1HG0A 3CZRA 1YSCA 1IBSA 2CJWA 3SX4A 4LVOA 1XCLA 2Y3QA 4NULA 3LL7A 5IW8A 2IU0A 3S2FA 3EDQA 4C4RA 1CZKA 1F2TA 2PTHA 4P4NA 3VR4H 4C7VA 3SJ7A 3AJEA 3KZVA 1OFHA 2D4AA 1ZJYA 2BTEA 2ST1A 3SZRA 2FPLA 3QMVA 4ZVLA 4EF6A 5LIRA 1OB2A 3PVYB 5D5QA 4CMEC 3WHLA 3R2HA 2GK3A 4OOEA 5K4HA 5L45A 2CUZA 3CF4A 1GZUA 3ZDCA 4AZ3B 1FC0A 3SQOA 3BF7A 4CKWB 3WQRA 3QPCA 3IAHA 2YRWA 1SD5A 3WGIA 3UKJA 1P62B 3RKSA 3U4QA 3NEPX 1CYDA 2ESRA 1SXJC 4YO7A 1HFJA 3UUGA 2HR5A 3IV7A 3PC8A 2X2FA 2CLSA 3KPWA 3QWIA 1UXIA 1YO6A 3SP1A 4K0RA 4RYDA 4ZCSA 1PWXA 5HOEA 1VBKA 5GONF 2N0SA 4OHZA 5A1TA 2EZ8A 1G8GA 5LIPA 1J56A 1KZ7B 4QDZA 4KRGA 4O2LA 4N54A 4ZQHA 4AROA 2Q1UA 4KYIB 1RXIA 2WP8J 3RIGA 1ZGGA 2ZTMA 4EB3A 1S3GA 3FOBA 5LB2A 3GRAA 3OESA 3U1VA 3V4FA 4QTTB 5BY2A 1IY0A 4FMPA 1FRZA 4Q4CA 3GFVA 2GF0A 4GNKA 3RSFA 3B1WA 3A1DA 3DLCA 4O4IB 3E18A 5BMVB 4Y9RA 5HRAA 4I2VA 1U0GA 4WE3A 2J45A 3TM4A 2ANBA 1NG1A 1NURA 5DM70 1Y1PA 3QYFA 3DEAA 3AK9A 5JZBA 2HEGA 3E6AA 4G97A 3CF4G 2FAXA 621PA 2AH5A 3AHIA 4YXWA 3C7DB 2E48A 2IS1A 4O3FA 3EYAA 4ZXPA 5JXJA 1H3EA 2WABA 5EKSA 2NYVA 1GPDG 1UIMA 3H5VA 3PRYA 4JJKA 1BD3A 1IPEA 1FNSA 4IOKA 5HNKA 4PG7A 4J3FA 4KQHA 5AXSA 4S05A 1E0KA 1S6YA 2V97A 2GFHA 4YJ2B 1N8SA 1P2BA 2CHVA 3WE7A 3FGNA 4IWXA 3TFQA 4BMZA 3LBFA 2ZYSA 1X42A 3R6WA 4JGBA 3UW1A 3I9FA 5KPJA 1G98A 3MUOA 4UPDA 5IU6A 5FBQB 4A26A 4YLYA 4GZ6A 4NQRA 4BO9A 2DPHA 1OFGA 4XX1A 4I3HA 4BNDB 1JEEA 4DCGA 5LD2B 2HB6A 5JBIA 1KFKB 3JTMA 4LSGA 3WL3A 3HBAA 5T8KA 3E9QA 7ABPA 5TGDA 1N0WA 3O8LA 4IRXA 4F21A 3HXMA 4OLBA 4JX8A 3L7NA 4P34A 1TKAA 3K8OE 2BZSA 1LXCA 2HMVA 3DMHA 5C8YB 3R3UA 1G8SA 1R9JA 3T61A 4HH3C 3WI7A 5GAJA 2F1OA 1LI4A 1LS1A 2IIBA 3OCJA 3RHTA 2FOXA 1JQAA 3TR5A 3PXUA 4D80A 2JFZA 3SJZA 3RVOA 4IXKA 1GT6A 2XVZA 2ZJ0A 5JAIA 2CDCA 3B12A 4GZMA 3ZZMA 3DZGA 3GVXA 4P4LA 4WEQA 5H3CA 3RF7A 5E7MA 3G6WA 3GFOA 1WMFA 4E33A 2IHYA 4E5VA 1C1XB 2OORA 4MSUA 3SGLA 1AUOA 1YULA 2ZXEA 4M1WA 4EKEA 1QM5A 5LBIA 3E3AA 4KLZA 3AGQA 1I2BA 5J4VA 3HA7A 2IUSA 3K6RA 5SY9A 3MVEA 1HL7A 1YS4A 5J5AA 3UGQA 3A9QA 2IELA 4Q4AA 5EWLB 3U0VA 2IOFK 1JMVA 1OAOA 4D9MA 2PS0A 2XUAA 4P4SA 4XUGB 3SF8B 4IFTA 4G0NA 1YDMA 4TTIA 3RYFA 3G89A 1RXEA 3K1JA 3W05A 1QDUA 2PWAA 1QO0A 1WE2A 5HRCA 2Q3DA 3V2UA 3VOSA 1B0AA 5GPBA 2EX1A 3DUFA 3RAJA 1JDBB 5I9MA 4BQFA 5C53B 3J7TA 1DV2A 3S27A 4ZOAA 3UWDA 3W5JA 4LGMA 1GUBA 1RXCA 4KNVA 3PUYA 5A71A 4QLBA 3EW7A 4FBLA 4Q93A 1IUPA 1ZMRA 3MJVA 3LM8A 1SUDA 5ANRB 1ICEA 1DEOA 1IM8A 1S2DA 2ERXA 1LPBB 3DXYA 3KKEA 1QP4A 1A8QA 3PDHA 3Q9SA 3AF1A 1OU0A 1U31A 2DYKA 1NJFA 4OB8A 3DO5A 3EDMA 3TI7A 4UTZA 5AKLA 5E7JA 3T1HB 2IGBA 1G55A 1MVOA 2WYVA 4DADA 5FPHA 4N8EA 4LJAA 4QD3A 1IBMB 3BA6A 4XWGA 3UHOA 3VNSA 2PYIA 4E09A 2P30A 2PSJA 3I9V1 1INLA 1VA5A 3WV5A 4X3PA 1ZRHA 3LUAA 5EI5A 2EBWA 5GM1A 5BV1A 1JV2B 1O54A 4MJYA 1Q7EA 2WT4A 4GE3A 1O95D 4B1FA 4DQDA 4E94A 2AMFA 4XCVA 1J7KA 4ZQCB 4AYWA 3EIEA 2AJDA 2BM8A 1AG9A 4G56A 5F21A 1F14A 1GFZA 3CW2A 2WIGA 4P33A 1TQ8A 3RSSA 4DAEA 4OBWA 3H1AA 1N32B 1WULS 5M5BA 4N82A 3NX4A 3EXEA 3RIMA 2IVFA 3DE1X 5K05A 4RYLA 3OT4A 3U90A 4DT1B 1C7ZA 4FHEA 4HWSA 3W2IA 3NTOA 5GOUA 8AT1A 1JR3D 3CGGA 4D9FA 5CT8A 1LD3A 2OBYA 5FBVB 2IT1A 4TXNA 2CDNA 1SG9A 1K1EA 3PX2A 4ZXFA 4BTLA 2CV2A 3FKQA 2OHGA 4EM6A 4DB2A 2WF9A 2QLTA 2R6GA 1L4BA 2FI1A 3LPAA 3LQKA 1FQKA 2OC4A 1YMUA 1MIOB 2WP0A 4OL0A 1ZJWA 4PYMA 3WZMA 2PCLA 4N6NA 3VC7A 3PQFA 1H8HD 1XYYA 2R48A 4FJ0A 2IH2A 2HLDD 4Q1CA 5I4BA 2ZYVX 2IU2A 2N47A 1I3KA 1XRLA 3WRXC 5K45A 1SXJB 2FDRA 4ZJKA 2DBRA 4YVZA 2EATA 2FWPA 2I2DA 2IYTA 3ICWA 2L17A 1QRUA 3V7WA 1HE2A 2GEJA 2QDXA 4MMYB 3G8BA 3NOVA 2HRDA 1KK1A 2WMYA 3BTSA 3VKVA 1RIFA 3ITDA 2Z5GA 3JQFC 4BNHA 2GHRA 3AOEA 4IIJA 3USCS 2VJQA 1HZZA 2CNNA 2YR0A 3FJOA 3F9RA 3MMSA 3K20A 5F7JA 1RCGA 1EAYA 4ZI7B 1QYCA 2YJ3A 4MLPA 3OHPA 4Q7EA 5FBRB 3JQPA 1TUBB 3UB4A 5JZVA 2Q9AA 1WXEA 2I8CA 2OD2A 4UHFA 1XTJA 3EUEA 1F4LA 3OX1A 4ZTUB 3MTJA 4YBRA 4Z9YA 3TVTA 2Z5LA 2KMLA 2C7OA 4GPAA 5DO9A 2PZGA 2G40A 1CUAA 2YNMD 2AOXA 4L27A 4UM5A 3ASYA 1KMIY 3M3HA 1P33A 2QY9A 3OP4A 1Q92A 3STXA 3OLQA 3RVBA 2YJ6A 1D2MA 2ZSEA 5FP0A 3BIOA 2K2QB 4L08A 4G8CA 1FP2A 5CFZA 4XIGS 4ER6A 1UBCA 1X8XA 2BJVA 5A4IS 2HJRA 4FS8A 3UJNA 3H7GA 1KJYA 3PCXA 2CBXA 1XXHB 2QD1A 3QMPA 4NCAA 1H2YA 4ZI7A 3FVRA 4W4LB 5IBCA 3EZ7A 3ANSA 1OFUX 2R7AA 4HAVA 2FFXJ 1KY4A 1JREA 1SKQA 4RJTA 1PZMA 1LQUA 2O2YA 1IATA 4Q47A 3RTAA 2CYAA 2JRLA 1JG2A 4AP5A 2MSNA 4B0PA 2DR2A 5GONB 1GSHA 2E1PA 4JAVC 2CL6X 3SXPA 1WF3A 2Z9DA 2IKQA 2H3HA 1KEKA 2AEJA 4JI4B 1VELA 1P7VA 2AN9A 3HM2A 3QQ5A 4FNGA 5A7GA 1QVAA 3W06A 5DOZA 3ZCTA 1OBOA 3F3MA 2B1GA 3JSAA 4FCVA 1K06A 5IT4A 1A98A 3K9BA 3K9FC 4BFSA 3A6PC 4CN9A 4CDRA 1RJ9A 3MTIA 2ZPAA 3MS7A 2R8OA 3G2LA 2NUAA 4XSVA 2DQ4A 2A30A 1E1CB 1E9DA 4KAFA 4DMMA 2IYPA 3SE1A 3ABIA 3QUAA 4I36A 2OFFA 4IVRA 4MVCA 1F6DA 1WHTB 2GJSA 4RM2A 2C42A 4DQUA 1XZQA 2VAPA 1ZWLA 2V98A 5KTPA 3D1JA 4GVPA 1C7JA 3KLOA 3IUSA 3AILA 3DOJA 4J6FA 4TZTA 2A57A 4P18A 3UCFA 3V8BA 4AL4A 5LWHA 1WPRA 2R7LA 4ASUD 1VXOA 3EXIA 5B30A 3PLNA 3UT6A 2CDRA 2FW7A 5GV7A 1M75A 2E55A 2W2VA 3AFNA 5FUBA 1G3UA 2I8LA 4YN3A 1VSUA 2CHEA 2VPPA 1FFEA 1NATA 1UBKS 1KEZA 1RLOA 2G1KA 2WMDA 3BT5A 2XMRA 3A58B 5FD8A 3DDSA 1K3FA 1EKXA 4LY6A 4B4VA 4KXFB 4PQEA 3VU0A 1FUUA 4FP9A 1TC2A 3EASA 2O48X 5L3QA 5T57A 3A1TA 4CXMA 1DOZA 2RDMA 1PR1A 1T4GA 4GLBA 1NM5C 2H9YA 1V6SA 4MZXA 5CHEA 2KS6A 4LHYA 3H8WA 5CCBA 3EPKA 3ETNA 2V9ZA 3UOFA 2GJ9A 1WCXA 1Q0TA 2OUKA 4QYWA 2XWBF 2MINA 3HB1A 2I4RA 1X3LA 1WLSA 1BJTA 3NVAA 4JQOA 4L4XA 1LJLA 3F38A 2KE5A 1E7SA 3RS3A 4F2WA 2GN4A 4PR0A 3GCWA 1UC9A 1X9HA 4BLTA 5IK2D 1FDIA 5KTMA 1JKIA 4LE0A 3L8HA 5GY7A 3H4IA 2WTEA 4PYIA 2R2GA 2XTAA 2INGX 1YR3A 2ZKLA 3IAM6 3KD2A 1GEEA 4U7GA 3S29A 2ZAYA 5LUBA 2EFYA 3L6OO 3TOSA 3WRYC 5KYXA 4RVCA 4ETNA 3IOMA 4WVLA 3WIEA 4F92B 2C5FA 3CNEA 3D8SA 3JW8A 4LISA 3LDAA 5AKIA 3VR0A 1JU4A 1RWPA 2I76A 3H9EO 1XZJA 4GEKA 3TIFA 1QMPA 4WZBA 3EQ6A 1IB6A 1MABB 2C9OA 1SBTA 3LU1A 3COVA 2Q41A 4ZCTA 4U7PB 3E3NA 4PPYA 3ECAA 3K0FB 4Q6WA 4RY0A 4UUQA 2IBSA 2JD1A 2W22A 3L79A 2B8NA 3D4NA 2I6GA 3V34A 3Q7TA 4NU5A 4BEBA 2R1VA 3NC4A 1Q74A 4U4AA 3O0TA 2D2EA 2M6SA 3S6JA 5TEWA 4WJLA 4FN5A 3JQCA 4A3SA 3G2JA 5IAAA 1PBNA 5KOHA 2YUIA 2W0MA 3E7XA 2CXXA 3HKEA 4F4HA 1QRAA 1XAGA 3TFOA 5TMDA 1KO1A 4H31A 4IJVA 3MMPA 3E82A 4MP6A 2FZFA 2PZMA 1NYTA 3PLRA 2WM2A 5IDQA 5DXJA 5LMZA 1HLFA 3W5IA 5HQTA 1X80B 1PFQA 2Q6OA 3AR9A 2X0RA 3BJMA 1G6KA 2FFHA 4MMZB 4M1EA 1EFUA 1IZZA 1YCFA 4E6KA 3WWPA 1QNFA 3KZNA 1Z07A 3RSQA 5F5NA 4BU1A 4DIFA 1PHRA 1TJPB 4FB4A 1V26A 2G76A 3LQ1A 2BEWA 4FD2A 4QG7A 2AXNA 3OZXA 4MQUA 4LF8B 1R5JA 1XGKA 3OQHA 4OEHA 3S5JA 3KOMA 1FDSA 2E0IA 3PRJA 4KR3A 1R37A 1ZD1A 4K6KA 1Y1QA 5CBPA 4A23A 1J33A 4B3DA 5DRTA 3AEXA 3U4AA 2Q9CA 2BGLA 3JZMA 4YV0A 1OZAA 3LECA 1FP1D 1V39A 3OECA 4GWGA 3NP9A 3IERA 3V3KB 4HDMB 4LX8A 1BXKA 1FUIA 2GETA 2B2CA 2JFOA 3DR3A 4I1SA 4HUJA 3CIFA 3UK7A 1WXWA 4A1OA 4AP9A 2F9FA 3UPUA 1K2WA 2GZRA 1L4FA 3FUXA 4UD2A 3AUAA 3K9CA 3KKOA 1U2PA 1LV8A 5HBGA 1PZEA 3P96A 4IIBA 5DN9A 1EDZA 2O7QA 2XLBA 5CURA 1JMYA 1HK7A 4BUCA 1QR2A 4AP6A 2A58A 4HSGA 1CX9B 4XRGA 1IC6A 4IZIA 2AUTA 3PC6A 3PR1A 4ZZ2A 2OZVA 5TMBA 3HB5X 2Y3IA 4NH4A 5J93A 1JPNA 1NULA 3QVLA 3FNFA 3MCVA 2GD0A 2JJQA 1IBKB 1CB0A 1VMAA 3A26A 4XGQA 4FXPA 1IIBA 1RJDA 3B6ZA 4PZUA 3R41A 1UDCA 5ELLA 3VPBA 3CUEF 1UBLS 4AZ3A 1BXGB 2J7PA 4M8KA 3U80A 1NXXA 1XDSA 2NZVG 4WEOA 4EA6A 3EZXA 2BFEB 3P9IA 1S8OA 1ZGBA 2QR5A 3KZMA 4JB3A 4JJ6A 1BQEA 3LVQE 2HBYA 4QU5A 5JSHA 3DEIA 5DK4A 4EYOA 2NX2A 5BWLA 1KIAA 1U3GA 3F71A 3DZBA 1E9CA 1M67A 4KBFA 3WGMA 1J99A 3EOZA 3VPCA 2GXUA 4FEEA 4QUHA 4UC0A 3ZX5A 1RQLA 5EIBC 5TPWA 4EKDA 1SUEA 4AMBA 3A06A 5TSDA 2CVHA 1R50A 2ZXUA 3TK1A 3T5GA 5ALSA 1BYIA 4DCJA 4P31A 3MSXA 4WPGA 2EDAA 2Y05A 4X0EA 2PUFA 1CFZA 4YAEA 2JLSA 4KIWA 5CA0F 4YRNA 1EEHA 2WAOA 1HUQA 1JI0A 4N3CA 3UOGA 3ZHRA 5A4KA 2JFUA 1Z5VA 1BZYA 1KNQA 2P4QA 4RFSB 1CQIA 4ZAVA