2OKCA

Crystal structure of type i restriction enzyme stysji m protein (np_813429.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
424
Chain Sequence
QSLTKKVWNLATTLAGQGIGFTDYITQLTYLLFLKMDAENVEMFGEESAIPTGYQWADLIAFDGLDLVKQYEETLKLLSELDNLIGTIYTKAQNKIDKPVYLKKVITMIDEEQWLIMDGDVKGAIYESILEKNGQDKKSGAGQYFTPRPLIQAMVDCINPQMGETVCDPACGTGGFLLTAYDYMKGQSSKEKRDFLRDKALHGVDNTPLVVTLASMNLYLHGIGTDRSPIVCEDSLEKEPSTLVDVILANPPFGTRPAGSVDINRPDFYVETKNNQLNFLQHMMLMLKTGGRAAVVLPDNVLFEAGAGETIRKRLLQDFNLHTILRLPTGIFYAQGVKANVLFFSKGQPTKEIWFYDYRTDIKHTLATNKLERHHLDDFVSCYNNRVEIYDAENNPQGRWRKYPVDEIIARDKTSLDITWIKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Type I restriction enzyme StySJI M protein (NP_813429.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Transferase
molecule keywords Type I restriction enzyme StySJI M protein
total genus 133
structure length 424
sequence length 425
chains with identical sequence B
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
A PF12161 HsdM_N HsdM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.30 Mainly Alpha Up-down Bundle Ferritin Ferritin 2okcA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2okcA02
3NMUF 1P1CA 2YQZA 1KPGA 3DLIA 1SUSA 3AXSA 4HH4A 3LBFA 4H0NA 2ZZNA 4POOA 2OO3A 3DUWA 4E2WA 1QYRA 3KPYA 3GDHA 4R8SA 4QDJA 5C9ZA 2PXAA 3SMQA 3G2MA 3GIWA 3P9IA 1O9HA 3EGIA 1RJFA 5DXAA 4DCMA 4NECA 5LQCA 4PYLA 4RV9A 2ADMA 4EQZA 4ER6A 3HCDA 2I62A 3LECA 1L3BA 2AS0A 2GPYA 1AV6A 1FBNA 1R74A 5E1MA 3EVFA 5K09A 4YUZA 2WK1A 4PYKA 1RJEA 5CUQA 1JR4A 3GXOA 3A26A 3IHTA 1F38A 5EZQA 4HTFB 2ZIEA 3TKAA 3IEIA 4AZVA 3UJCA 3DR5A 2C7RA 3NW9A 2H00A 1NKVA 4RTLA 3R0QA 2JHAA 2G8NA 2ZZKA 5EOVA 2IH5A 1NV9A 2OPBA 4CTJA 2AOWA 3NVMB 5K0LA 1JQ3A 2C7QA 3LX6A 1ZHFA 3V8VA 1D2HA 3HCCA 4MQ4A 5K0BA 3MCZA 5DPMA 4RTNA 3NVKI 4YV0A 3ME5A 3NJRA 5FADA 2FRXA 4DMGA 2AVNA 2CMGA 2ZTHA 5DTQA 5ICGA 1P91A 2R3SA 3UJBA 4QQKA 5E9QA 4IV8A 4P7GA 4RX1A 4QTUB 4RTKA 2BM8A 3HCFA 4X1OA 4K6MA 3RODA 4YUWA 3ELUA 2A14A 4M37A 2ZIFA 3O7WA 3GRYA 3B3GA 3FUTA 2UZ4A 1RI1A 3B3JA 5EMKA 1XDUA 3ELDA 3FZGA 5FHRA 3QOWA 2YXEA 3UJ7A 3GO4A 4KRGA 4E70A 2R6ZA 4C05A 3R9XB 2XVMA 5B1SA 1AF7A 1ORIA 3M6XA 3BWMA 3CKKA 3B5IA 1ZQ9A 3FYCA 4QTTB 4YV1A 1O9GA 4PIPA 3A27A 4KW7A 4YUXA 2QY6A 2CWWA 2EX4A 3OU6A 4KVZA 5DRYA 5K0NA 5KVAA 3OZTA 3BWBA 2G70A 3TQSA 3HVHA 2AZTA 2VZ9A 2EG5A 2ZBQA 4DCGA 5LQRA 3EMDA 5MHTA 3LDGA 4GQBA 5EHGA 3EEOA 4X41A 3MQ2A 4MHTA 3M6VA 3B89A 4XUCA 3P2KA 4ER3A 2XYQA 3LCVB 5DM4A 4BLVA 1VPTA 3UZUA 3FRHA 9MHTA 3BGIA 2B78A 4WXHA 3LDFA 5ICEA 2FK7A 5JR3A 2K4MA 2PBFA 4GEKA 5DM1A 2IIPA 4FZVA 3UFBA 4R8RA 4ER0A 5BW5A 4PONA 5EMJA 2IDKA 1QAOA 5ICFA 3TM5A 1EIZA 1RI2A 1WG8A 1ZKDA 5FA5A 2BZGA 3CCFA 3CJTA 4R6XA 4E32A 5LQUA 1PRYA 2JJQA 3KQVA 5E2BA 3P2EA 1PJZA 3EVCA 4PYQA 5K05A 2YR0A 4KDRA 3OE5A 2AOUA 3KQMA 4R05A 4DM3A 2PV0A 1ZGJA 1VBFA 2GAFA 4RTPA 3M6UA 4HGYA 4JXJA 1TPYA 3OU7A 1JQEA 3B7PA 3UWPA 1KIAA 3KKZA 4OQDA 2FHPA 5E9JA 4UOEA 4FSXA 5E8RA 2CKDA 4RVFA 4A6DA 3OZRA 1V39A 2B3TA 5FCDA 3CGGA 3FUWA 3EVGA 2G71A 1NBHA 2H11A 2ZLBA 2AR0A 3DMFA 3SSNA 3C0KA 2AN5A 3I9FA 5HIMA 1XDZA 2PKWA 2KW5A 4U7PB 3UA3A 4QPPA 3GGDA 3QV2A 4KIFA 3DULA 3LPMA 3BGDA 3CJQA 3UJ9A 5BP7A 2B2CA 2ZW9A 1BKYA 5GIPE 3KQTA 1L3IA 3RW9A 4LWOA 3THSA 4GBED 2B25A 4OBXA 4G56A 4FT2A 3BGVA 3G89A 3Q87B 1NE2A 4Z2YA 5CVJA 1FP2A 3G7UA 4PGHA 1WXXA 3PS9A 5CVVA 1H1DA 2PT6A 4E30A 2IH4A 4RVDA 5E1BA 4FT4A 4MIKA 3OZSA 2V74B 2PSSA 4P7FA 4R6WA 2Y1XA 1XXLA 2ZWAA 3DTNA 3E05A 4FGZA 5LSAA 5LQAA 8MHTA 3RIEA 3KPJA 5HOQA 3SSMA 1BC5A 2GH1A 1XJ5A 2BR5A 4RTJA 5D1NA 5FQNA 1QAMA 4DA4A 2ZFUA 4CTKA 1NW7A 1YZ3A 1XDSA 3JWJA 2NXNA 3NDJA 3M70A 5EG5A 1FJXA 1M6YA 5CM2Z 5LQNA 5E1DA 4IV0A 3LHDA 1NW5A 3TRKA 2HNKA 5CCXA 5KYGA 4LECA 1XVAA 2HWKA 3C6KA 3DMGA 1I4WA 3R6TA 5HIIA 2ZBPA 2HV9A 4GOMD 1JSZA 5HILA 2VDWA 1RJGA 4C03A 3AY0A 2C7PA 1RI5A 3FUXA 3IV6A 4U7TB 3MERA 1EG2A 2AN3A 3DLCA 1TW2A 3ORHA 5EQJB 3KR0A 5FUBA 1JG4A 1AQJA 5DSTA 3KPWA 2PVCA 1EQAA 2NXCA 3FUUA 5DM0A 1KR5A 4X63A 3PVCA 4FS8A 3R3HA 4E33A 2ZWVA 2YVLA 4QVGA 1IXKA 4ATNA 1KYZA 3LCUA 3HCEA 5KS2A 5G02A 4Y30A 3FRIA 2UYQA 4V0QA 2P41A 5GOZA 4ER5A 1ZGAA 3DP7A 2PT9A 3F4KA 4ISCA 2PX8A 4IKPA 3HA7A 4AX8A 3BXOA 2P7IA 2VS1A 4LG1A 2PX2A 4RTMA 3BKWA 4PIMA 3OU2A 3OPNA 1SKMA 5HFJA 1G38A 4E31A 3GNLA 3G8BA 2DPMA 3NTVA 2AOTA 3FUVA 3HEMA 2CMHA 5EC8A 3GRUA 3DXYA 3FTFA 3K6RA 3EVEA 3AJDA 5E1OA 5DXJA 4BP3A 4PINA 1I9GA 1Q0SA 4GOND 1VLMA 3MTEA 4HSGA 3G2OA 3UJ6A 5ICCA 2YXLA 1FP1D 1YB2A 3OFJA 5GINE 3PTAA 4X60A 4IWNA 2AOXA 2JH9A 3JWHA 4AZWA 1BHJA 3EGEA 5DSXA 4EK9A 5JUWA 2UYHA 1SQFA 3KPUA 4F86A 5LR6A 3FPGA 2NP7A 4HG2A 3G5LA 2IBTA 3G2QA 1P39A 3KU1A 2Z6QA 2P3LA 4X61A 3PLAE 2Q41A 1L3CA 2VP3A 4RTRA 3EPPA 4XUDA 4PYJA 2P7HA 1SQGA 3R24A 4QPNA 3REOA 3WSTA 2P3OA 5FWDA 3Q7EA 4LWPA 1U2ZA 1UFKA 3FTDA 3ELWA 4QVKA 5LQJA 4OX9Y 1VE3A 3UBTA 5K03A 4MTLA 1ZG3A 3EEYA 1O54A 3O4FA 4C4AA 3FPHA 4P58A 3CBGA 2ZSUA 1JQDA 3A7DA 3FTEA 4C06A 2ZIGA 3P2IA 2IP2A 2O07A 1N2XA 5CD1A 5K0CA 3T7SA 4C07A 2QE6A 5C1IA 3EGVA 5K8VA 4PNEA 1X1AA 5BXYA 3A4TA 2GS9A 2ZBRA 1WXWA 3GRZA 3SM3A 3KR2A 3MGGA 3L8DA 4E2ZA 4M36A 4PYOA 3MCTA 1IY9A 3TPZA 2G1PA 4ZTBA 3T0IA 5T67A 4E2YA 7MHTA 3CVOA 1YUBA 3HNRA 1NW6A 1XTPA 3M6WA 3P97A 5T6BA 5DX8A 4QDKA 1B42A 4YMGA 3G2PA 2XYRA 2PGXA 2NXEA 4GOLD 3FTCA 1IM8A 1N7IA 3SVZA 3ER9A 3P9KA 3G88A 3JWIA 5CVUA 1L1EA 1HMYA 2JHPA 3HVKA 3HVJA 3KQOA 2UYOA 4EMSA 1SVUA 4F85A 4DKJA 2OYRA 1G55A 2EFJA 2GB4A 2PX4A 5EHIA 1YF3A 4PWYA 4AZSA 5K0JA 3GRVA 3HVIA 3TLJA 1N7JA 1X1BA 4KIGA 1TW3A 5KQRA 3PX3A 3OE4A 2IBSA 4RYLA 2QRVA 2ERCA 3ELYA 5U4XA 2NYUA 1YFLA 3MHTA 3A7EA 3FPJA 4GUAA 2P1DA 3DXXA 3LCCA 3NDIA 4FSDA 5DTRA 1L9KA 1QAQA 3M33A 3ID6C 5HEKA 2JH8A 3JWGA 2UYCA 2BR4A 1YFJA 3A25A 4RVGA 3FPEA 4MWZA 5E8JA 4BLWA 2VDUE 1OR8A 1X19A 3ER8A 2NP6A 3I64A 2HMYB 2NNWB 3MAGA 5DX0A 5EMMA 1KXZA 2GA9A 3SR4A 3THRA 5IKMA 1RI3A 4YMHA 1AQIA 1M0EA 3HP7A 5GP1A 3X0DA 4P7JA 2IGTA 4C04A 5BW4A 2DULA 3NWEA 4PYIA 1WZNA 1DCTA 2FK8A 2FYTA 3P8ZA 2E5WA 4OA5A 1HNNA 1UWVA 10MHA 4YUVA 2OXTA 5K0EA 3UJAA 5F2OA 3VYWA 4AUKA 3IYLW 4CXMA 1VQ1A 3HTXA 3GJYA 5K0FA 5EMLA 1Z3CA 2ONYA 4RVHA 4RTSA 2CL5A 2OZVA 1MHTA 5EKXA 3P9NA 3KPVA 3BWCA 4HGZA 3MTIA 3V97A 2HR1A 3BWYA 3E7PA 2EJTA 5FULA 4V0RA 3FYDA 5EGSA 3DXZA 5DX1A 3HA3A 3KQPA 3KHKA 3ERCA 3NWBA 3PT9A 5DRTA 4PCLA 2FCAA 4L7VA 3TR6A 2AOTB 3LSTA 3DMHA 1UIRA 2I9KA 2P8JA 5DLYA 5EKUA 2ZZMA 2OB1A 2QRVB 2V7EA 2Z6AA 4C08A 1JG3A 4XUEA 3BZBA 3HM2A 1JTFA 2AN4A 3SX0A 4CKCA 3I5UA 5HIJA 3U81A 4A6EA 2IFTA 2N47A 2IDJA 1WS6A 2BM9A 3O31A 5DM2A 5GM2A 4FP9A 3UJ8A 4DZRA 3G5TA 5CIYA 3TKYA 1RI4A 2O57A 1EJ6A 3VC2A 3DH0A 3KQYA 1WY7A 2BR3A 1KHHA 2AOVA 2YUIA 4DQ0A 4EKIA 2ZCJA 1DL5A 2YTZA 1VL5A 4P7KA 1NBIA 5ERGB 1R6AA 1Y8CA 2VDVE 1G8SA 3LKZA 2ESRA 3B3FA 2C7OA 1MJFA 4RWZA 2PXXA 2P3QA 1R8YA 2PWYA 5T64A 1VP9A 1FPQA 5DT2A 2O06A 2B9EA 1XCJA 4YV2A 1DUSA 1M6EX 2AOUB 1RJDA 3UA4A 3FPFA 1X1DA 4XCXA 3LDUA 5EIFA 3BT7A 2QM3A 1JSXA 1NW3A 2JHCA 2WA1A 1EJ0A 2EJUA 5D1HA 1JG1A 3PFHA 5EIWA 4AZTA 1Q0TA 2BH2A 3EVDA 1D2GA 3PX2A 3EMBA 2WA2A 4EKGA 1VIDA 2I7CA 3HCBA 4BY9E 3C6MA 2OY0A 3LL7A 5C0OE 3AWIA 5P8WA 5GM1A 1D2CA 2PJDA 4M38A 4PGGA 5FQOA 3KQSA 1VP3A 3CC8A 4GC9A 4CKBA 5KQSA 2Z6UA 1KPIA 3OCJA 1KPHA 3TMAA 4CKEA 1JG2A 5EVJA 1R00A 3EVZA 3UJDA 4KDCA 2PY6A 1EAMA 2PWPA 3QOXA 3I53A 3H2BA 3D2LA 2QYOA 2XBMA 4PCAA 2IPXA 3E23A 4GF5A 3SSOA 5E9WA 3T7RA 4HRAA 2OKCA 3TFWA 4E2XA 5FA8A 4RTOA 3SXJA 3KQWA 2OBFA 3GWZA 5FHQA 5EZSA 4DF3A 2LD4A 3MB5A 2IH2A 2NXJA 1ORHA 2ZULA 4GC5A 1G6Q1 5FTWA 1G8AA 3VC1A 2I6GA 3HA5A 3HCAA 3LGAA 3M4XA 5EPEA 2XYVA 4BP1A 4F84A 1JTEA 3E8SA 4BLUA 5FWAA 2OB2A 3EVAA 1SUIA 3KR1A 5LQKA 2ORED 2G72A 3C3YA 3EVBA 4HC4A 4WVLA 2PLWA 3T7TA 1G60A 5M5BA 3GCZA 3BUSA 4GOOD 5E2AA 3TM4A 5F2NA 1KP9A 3LKDA 3SGLA 3LBYA 4RSRA 5GWXA 4PYNA 1X1CA 5H02A 3P9CA 2FPOA 4PYMA 4B17A 5CCBA 5F2KA 1INLA 5DWQA 5GIOE 1XCLA 3P71T 3KR9A 2JG3A 3I58A 3AXTA 4FR0A 4RTQA 1SG9A 1BOOA 2O0LA 3OFKA 3C3PA 4Y2HA 1P1BA 3G8AA 2XVAA 2F8LA 2HTEA 2H1RA 4HTFA 4OBWA 1YZHA 1QZZA 3K0BA 5EEHA 3S68A 1KYWA 3PFGA 2Y1WA 5HZMA 5CVEA 3TOSA 2YXDA 4ER7A 5K0GA 4O29A 2P40A 3GU3A 4QQNA 5DTMA 5IH3A 1NT2A 4M7RA 1R18A 3ANXA 2P35A 3GRRA 2O05A 4OQEA 2ONZA 3KQQA 4EVIA 5K01A 1I1NA 2PXCA 5EEGA 4YUYA 4CWAA 3BKXA 4OA8A 3DOUA 2GLUA 3CJRA 3PB3A 1F3LA 1NW8A 1R8XA 1QANA 1NV8A 2YX1A 2AVDA 2ZVJA 1T43A 5CVDA 3VSEA 2PX5A 4KWCA 5HIKA
chains in the Genus database with same CATH superfamily
2OCXA 3WLSA 1L4GA 2HXGA 3B5EA 3DDHA 3HK2A 1FFGA 2REQA 1T8UA 2ZZNA 2B34A 2OO3A 3OZBA 3ASUA 3IEPA 4XWGA 4RY8A 4R2XA 4FQ7A 1I7QB 3HB5X 1O9HA 1ECGA 1JZTA 1RJFA 3C24A 4QDZA 1M2HA 1THGA 3IKVA 5DGIA 1QH1A 3TTSA 4NZOA 4F3KA 1BZYA 821PA 4KR6A 5DCLA 5IJ0A 1GRCA 2JGMA 2WK1A 4PYKA 4PQGA 4DCUA 5GOTA 3CCCA 4PX3A 3H16A 2WLUA 4N65A 3U7EB 4QGSA 3WTBA 3EZNA 1R9JA 1CRZA 1X77A 5SY4A 5K7SA 2R5WA 5IXYA 4XTRA 3VTFA 2WG1A 1C0LA 2B4KA 3IHLA 4NMMA 4YGYA 2I4OA 5KSZA 2ISSD 1NN0A 3THWA 3AL2A 4NCAA 2AOWA 5KWEA 5DN6A 4DV4B 1F6WA 3ZE8A 3ZDAA 4DMHA 3I28A 1NBMA 3HEAA 4MQ4A 1JZSA 1G9SA 4COOA 1T35A 5IAGA 4XB2A 5KOYA 5IKEA 1IOWA 2MT9A 5BN4A 2PV7A 1E9FA 2C1XA 3RK4A 3WVWA 1V71A 5H7XA 5BR7A 2FX3A 3TLXA 4MLZA 2QAGC 3ELUA 4XEHA 1Q1ZA 2A92A 2IYYA 1EHCA 3DVLA 5LBUA 5KAPA 1X9IA 3K7EA 4UM5A 3UAVA 2XUAA 2BFEB 3P0RA 4TL7A 3GO4A 4KRGA 3KXLA 2QGFA 4OX9B 4N0PA 1MC5A 1Y9AA 4DDUA 3FYCA 1RTKA 1TAQA 1GN9A 1Y7LA 3CLSD 3TB4A 2WIJA 4BO4A 4LF8B 4PGMA 3MMZA 5KDLA 3H3JA 4C21A 5KQLA 1UINA 1EWRA 1G8HA 2CXTA 5IBPA 1E5XA 1R0BA 2XOKA 3BMNA 2Y6UA 3SJUA 2VZ9A 2VCEA 3E9CA 1DRVA 4N8SA 2G77B 4RSHA 4BIMA 2XRZA 1P80A 4QRHA 1CDOA 2YY6A 3LNTA 4M55A 1ESZA 4RIFA 4TYYA 1Y33E 1FUKA 3DZHA 4FFSA 3QFHA 3UQYS 4ZYYA 2I6UA 2NVWA 2H5LA 4Z54A 4ICIA 4UE3S 1PT9A 4BNTA 3MJ4A 5EIXA 3S8EA 1DBSA 4X71A 2JA1A 2R11A 3CUEF 4M83A 1CNEA 1N0IA 1DELA 1F4LA 1P4AA 1Q17A 1RAIA 1XT6A 1YFZA 3DDNA 3IOBA 1KS2A 4HFMA 5BW5A 5IS2A 4IJ5A 1GSHA 1QAOA 5HRUA 2XGGA 1GNRA 4FGJA 2O50A 2ZB7A 4MV0A 3N8GA 3T1QA 1QR2A 3JARA 4ODIA 3UT5A 5BSMA 2A88A 5E7MA 4J3NA 4DUPA 5KVCA 3LLVA 2V7PA 3G0GA 2Q0XA 1A9PA 4OHXA 2UUAB 2HJVA 1W59A 1Z29A 4LPKA 4XWTA 4F97A 4CKZA 4G89A 1E4EB 3WLKX 2B8JA 4NU5A 2R6HA 3GLHA 4P36A 1PL0A 1U8UA 1W4BA 1Q7RA 1A8QA 1WAMA 2EZ8A 3CURA 3D8UA 1H2YA 2IL1A 2BFAA 3RRXA 4WKBA 1CR0A 2Z8ZA 4MR7B 4XZ3A 2C78A 1H1LA 1RYYA 2Z3WA 1QG4A 1ZS9A 3A3OA 1P4HA 5JJCA 2AN5A 1QHEA 4YP6A 2BSAA 2C98A 1GTVA 3QLEA 2PKWA 3ZBUA 3ZGXA 3RRYA 4KFTA 4LDPA 3ESYA 3DV9A 1JUDA 3PE4A 1UXOA 1FUYB 2V7XA 5ELMA 4LF9B 1E59A 1CQPA 3AQ4A 5DF1A 4CIAA 4GPD1 3TLZA 1G98A 3PVTB 2R8XA 4NBNA 3EWIA 3GLFA 4QRIA 1PJRA 2I6FA 3OUZA 4P4SA 3IJRA 4HH0A 4K5QA 5CVJA 4C3ZA 2ZIXA 4GWKA 4P0TA 3IBFA 1C8VB 1N3BA 2VJDA 1GRRA 2WHEA 4S05A 3ZHQA 3CF6R 3WBBA 3TL3A 1CFZA 1DBIA 3KHTA 3T1OA 1WXIA 4PO3X 3RRFA 1NU8A 1XXLA 3DOFA 4FGZA 1IVSA 5BVHB 4Q18A 5HOQA 2WIGA 2BR5A 4NJEB 2OHJA 4ZI2A 1BDHA 5FQNA 2QTGA 5FA6A 4BJ5A 1LK7A 3H2SA 1TJ4A 2E18A 3L6UA 3MLEA 1RPZA 2IEGA 4LJKA 2JI8A 3HU1A 3LP6A 1SCJA 2VP6A 3GRPA 1B43A 1VLQA 1YZ3A 3NDJA 1Z45A 4O33A 5IKOA 3R3WA 1Z25A 3PU6A 3TZHA 4D3ZA 1AGXA 2GS4A 2WU1A 4YXMA 3UENA 4M46A 2WAAA 8OHMA 1GARA 1J0DA 1TEVA 1QGDA 2PS9A 3V7NA 2UVPB 1QOZA 2FPIB 2OGTA 1RDFA 2WHXA 1VG0B 3NHSA 4L5BA 3Q3HA 5HILA 2OOSA 2BE7A 2GPJA 2Z08A 2I65A 3E82A 1RI5A 3LIPA 3QUCA 4HBGA 1T8TA 4NYMQ 4MVJP 3V42A 1G1AA 2FJ0A 4LYGA 5EQJB 3S5JA 3ZE0B 5AI0A 5CNJA 4RPKA 2PVCA 2H1WA 1L7RA 5G0SA 3IB3A 3UMFA 4LVOA 3O8BA 4MAFA 2QAGA 3C3EA 3DLAA 3QW4B 3AUAA 3CNBA 1NTOA 4AQDA 1RCTE 2F9LA 1HDXA 4FYMA 4G63A 5FO0A 1TVMA 1XX6A 2PDAA 2W6MA 5BWBA 1YBHA 4EMUA 3E5NA 4QEDA 3NBXX 1LNQA 3QVVA 4MW7A 1OXVA 4S35A 4UNIA 4DCNA 5FWXB 5KYTA 3N2LA 3DQQA 4ZI7F 3ZDBA 2HRCA 2VN8A 1S9HA 1PO7A 4OBEA 1Z6OM 2WJ3A 3F4KA 4EZEA 2LWIA 2D4AA 4AX8A 2P7IA 1E6EA 2VS1A 3MTGA 1QRTA 3ASZA 1OE0A 1X1SA 4RJIA 1NG9A 2F62A 3EZUA 3KUCA 1G38A 1BD3A 3DV2A 3H5TA 5HM6A 3WGKA 2GO1A 4LJ7A 3GNLA 1XVLA 4EGJA 3T1VA 2AOTA 2JLXA 3FNGA 1ZLXA 1OKKA 1BKSB 1UMCA 4HQRA 4H31A 1Y1QA 2EIHA 1FNSA 1D8AA 3K1YA 5SZKB 3WC4A 1JR6A 3T1HB 4J16A 1P1IA 3BFJA 4EPYA 1EMDA 1NUUA 2GMWA 2QZ9A 3N0XA 5LYJA 4XGSA 4WERA 2I71A 4A6PA 1NVBA 1UJBA 4IMRA 3ASVA 1A0OA 1QQ7A 1YB2A 4NCHA 4RK4A 4D1YA 1KJIA 2SBTA 4QBTA 1YDEA 2YXNA 4J3FA 3EGEA 4MR8B 4PY2A 4EB6B 2VP5A 5JUWA 2UYHA 2AEJA 2EYUA 3K4PA 1H3FA 4GMHA 4BBJA 2LKCA 4CDNA 2IBTA 2C57A 4LS3A 1ZM9A 4W7HA 1UC8A 1LKZA 2Q5FA 2XVYA 4DYDA 3P96A 1WKVA 2P7HA 3R24A 4PU0A 5ESXA 4JL8A 1ZOIA 4NNJA 5IF3A 1QQBA 3I42A 2JHGA 1UFKA 3AINA 3PRKE 5GU0X 5JKMG 3B8HA 2NTYC 4FFRA 4BLOA 3V7WA 1C1HA 1G5IA 4MK4A 3QV1A 4X1KA 4BFSA 5ESRA 3ANYB 4R8SA 4PPNA 4WPGA 2O07A 1PZFA 1E7QA 3QVUA 1QYCA 3R2JA 1U99A 1BN7A 3T7SA 4JT2A 1OWNA 3BVLA 1ZMBA 3MW8A 4AM8A 4D6XA 4EHHA 3OKAA 2B2NA 3UWDA 1P3Y1 1IEVA 4DARA 3WGTA 3LY7A 4KTVE 4DNFA 3FR8A 1G5TA 1NVAA 1USWA 2R8ZA 4BFYA 4PN3A 4KQ1A 3CVUA 1AKEA 1DG1G 1GR1A 1K7YA 1NW6A 5HJFA 1PEKE 1TJPB 2AUTA 2OSBA 2V0NA 3AX6A 3B6MA 1DC6A 4QG7A 5SZHB 3UKOA 1AH2A 1SBIA 4Z1MA 5JD6A 2PGXA 3PVZA 1KAQA 4U8HA 3U3XA 4TOEA 2H52A 2J5RA 3SXUB 3V1KA 4EJSB 2XITA 3F8WA 3EAQA 4QBFA 3OM0A 2DCMA 2V3VA 4YXWA 3RBCA 1AGYA 1L6RA 2BM1A 2V65A 4OKSA 1VLZA 4P34A 4YMLA 2ZBFA 2QK4A 4F85A 2IGBA 1G55A 4JJ8A 4WJLA 1Z06A 3DAHA 1COWD 2AFIA 3SR3A 1Q7CA 3ZVNA 2FRVA 3K0EA 1I3NA 2UUBB 4CM7A 1QHFA 4J2HA 2F59A 2ZDHA 3P0JA 4EVBA 3PX3A 1IN1A 1ZISA 2COUA 4YECA 4GNRA 5CGZA 1DCKA 1UP4A 3NDIA 4UM9B 1YOBA 4B76A 2C5EA 3VU0A 1IXYA 3VZQA 1E0JA 4TPKA 3U4QB 2VDUE 1V41E 3VU8A 4F4HA 2P9YA 2VRCA 4E0BA 4P0QB 4JWKA 2F1RA 4HQ6A 3ITNA 4L6IA 4HVAA 5KOHB 4YMHA 1WOMA 2Y92A 4PLVA 4ZHSA 4I0WB 3L7MA 4CM1A 1ZUNA 4YKHA 1J22A 1IJEA 1FLVA 1XAHA 1JDNA 4B4WA 4QJIA 4C04A 5BW4A 1AMUA 2ZWIA 3ICCA 4H7JA 1WZNA 4RV5A 3BFXA 3HVUA 3A68A 2IRWA 3Q1LA 3R7BA 2E5WA 2OORC 2V03A 1LJUA 5AKKA 5DNEA 5EP2A 2O7RA 2OXTA 2W22A 1OPXA 2D1FA 4G2TA 1VQ1A 1PYDA 2J7PA 2YIJA 1LDMA 3EW9A 3V8EA 3M9XA 1K6IA 2DHDA 4D0NA 4GI1A 3EUFA 3WNZA 3LC1O 5JSZB 3AILA 1KY4A 3H19A 5LIPA 2P30A 2AMJA 2CJWA 1GQQA 5K45A 3EEIA 2J3LA 1AVTA 3E03A 3PT9A 4JGBA 1L1RA 1XKTA 1YVUA 2FCAA 5NLLA 1AHNA 4BQPA 1GKKA 4INJA 5A4MS 4DSTA 2EP5A 2P6UA 4II7A 3BMOA 1TUBA 3FKJA 3NDBB 2VXYA 1Q7TA 2XLCA 2X9LA 2OB1A 2DWUA 2GK7A 5F1YA 1PG5A 2QR2A 3WYCA 1B71A 2FP3A 2KMLA 5MN6A 3BXXA 4FINA 4OFXA 5HIJA 4HB2A 3S44A 3MEQA 3WK7A 2UXBB 1I0IA 5BNWA 1ISSA 4QFMA 1BVRA 2I2CA 5C7YA 1TM2A 3V8PA 2PL9A 3EZYA 4WINA 4QJ3A 3DH0A 2CXOA 4J75A 4ZVLA 1P2UA 3I8XA 1TU4A 1YJ5A 3GJTA 2BR3A 5D85A 5GJVC 2ET6A 3V4LA 3GCDA 4DLYA 3G0OA 2YN2A 5D8SA 4WY2A 4YBZA 4PPQA 1SQ3A 2Z6QA 1E2QA 2HDHA 2GPAA 2C7OA 3RYIB 4C2BA 2G0TA 3QLUA 4KITB 5TJHA 1WHTA 1DC7A 3LYLA 5EL0A 1Z62A 5T64A 5TQJA 3U3ZA 2WTUA 1UBKS 1DUSA 3WHLA 3CE6A 2NAFA 2XTNA 4I9FA 1H0KA 2Y68A 3TTVA 4JX9A 3S3TA 3UT6A 1KVQA 3SF0A 4JJ4A 2REBA 2ZS7A 4N6NA 4HX5A 3F32A 3PFHA 1XTQA 2HHHB 2RGDA 4DWVA 1Q0TA 1XRJA 2GWRA 3EVDA 4LBWA 4WGGA 5LP1A 4CEIB 1T2VA 4QNMA 5D2CA 3OFNA 4P4GA 4KL8S 4K40A 3U61B 3U48A 1JHDA 2PQ2A 1I1QB 1B0UA 2B1IA 2VDWB 3K0HA 3OBBA 4IIJB 3PBKA 3O2JA 4WKGA 3CC8A 3INGA 3L7OA 3V4PB 5TPZD 4ZMRA 3LDHA 4RXUA 1G8FA 3LC2O 1LJ8A 3L3BA 1MVLA 4FMCF 1RXVA 3ICQB 3C5HA 1NQOA 1T2DA 3D2LA 1QG2A 3P9YA 4D80A 3E70C 1DOHA 1XIVA 2O6HA 3MGKA 1MB9A 2CVHA 3N3AC 2GEBA 3X1JA 2C7BA 3DO6A 4ZVMA 3SQWA 2HSWA 2H51A 1C8BA 2J85A 3ZWCA 1XDDA 1CY4A 1N3LA 2VHZA 1IYZA 3G6KA 4FW9A 2X0DA 4AUMA 4GC5A 5KNBH 4FFPA 4X6UA 4AJPA 1DXOA 2BHTA 4F8EA 4Y2TA 3FLEA 1PVVA 3M6FA 4IDCA 1EFVA 3L04A 5EXPA 4JYZA 2K6GA 3EOAI 5J4LA 3FHOA 3MJFA 2R6JA 2OT3B 2ZIWB 4S1PA 4YP1A 2AK2A 3O8QA 3I5YA 3OJ0A 1X14A 3R3YA 4KPFC 3V8NA 4WXPA 1C4OA 2NO1A 3CZQA 5BN3B 2A33A 3FFWA 3A8TA 1GM5A 4B3FX 4MHSA 3ZGYA 4UHFA 1U1EA 5A4FS 3RADC 2YVQA 4IYRA 1MEEA 5DCUA 4JJFA 2WI8A 1RIFA 3GZNB 3NDPA 4WFJA 2GM3A 2FUG6 3JD3A 4PYMA 1JEEA 3QLTA 1Y3IA 2FPRA 4MMZB 3RYFA 5LXTB 3FFTA 1NXQA 1JBKA 1RHQA 2Z6VA 3AY7A 3AR8A 3QWFA 5LA6B 3ZHZA 4NQRA 2PNJA 2W2KB 4BZXA 1JLRA 1UIMA 1V95A 3FPKA 4QE3A 1GA1A 5H3LA 3HPQA 3TOXA 1G3UA 5C35A 1ZH8A 2Y3IA 1ZJWA 2BT4A 2W6JA 1YVPA 1NR7A 2W8ZA 4J9VA 4PZDA 4TYPA 1U7UA 3ZNPA 5K0GA 5ALWA 4KSCA 2V8TA 1HNZB 3JR7A 3UEOA 2F1HA 4LY9A 3GT7A 3AVXA 2DLDA 3SHQA 2NT3A 3LOUA 2C41A 1AKRA 1JIKA 2VUTA 3ZBPA 2HA7A 1E9EA 4DG5A 1M54A 4M7PA 4GP7A 3JVEA 3O84A 4HN4B 1VCHA 1GG9A 4EMBA 2BP7B 1MEJA 1NA5A 1RM5A 4WUTA 1Q0ZA 3SHXA 1JMKC 3QFSA 1EA7A 3VV3A 5AUOB 2IS6A 3FKSA 2ZVJA 3CW8X 3NBUA 4HYEA 1T3ZA 4DYHA 5ALVA 1FF9A 1I32A 1E2DA 1SUSA 1Y5NA 4RJLA 1W93A 3H7GA 2CXQA 3S27A 2EIXA 4G1BA 1TQDA 3HO6A 5A1TA 1HFEL 2ZUWA 3ISTA 2VBCA 2DPLA 2FWPA 2V0CA 1I3LA 3F1LA 3R40A 2FN3A 4IH1A 3RVNA 5C9ZA 3TPFA 3SQMA 3WDKA 1WNTA 4NECA 2W9XA 4KXNA 4Q01A 5FR1A 1MZPA 4EQZA 2C99A 1PHPA 3ROZA 2I62A 3U0VA 3LECA 2XHEA 1T5IA 4AJEA 4DDHA 1XRNA 1ZCAA 1CUJA 3P20A 4JP1A 2AUMA 4Q16A 5CUQA 3H2KA 2PKQO 1NX9A 1QCZA 2HIMA 1YGPA 3Q3IA 1JWLA 3RS5A 1ICEA 1TLTA 2N46A 1W0CA 1NLMA 3FPBA 2PGDA 3ENNA 3PCTA 3PWKA 1THZA 2H7CA 5G0WA 3VPCA 2PYIA 2QVGA 3OCWA 3NNNA 2FEKA 4IDHA 4UNRA 1O4WA 1WMFA 2X7HA 4Y1GA 5JJBA 2IH5A 3B1WA 3ZVKA 1GPYA 3NS7A 2RHCA 3WA6A 3Q8XB 4AW9A 1H9CA 1W0JA 4DMMA 2VA8A 3QXSA 2Q2QA 4KI7A 4NENB 4P3XA 5AHWA 2ATEA 2D2XA 4CG2A 1TJYA 3LC0A 2AVNA 4E5MA 4MQ6A 1VZ2A 1Y8RA 1XZJA 3EDMA 1P2GA 4EVCA 3AHCA 4P7GA 5AD1A 3I61A 2QZ4A 1WB9A 3AHDA 1QJ4A 1KGSA 4C6SA 3QU5A 4M37A 4HDKA 3TLEA 4BDSA 1W6RA 4Y08A 2CHEA 3TTTA 4CKXA 2HJRA 2GJAA 3T3GA 1EHYA 1DV1A 4DLSA 4UUAA 1ISRA 1LPBB 1N2ZA 4MZDA 2E4AA 4YA6A 3ABOB 3H99A 1A2KC 1TKRA 1ACLA 3MCWA 1WJGA 1R0WA 1V8ZA 1OFGA 1Y5RA 4MV8A 4ZI7B 3CKKA 1J39A 2BFDB 1AHIA 1PG0A 2J6CA 1B8VA 1MT3A 3TIGA 2AZTA 3GT4A 5TVGA 4L8FA 3TRFA 4X94A 3K4HA 3EMDA 4TUYF 5LQRA 3AK8A 1L7MA 5MHTA 1MA0A 2FW7A 3R0JA 3DTVB 3C3BA 3PT5A 1J21A 2WHRA 2FETA 2VEDA 4IUDS 2EW2A 1WP4A 2KS6A 3LCVB 3ECAA 4ROSA 3VO1A 4DDWA 4OD0A 2CVFA 3KP1A 1WMEA 2HMWA 2C9MA 5HQ3A 4HD8A 2GJKA 5EIBC 2VCHA 2XQIA 2QB5A 2IIPA 4FZVA 3GPIA 3AESB 2R44A 1KIMA 2JD80 2ZAIA 3C87A 4TLCA 2VFAA 4ZQHA 2B83A 4DWOA 4XXHA 3IPYA 2B21A 1RXIA 2IXAA 2IEAA 2YR0A 2NQ8A 3LE8A 4RC5A 3PHBE 3T15A 1W30A 1M76A 5DU2A 4FU0A 3STYA 3TUIC 1TIKA 1CU1A 3WE7A 4N47A 2WOJA 4HGYA 2X0IA 1E1QA 5AOAA 1CQWA 4ID9A 4JXJA 5GPBA 3HGQA 1UPXA 1VKZA 3Q5GA 4HAVA 3ZLTA 1GCOA 1JKMA 3B7PA 4KSBA 1WHSA 1PVOA 1YVEI 2FHPA 3AF8X 2BC9A 1DGQA 1JR3E 4WN3A 2C3OA 2JAOA 2RHBA 1I2DA 4R40A 3DOCA 3BTVA 3TXXA 4R2JA 2OMKA 3LBHA 5DYIA 3RWMB 3BDAA 5AVQA 1Q6ZA 2HIGA 1XDZA 5TQ0B 5C4GB 5AJVB 1U3UA 3L0YA 1A3CA 5J5AA 4RPHA 2C2JA 2Z0MA 3IERA 1YZLA 4W9RA 5BP7A 1DFHA 2A9FA 2VNIA 2PFSA 4QNRA 3VJRA 3RW9A 1NQUA 1JMYA 1RQLA 3NXKA 2JD1A 1BHSA 5FO1A 1OLUB 4RY0A 4TRNA 2HDWA 2ID7A 3AL3A 3IEXA 4IO0A 4TZKA 3SR0A 1BXGB 3V7FA 1NY6A 4KIJA 4ESEA 3R4CA 1BOFA 1BX3A 1IB0A 4TYNA 2HWYA 3HN2A 3TLGA 2RAFA 2PSSA 3GROA 1FNBA 4YT4A 3IA7A 2KLBA 4P5DA 4WJKB 2FQYA 4NC9A 3W2TA 1KZ1A 1BC5A 3N7AA 1JXAA 1IVNA 4DY6A 1JIQA 1I3CA 4ZTZB 3JQRA 1N3YA 1KJ9A 2AWNA 2NACA 4O2LA 5AP9A 3RJTA 5CDSA 1TU3A 3JD4A 4OHUA 1H3NA 2OG2A 4EF6A 2VOEA 2NZ8A 2PVSA 4UKDA 4ZO8A 4F0JA 3HSSA 4MKHA 4HAOA 2OV1A 1XRRA 3I83A 4LECA 2H2WA 4LSGA 1UBJS 2IXTA 4BVKA 2NU8B 3UG7A 3WGMA 3HRKA 5K8IA 1SXHA 2IHZA 1VXRA 2QJRA 5CP8A 2XUFA 4NEQA 1IY1A 1E2EA 1EFLA 1U8ZA 1ZQ1A 1WDLA 1GZSA 1W76A 1V96A 1H94A 4EX6A 4M87A 1VLVA 1JPJA 3CZ4A 3RU7A 1YACA 1Q0QA 1DEAA 1N3IA 4Q6WA 1UH5A 3L40A 1EX7A 2W4IA 3VGJA 4DR1B 1DLJA 4L3VA 1R27A 3OZVA 4K9RA 5AKZA 1UBHS 1CS0A 1CY1A 1MIOB 1NULA 2G7MC 2PBRA 2RHDA 1FW8A 1VL8A 3D0RA 3TXYA 1I5OA 5DNVA 1UMBB 1PJQA 1DAGA 2C5BA 1WVGA 3F4LA 3VDRA 1X2EA 1XZMA 1YRBA 3OJFA 3A36A 1X80A 4F7DA 3K70D 4OP2A 3ZE2B 4DE6A 2PZLA 4G1FA 3ESZA 3SZ3A 2IF0A 2EL9A 4B8ZA 3ZS9A 2VDPB 3MBOA 1SVSA 3O8CA 3Q4GA 4UVGA 5I7EA 1SU7A 2UVDA 3QA3E 1EUDB 2CBGA 4N01A 4TKMA 2E4VA 2RFLA 2E4UA 3UWMA 2ZUCA 1OBOA 2QZPA 4H7FA 4TTTS 1TU0A 4RTMA 1BDMA 3AONB 4JVSB 3W78A 3VPHA 4UEWA 3SP1A 2P9FA 4LDNA 4BMZA 1OFIA 2WJ6A 2C1EA 2V6FA 1B4DA 3NHWA 4OYHA 1U28A 3S29A 4KO3S 3B2NA 1MEOA 3OIFA 2IUYA 4RM2A 2ZBUA 4EY4A 4ZEVA 1JA1A 2R6DA 5LJIA 2HBZA 2JD0A 2XYGA 2J08A 4PF1A 4UFNA 4WXMA 1KZHA 1J09A 5JQGA 3A6LA 5KNDA 2J5QA 3BHJA 3HDTA 1NL3A 4GOND 1VLMA 2CNOA 1JSLA 3G2OA 3ONEA 4PNPA 4JP5A 5AHRA 3UUFA 3I2KA 3GA5A 3JTEA 5B3JC 4FX5A 3EXEA 3AF9X 1P9RA 4W1PA 3WADA 4EK9A 3UQZA 1A4IA 5CX1B 3P2MA 5F12A 2QG4A 4NOMA 3U1BA 3L4JA 3NM6B 3B6IA 3W3AH 2P3LA 3MXTA 4HLCA 1EFAA 5K6AC 5D8PA 3D3KA 3FFBA 1SQ0A 1JB9A 1WZCA 3KUUA 3NWOA 4TYQA 2FE4A 3B60A 1R3UA 3K15A 2Z4TA 3Q7EA 3GY0A 3NUZA 3BERA 3MQ4A 5TNXA 3O4JA 4XX0A 3T35A 4Z3KA 3KETA 2XRYA 1QKJA 4PTYA 4YMUA 5FNZA 3AO0B 1A88A 2H3HA 4FBLA 4GLBA 2ZIZA 3RKSA 1J0AA 1WXQA 2XUIA 4K9QA 4P58A 5JQGF 3WAGA 1VDMA 4L4SA 5AFSA 3NR2A 1NNI1 1P7WA 2C2KA 2KYRA 3TEMA 2CLKB 4XRRA 5FF9A 2C95A 2ZOSA 2ZYHA 5DKFA 1QCDA 1ZD8A 4F56A 4DIOA 4RLFA 5K8VA 4BB6A 3WRXA 4MKUA 4IEIA 4MB6A 1OI3A 1NMZA 2IUSA 3EDQA 2G28A 4YBRA 1SUFA 1XD2B 1U7PA 5K6AA 1QU2A 1K3FA 1FLAA 4CQLB 4TMWA 1KI4A 4ITTA 3CVOA 3BT5A 3FDFA 3T5DA 5B4VA 1Z2NX 3PD0A 4I7EA 4Y2PA 3VBCA 1VCNA 4XW2A 3TIIA 3VAAA 1I4LD 2OLKA 3MPUA 4OATA 3PVYA 3EGDA 2YZGA 3ISJA 3NG1A 4R2KA 1OU0A 2VJNA 1DFGA 1GITA 3M83A 5CVUA 2I2FA 1VIYA 2G83A 3HDJA 4I5FA 1I3MA 1KORA 3W7BA 4H4CA 1ZNWA 5EHIA 5KMGA 1WPRA 2A9RA 4X0JA 2E4WA 3LSYA 2DWOA 4XH9B 3NGXA 1ZDMA 1NVWQ 3VZCA 3ZS8A 1JH8A 3MGAA 3KD2A 4X3PA 4MRMA 1PDWA 2J0EA 1MJHA 2GBGA 3LNCA 4O2AA 3PL1A 4CIVA 2DY1A 1N0WA 4W8GA 3DNFA 3ZXUB 2BFBA 3MS4A 5AM2A 3D5TA 1BWPA 2IZOA 1CUYA 1Q19A 2YHSA 1EVYA 5JPDA 3EARA 4MVJA 4PBRA 4EO7A 4H3HB 3V4VB 7ABPA 4HDRA 2XXAB 3RUFA 4KQIA 3HBNA 4IF6A 5AO9A 5A3VA 1KXZA 2VVTA 1I5EA 1PR5A 4RETA 4A82A 2QJOA 4HEQA 1Z12A 2XKQA 1NBEA 1P60A 2GBCA 4BUZA 4LFBB 1J5PA 4W6ZA 3IUBA 1SKQA 2FYTA 2PUJA 2QJFA 1BU8A 3IKLA 3KJIA 1AY0A 3F38A 2GFHA 3P8ZA 3VHRA 10MHA 3ZBQA 1OYOA 2FP4A 3F9RA 3D8BA 4M98A 4D3YA 2B4RO 3P52A 1SD2A 2H0QA 3NETA 2JGJA 2ZREA 4O4LF 2YRFA 1E2MA 3ZK9A 1JIGA 4BNDB 1ZM7A 2IYFA 1BWQA 3QPDA 2CL5A 4RVHA 4CF4A 4B4VA 1S4MA 3AK4A 3KPVA 4X62B 1XD8A 4ZOLA 3MTIA 1ODKA 4XRGA 4TZ6A 3GLTA 1JU9A 5C3MA 3OUTA 1UBNA 1C3EA 3G6WA 4NXMB 1UC4B 3BXGA 3KQPA 1GNSA 4C4SA 3T1TA 2FDCA 4DJAA 5HA5A 1NVDA 2ILTA 1Y4AE 1NP6A 1WQ4A 2MYUA 3GJ7A 3CF4G 1FNDA 2V7EA 3A9TA 4DIKA 5CG2A 2VT2A 1VFNA 4XOIA 1XEAA 3PQ8A 2F55A 3C1YA 3K09A 1CUZA 3ZTYA 3KEFA 1B41A 3K3PA 3WKAA 2Q1TA 4PLFA 1VI5A 3FYSA 4L5JA 1RLUA 3NTLA 1Y8QA 1LRJA 3G5TA 3GOHA 3GZ4A 3A1SA 3HLTA 4PO9A 3ONWA 4D3DA 1OH5A 4AWAA 2GF2A 7AT1A 3BE4A 3RU9A 1IBRA 1IHDA 3N59A 1KHHA 2AOVA 2VHEA 1TD9A 5BRNA 4LXTA 1XB2A 3AKZA 4GOKA 1EP3B 2X0KA 1U1GA 4LYXA 5GGYA 4I9NA 1R5JA 2QE7A 3L1JA 1QFXA 1LX6A 1IRXA 1EVQA 2FZVA 1AZWA 2H29A 2KI5A 2DH6A 1KETA 2LE0A 2P3QA 2PZMA 4KMMA 1VP9A 3IAXA 3GC6A 2O06A 4NARA 4WZAB 5F35A 5FFNA 3RSFA 4LQLA 1DPGA 4BJHB 2CLLB 2QD3A 1OB5A 3PKZA 1XHFA 3IUEA 4RK6A 5EIFA 3BB4A 2WJYA 1KKLA 3LVBA 2HU2A 3G9UA 3IPRA 4UHBA 3TSOA 3ZCQA 1EFPB 2XB9A 4F46A 1L4LA 1RM3A 4KU4A 3RS9A 1N9GB 2BZ0A 3F97A 2P4EA 1M7HA 2OGSA 4U2KA 3L7BA 1V11B 1U5BA 3T9AA 9GPBA 2JPDA 4PSVA 4G09A 1ZH2A 1YR2A 2D5IA 1Z6QA 2DQ4A 3H1PA 4NH4A 4TLDA 3GELA 1FRZA 1SGWA 3KDAA 4L9AA 4GC9A 1K0FA 2FQXA 5DJ5A 2VDKB 1X1TA 2DERA 3OCJA 4YRQA 1W85A 2JGLA 4CKEA 4DSOA 5CNMA 2NU6A 5IARA 2LPMA 2A30A 2PY6A 3E5MA 4OVKA 1A9RA 3AUFA 1TMYA 4J1TC 4TQGA 2Y1DA 5FYQA 5AW1A 4IIDA 3VR5D 1TO1E 2JZNA 2IYLD 1VMDA 4D56A 1RP7A 1Z6ZA 2C3YA 2JKYA 4GF5A 3SSOA 1GKIA 1GVHA 1RHKA 4WMLA 4E15A 3QEBZ 5B53A 1S8AA 2VSNA 3K30A 2HKIA 2QY9A 3QEMB 2R86A 4ZK6A 2C83A 3GDFA 4NWIA 1QP7A 4DMUB 2FX5A 5CFZA 2ZVDA 3EQ2A 1IHUA 4GS5A 3MB5A 3ZTTA 2Y0BA 3K8QA 3IVRA 3DEAA 2DM6A 3GFOA 4JLOA 3P2YA 4LYAA 4BB0A 1JTEA 4GW3A 2J67A 4M1MA 3ZC3A 1U3WA 5F1KA 3OEHA 1CJUC 1XQ9A 1G7SA 2BFWA 3R7NA 2CLEB 4DBVO 4UVDA 3AY3A 2FG4A 2OL4A 2PLWA 3DMDA 2ZI9A 1IXRC 2ZJ2A 4MULA 2J32A 4G5YA 4UM7A 1KJJA 1R0LA 4QXPA 4IHKA 1U4OA 1QGZA 3QYJA 2JJYA 1XZIA 3PPXA 2GM5A 4TXLA 4BUJA 5L9AA 2RGAA 4LCBA 3MT8A 5DLPA 5H02A 2HJHA 1YHNA 2FPOA 1RQXA 4G07A 1Z4PX 4TKZA 1X42A 5K3CA 4JL5A 1XELA 2RSLA 3ADKA 2WC1A 1U3TA 4X97A 2BJYA 2UUOA 4B81A 5GTDA 3PFGA 4G0UA 5CVEA 3W6UA 2YXDA 3S2GA 4RZIA 3PI6A 4Q34A 4D42A 2OXIA 1NT2A 3ZCSA 2RH8A 3ANXA 1WUJS 5JSHA 3A6GA 2VP0A 3BRSA 3KLBA 3KTOA 3II6X 1ZMRA 2VUSA 4F4UA 3S8YA 4ETRA 4DC1A 2VF4X 1USKA 1QJCA 1D04A 1CD5A 1SD1A 3KJXA 4Q19A 1NQ5A 1F3LA 1E1RD 1MC1A 3KJNA 3QP9A 3PDUA 1U2GA 4R0NA 3JALB 4EHNA 1FFXA 4XIFA 2FR1A 5K0SA 4HB3A 1P1CA 1WUTA 1GGEA 1RC1A 1XSEA 5IABA 3T4EA 1O97D 4JT4A 4LOAA 2YJ3A 5HDQA 3VAYA 5ALEA 3ZX5A 4KWEA 2QVLA 3T5GA 3ZWNA 4JY7A 1ZD5A 5LQCA 3HDGA 1PJBA 2ADMA 1QLHA 4D8WA 1PJ2A 2AS0A 3IVCA 2VDLB 1AV6A 2IIBA 2W8BB 3ZCRA 3C3CA 1E1CA 2WYHA 2XT6A 4FC7A 3UOGA 4BE4A 5HJ7A 4KQMA 3OHSX 2F4NA 2I78A 3HDVA 4LX8A 1MRSA 4BN4A 4JB3A 5EZQA 4RQUA 3DR5A 1ZUWA 2ZYTX 4JUFA 4O5AA 3I9OA 4NNOA 4JQZA 2NO7A 1ZVJA 4X1IA 3G3EA 2OLEA 4DQLA 5JHGB 2WD7B 1T6ZA 4K88A 2IPNA 4U6QA 4US0R 5AVXA 5JI2E 2HZ7A 2HSJA 2QX4A 3LWDA 2IYUA 3MCZA 1REQA 3KYCB 3PTZA 4PHFA 5HVNA 1C1DB 4P08A 2CFRA 5DGCA 2FRXA 1ZXLA 3UK0A 1NGSA 4LMPA 1KDZA 4C5AA 1WPGA 3GQBA 1GR0A 4DGSA 5ICGA 2QIPA 3QWIA 1EM8B 2XOEA 5JNTA 3WIDA 3WHIA 2FRDA 3GQVA 3LZCA 4L8LA 5FUYA 3GJXC 4X1OA 1ODIA 4HLDA 3RODA 2ODEA 2CW5A 3OIDA 1V1MA 1ID8A 3IAM6 3O90A 4NMLA 1N7HA 3B3JA 1RRMA 5L3QB 5DYYA 5FHRA 3RIMA 2Q5EA 2QI9C 3DEZA 3IP6A 1K9SA 1NNSA 3HXKA 4BNIA 4RK5A 4D97A 8GPBA 1EWTA 4KG7A 4Q1CA 5F52A 1KQNA 1YCGA 4CRWB 2JL1A 4OQYA 4CVNA 1LBEA 3FMPB 1WV0A 1EI9A 1V6CA 1FQWA 2HAEA 3SKYA 3WB9A 3WAJA 4LOJA 2G70A 4OQ4A 3QHQA 3UV6A 3RE7A 3C5VA 1GLNA 1ECLA 4IHJF 3WQHA 4B73A 3BSSA 2ZRQA 5I7AA 3IO3A 3SSAA 1KI3A 1MQAA 2O3UA 3WGYA 3UHJA 4R0MA 4PX5A 1A9SA 3EFHA 1D09A 1PWXA 2XYQA 2DJIA 4A0FA 3JZFA 4JFAA 4KXUA 5LQSA 3TGWA 1Z4QA 3SYLA 1C9YA 3BE5A 3SK0A 2PTHA 3SBOA 4KLRA 1YOVA 2QZSA 2YFYA 2K4MA 2XGSA 4IIXA 1T3GA 1LPNA 2OE2A 4OJTA 1K5DA 4AJJA 3MD9A 2QW8A 4MUKA 5AK5A 1X7WA 1OYWA 3FROA 1WG8A 2EJBA 2UZIR 1D5WA 3FTQA 1C2TA 3VJMA 3VYVA 4BDTA 4OMDA 2UDPA 5HK9A 1OH6A 2H16A 1IBKB 3DO5A 2LVBA 2R8YA 3HKDB 4JLVA 4AJIA 5K8CA 1OH8A 2WMOB 2PT5A 2VWHA 3NAGA 1SA0B 4J0KA 4PYQA 1XQYA 4XVRA 5ANRB 4XFDA 3SBDA 1R2QA 4MVCA 2JJ2D 4R05A 3NWJA 3RUPA 1Z8FA 4JI2B 4BGDA 3Q4QA 4V02A 1RZ3A 1CJBA 1X7XB 2PNFA 4P2GA 4QTYA 4CF6A 1TPYA 4Q1EA 4XJSA 3C5WP 1DADA 3W5BA 1YKSA 5KPDA 5E9JA 2WJZB 4Q3BA 5E8RA 2PCJA 1W48A 1MB0A 4O59O 4R2HA 2JFOA 3DE5X 2IV2X 5JVDF 4UNPA 1YUZA 3DMFA 5FIUA 3FRJA 4E6PA 3W5AA 5ITZA 4M4SA 3QUQA 2ID9A 4IFBA 5CYOA 4TOGA 3W8NA 3ODGA 3EIOA 1G6KA 1QZ3A 1UXGA 3IXLA 3QIAA 4WHMA 4TTQA 4R1QA 4DNPA 1D6JA 1O08A 3AU8A 3PNBA 3KKQA 4Q12A 2N02A 2UUCB 4II3A 1GQFA 4NKRA 4L2IB 2WZQA 2I80A 5JAQA 1L4NA 4X95A 1H1DA 3VVBA 1RQNA 2GZ2A 4IRUB 3KAJA 2QD1A 3BXEA 2XMCA 1WF3A 3CUVA 1YASA 1R12A 4UXIA 2OHOA 3BGSA 2GD1O 3FGNA 4FBGA 3SH6A 3QZ3A 1GNPA 3KM0A 5DOVA 5TQVA 1CJCA 3PUVA 3UXYA 4DJTA 4ZJZA 1KXJA 1SZCA 4RCYA 3P4UA 5LQAA 2ZITA 4PCVA 1L6IA 4ERXA 2GBLC 1YI8A 3JAWA 4YACA 3R8CA 2O7SA 1ADFA 3D0QA 3O3CA 5GMOA 3OGHA 1DXYA 3SKVA 1SVKA 1UBEA 3T9DA 4ENWA 4PZ9A 4J2OA 3QHCA 3IE1A 4J0CA 4KBFA 2A0YA 3UOFA 3DFMA 3E5HA 1OYVA 3M49A 4LMAA 2C9CA 5EWMA 4LEIA 1YQGA 1NW5A 3G13A 4LDQA 2ZR8A 4DS3A 5IDQA 1SQSA 4P5PA 1SHUX 3OZ7A 4I81A 3DMGA 3RS8A 3O9VA 3R6TA 4B17A 2VPZA 5CGQB 3RJMA 4F9FA 2ZQZA 4XQ9A 4Z7OB 2VNJA 3OOEA 1Q22A 3P9QA 4HI0E 4XLTA 4CT0A 4RVNA 2BKLA 1ZRSA 1OIXA 3MERA 5FEJA 3ZI4A 3QPAA 3UMVA 5L3RA 5FUBA 1CR1A 3U37A 5LCXA 3B1JA 5A5GA 2F1JA 4DILA 3JRWA 3OQMA 5JYCA 2ID4A 4M6WA 5DM0A 4YCNA 4FYJA 3TBKA 4ND8B 2XE8A 2AD1A 3CPHA 3PQDA 3GLIE 1IXKA 2VT6A 2Z04A 2WDZA 4AM2A 3HCEA 5JY1A 2GBPA 5G02A 5LA6F 1PLKA 2D1TA 3AL0C 3L8EA 5L45A 4QXOA 3NIFB 4O1IA 4JP8A 1MJ5A 3NYRA 4LDAA 2PCLA 1CWUA 3R6LA 3BSWA 4LK3A 2PSDA 3AT1A 2E82A 1U7WA 4BP9A 2PL5A 5C7OO 5JEDA 1ORRA 4U9HS 3SLRA 2IYOA 4Q9HA 4C4XA 3FYUC 4UD2A 5ICMA 1I9CA 1TI7A 2ATIA 3C6YA 1IN8A 5IYZF 1EH5A 3WB1A 2OXFA 2RBGA 1OLOA 2PL1A 4LXQA 1PNQA 4EENA 2WILA 3KC2A 5BUQA 4GKJB 4N40A 5JU6A 1O0CA 1P1FA 2GHIA 1KI2A 2CMKA 3IPXA 4GX0A 4LNUA 3RUIA 1Q1BA 1RRGA 2B6HA 4DSAA 1Z08A 4XI9A 5LZ8A 3G9XA 4NHEA 1HYGA 3DBLA 4H2DA 1QV9A 1DAIA 1LWOA 221PA 2PHZA 4LZNA 3SC2A 2VHCA 3AJRA 3AHHA 3UJ6A 4FYHA 4Z0PA 5A2QA 2HC9A 3JASB 1K7SN 1Y9JA 3I34X 4C7JA 4KAJA 3PZBA 4CEHA 1YQXA 1SQFA 1N6RA 1GRVA 3IEVA 4AMZA 3TQOA 4B33A 4E5YA 1E3WB 4DC9A 1NXVA 2SICE 1I30A 3FNQA 3WMWA 4FGWA 3AGQA 3TJZA 3NGMA 4JSYA 4UEOA 1J33A 4AY2A 4QPNA 2O8EA 4MVJF 2PZBA 2ARKA 1URPA 5FLEX 5BY2A 3Q6IA 4H6WA 1U2ZA 2C8JA 3VM6A 4QGBA 2V2RA 1C29B 3IE2A 3Q0EA 4QVKA 1HL3A 4WXEA 3RDPA 2DSTA 2VRNA 5BWOA 2WIDA 1NUQA 3R09A 4MWSA 4FMDB 1SEVA 3F78A 3AI3A 2I3ZA 3ZKWB 5LIRA 2PTGA 1U0TA 1YIOA 2CNLA 2FB9A 2I22A 3ILYA 4HWOA 5I51A 5FBQB 4DWJA 1DCFA 1JIUA 3P2IA 4MV4A 3PWQC 3NCTA 1N2XA 1Q84A 2ITBA 4Q7LA 1B26A 1YH3A 3CF4A 1F17A 1NW4A 3K1AA 4MAMA 2Q5LA 4Q3CA 1Z3IX 4U6NA 3Q0IA 3TYXA 2QX6A 1PX2A 2QUBA 3SM3A 1GQRA 5KTOA 2Z5GA 4M36A 5EIEA 3FOWA 4AXBA 2AXQA 3N2EA 4F11A 1M2WA 3SEFA 1L4FA 3KAQA 4UREA 1O9BA 3RTCA 2HA6A 3SYRA 3PW1A 3M6WA 5T6BA 4Y67A 3PNOA 1JDTA 5ALIA 4XQCA 4MYTA 3EZ6A 4RZHA 3AERA 3IDZA 2NOAA 1U98A 1H69A 3GEHA 1NASA 3WWOA 4EB3A 3MMPA 4L16A 5IVKA 2ZSFA 1ADCA 4YN3A 5TQ2B 3Q3VA 4MTCA 5JMPA 2OAP1 3GMIA 3HVKA 1Y4UA 3NP7A 1DKRA 4G4IA 2I91A 2V6GA 1UFVA 4JI6B 2R00A 4EMSA 3OHMA 3HZOA 2H4FA 1GPKA 2JCXA 2X2EA 4FUQA 5EZYA 4AJ9A 5KSOA 4FCCA 3R2SA 1R4MA 1Z13A 1XROA 2PLAA 3AIIA 3FW1A 4PWYA 3ACBA 4TMTA 3UATA 1F48A 2Z2JA 4AZSA 4E6EA 5J43A 1X1BA 2H0AA 2GLTA 1ACJA 4QPZA 1J5XA 1FTNA 1M67A 2AZ4A 3CKYA 3JRXA 3OE4A 5K3AA 3ROXA 4ANFA 4B1FA 2JGDB 2JLWA 3NXSA 2VSYA 4EHJA 2QL5A 2FU5C 5BN5A 1HKHA 5J93A 2L18A 5HUJA 2DMRA 5DTRA 1Z68A 4OM7A 4RA6B 2Q99A 3FPEA 1E7YA 4MEBA 4LF6B 2FSFA 3AV0B 1DAFA 1SPBS 3GEMA 4KJZA 1QORA 2BW1A 4P9NA 1MOZA 4CIBA 3N9IA 2FOXA 3VHXB 3L7KA 2CHPA 1SCDA 3NHJA 5DX0A 4G5QA 2WINI 4DLBA 2R1TA 4JA0A 1PWZA 5GV8A 2J09A 3EGXA 5EWJA 2I34A 3PVRA 3R3ZA 3D6FA 5KJCA 2E3JA 3U7IA 1G18A 2WUGA 3ESDA 3GA7A 2GTIA 1RPNA 4LY3A 1AZSC 1PL7A 4YS6A 3WKDA 4BYGA 4V38A 5K0EA 2WKPA 2FN7A 1LLQA 2OV6A 4CXMA 1UXHA 5CNIA 2VPXA 3FUCA 2ONYA 3VR6A 2EZ9A 3E3NA 3TD2A 1ZNXA 2AW5A 1R64A 2IX9A 3MA0A 3NV7A 2P5TB 2QJWA 4P32A 4G0VA 4D4IA 3CLKA 2BE9A 3FYDA 3ROQA 4RKQA 4NIMA 2ONCA 1CHDA 5FI5A 1SRRA 4R7GA 1B8OA 2FVXA 4EDFA 3O7SA 4EA7A 1ZK2A 4LRYA 5DLYA 2NUTB 1YMQA 3HB9A 5EKUA 3ZCUA 2DBYA 2YZMA 3TNDA 2G6BA 1FTWA 4WDQA 4CKCA 1RXUA 4UCFA 1JH9A 4C7BA 2CMDA 1NRJB 1U6IA 2H1IA 2P9EA 3KJZA 1O58A 3R3JA 5B6JA 5BPHA 2EW1A 4ZKWA 1SG6A 1H2EA 2XMGA 1J20A 1HXHA 3K2EA 4FP9A 1A96A 3HADA 4U02A 1QNFA 2WM8A 4ISMA 3O4GA 3SEAA 1NJ6A 4RGYA 4YMSA 1VE5A 4DPLA 1A8IA 5JZVA 2A5GA 1KAMA 1WY7A 5D86A 1VE1A 4NYIQ 4MKGA 1ZRHA 2NO9A 2RJ3A 4K87A 4C0LA 2O7VA 4E1VA 2FY8A 1MX9A 3B3FA 3C6QA 3DEKA 5A9TA 5THKA 3H9JA 3NO4A 5KCMA 3T9FA 3V9PA 2ZDGA 2GPSA 4U7DA 3CVXA 3I39X 4O4LA 3OECA 1I4OA 5BWLA 4XCXA 1DNPA 3IIJA 5BSWA 1XYYA 3NHAA 2RK3A 3ESCA 2WF8A 3Q15C 4ABTA 2CCGA 1V9CA 1PKEA 1SKYB 3HB4X 4EP1A 1X3LA 1SKYE 3UPDA 2ZJFA 1X15A 3U6KA 1OBHA 3I9NA 3EMBA 2A4MA 1BHQ1 3Q88A 5J9VA 3PNLA 4PLWA 1LPPA 4W5QA 4EYKA 4BRUA 1CP2A 4HUQB 3U4HA 1CF4A 2J9FA 2GEFA 1SOVA 2NPIA 4I8DA 3QYPA 2PSHA 2QRPA 2CN1A 3H5IA 4N03A 3AJQA 5ALPA 3OZGA 4LJ5A 1E1MA 1UPUA 3EB9A 5KCZA 3NBQA 1FFHA 2J9XB 2CUNA 2R4QA 1N6PA 1Z5PA 1SKUA 3WK4A 2IY8A 1JAYA 4ZCLA 3SXJA 4Q4HB 5IJXA 3A11A 3GWZA 4ZTTA 4YC7A 5KSWB 1MT0A 1Y5LA 4RH3A 1XO1A 3AVTA 2LD4A 3ABRB 2EP7A 4RVCA 1UJ5A 4IFTA 2PUVA 3C70A 1KI8A 4GMXA 4HDQB 5FTWA 1G8AA 3IL2A 3HCAA 4MP8A 1DARA 1PQ4A 3M4XA 5DHPA 1VMKA 3AM3A 1QVWA 1P19A 1P2TA 4QGFA 3A1NA 3TZKA 4G0OA 2WKRA 3EVBA 4OUKX 1JEYA 4JB8A 4P83A 4IG9A 4JYBA 3LGSA 4LX0A 1T5TA 2DFVA 2EFCB 3ZQ4A 4FFWA 4NFSA 5H4GA 1V3TA 4N6OA 5ALDA 2GDZA 5F2NA 4TSKA 3EZ9A 2BLLA 4QM6A 5EIOA 1ULUA 5B36A 2ZYSA 2A0WA 3Q3GE 4B75A 4Y2VA 5F2KA 4UBMA 3AUKA 1PV2A 4DABA 3HXQA 4RHFA 1U8FO 2NPOA 3GB9A 3OFKA 3OPXA 2G4CA 1XAJA 4J1NA 1C9EA 1P1BA 3TLMA 1KEKA 3BD6A 1MO6A 5K3EA 4P81A 3IMCA 5GU1X 3UJPA 2WZDA 1QRSA 4ZVQA 3DL2A 1CLEA 2COKA 5E6RB 5F9MA 2VYNA 2FUCA 1KY2A 4IZOA 2OCBA 5DTMA 2JI7A 4CR7A 4YCSA 4XASA 1P9NA 2DP4E 5BYAA 4JC0A 4OQEA 3DTYA 1XZ1A 1E64A 1HSZA 2C9OA 4P3PA 4PZYA 4IKEA 4Q3EA 1X86B 3RFFA 3MJDA 1GL6A 1ZGGA 3HBAA 2RGRA 4AJHA 4IW3B 5B4UA 2C5LA 3PB3A 1RC0A 1NW8A 3EWSA 4OUDA 4DREA 3BE6A 5BV2P 3L1KA 4E5NA 2IEZA 1FMCA 3V1LA 4FGLA 4J49A 4CV1A 1GSAA 2PKYX 1S4QA 2W6PA 1YS9A 2EWMA 3AC0A 1YOVB 1OTXA 5JQWA 2ZT7A 2ODPA 3D8RA 3GR6A 4R9SA 4YMWA 5B1DA 5AM3A 1KRWA 2PXAA 3G2MA 3KDPA 4S12A 4WOKA 5ER6A 5T3YA 3HXLA 3TRHA 4S0ZA 4CR8A 3FAKA 2PZJA 4M0UA 2O2ZA 4BCBA 1QLWA 3O2NA 5BWNA 3H86A 4FS3A 2B69A 4ZQCB 3GXOA 2A3NA 4MWOA 1CZRA 4ETNA 5GJWC 5A6SB 1DXHA 3N2GA 4KO4S 2IYWA 1NKVA 3ZOZA 3Q2KA 4TOHA 2CSUA 3F3MA 3K1TA 3FMIA 2CLMB 2GD6A 2VO1A 2O0KA 4A1OA 4MI9A 2K7FA 1P1RA 4B79A 3HYRA 3WJ1A 2D1YA 4REUA 1ZD2P 1FP6A 1DAOA 3GJZA 1WVIA 3C6BA 5CJPA 5F5NA 1G20B 3MJHA 5AOVA 1FW6A 2BHLA 4GIBA 2CLIB 2YMPA 1DEOA 2V9PA 4JUIA 5SY6A 3QBVA 1G0NA 3LQRA 1TVKB 2Y8EA 1IN7A 3RAGA 3CZMA 2XCIA 4W5RA 4RTKA 3GFSA 3GCGA 1LEHA 1OXUA 2J3JA 2P9HA 3FXAA 3PHGA 4N5MA 3EULA 1TKOA 1A7AA 1C1DA 3QFTA 4I50F 3KYCA 4FKZA 1LPMA 3L82B 1WUHS 3RC8A 1IXSB 4Q3KA 3FCXA 3HR4A 3L01A 5EMKA 2YY7A 3FZGA 2GETA 3OMLA 4EH1A 3TZQA 3AI2A 3C3KA 4IAOA 4J0GA 5L95A 4NCBA 2WJWA 2AE2A 1DQPA 2C9DA 3STUA 2K2WA 1NFQA 3B5IA 4BFLA 3BOSA 2H2HA 1QGED 1QQTA 2PGOA 3PGVA 1P7CA 4W9NC 4FTWA 4YJ2B 4D0RA 1MFPA 2R8OA 2WMDA 1UJMA 3R3XA 1KFKB 3EFOA 2HBRA 4EW1A 1FDWA 3LDGA 2WIBA 4M0DA 3VR5H 2HGZA 1WCYA 2WYUA 4L3WA 4QQRA 3ZWKA 1KH3A 1Z4OA 1A4UA 1DWPA 2ZI6A 1WPXA 4LF5B 1FEZA 1U3VA 3GGOA 3M3HA 4NZ9A 3J80A 2CZQA 5IASA 1B0AA 2A7XA 3AF2A 5EINA 4HT3B 4YRSA 1Z6PA 4GEKA 4YWJA 3RSGA 2WTXA 4G84A 2PYBA 1E6LA 1N2OA 3B6ZA 4ITRC 5ERXA 1EIZA 2E5LB 5FA5A 1V5IA 4TKUB 4F5WA 3RRBA 4HAWA 1JPNA 4YR7A 1G8MA 1PJZA 3VSCA 4YJ2A 1GG2A 1QHHB 3BILA 3NBYC 3PA8A 1VJDA 5DGHA 1ZCFA 1JQBA 1DKLA 2FEAA 3OE5A 1FIUA 2PV0A 2I4LA 5BUSA 2QR5A 2I8AA 3C1UA 3E15A 3D4PA 1HE1C 1TCBA 4JYPA 3G8YA 1E7SA 2H17A 1C3LA 3UWPA 2BI7A 2GZMA 2PEYA 2W2PA 3KKZA 2OFFA 4EW6A 1NLYA 3DE1X 1V39A 5C51B 2IUTA 1YRAA 3LA6A 3LY5A 3QM1A 1GNLA 3LZ6A 3WP1B 1A8UA 1XEFA 2QUKA 4C4TA 3EWNA 3P4XA 3U3RA 4FLEA 3PJEA 3IP5A 4QUHA 1HWYA 4AAYA 1ENZA 1H9AA 4DPKA 5BSHA 4ZJKA 2VJLA 4PLTA 1I7DA 5E6UB 1ZL2A 4FDVA 4RK1A 4RPGA 1G20A 1L3IA 4EVRA 4C4OA 1TRKA 4JP3A 2FUEA 1TECE 3Q87B 1O95C 1C0KA 2VHJA 4EEKA 1CR2A 1FP2A 4EA6A 1RRVA 4R3WA 3ZQJA 4ZT2A 4YTEA 4FT4A 1QTRA 1CEXA 1UDXA 2ZYDA 4KQCA 3MOGA 3SDBA 1SOWA 2GFQA 2V74B 3EG5A 3R5JA 2XA1A 3V3KB 3P19A 1XYVA 3MIZA 2O2GA 2ZAGA 1BSVA 4M53A 1MFZA 3F5QA 1VGVA 1W4LA 1QWOA 1ZN2A 2FFRA 3KB1A 5EP3A 3RC9A 1Y7TA 4QTZA 2QRGA 4B2IA 2ALJA 2WJPA 1PCXA 1AKWA 1XDSA 2NXNA 3C4VA 3PWZA 4CCAA 5E6SB 4NZZA 4NZYA 3RFVA 1TNDA 2ZRBA 1P8JA 1XKLA 4JNKA 5L8VA 1FLNA 1ZCBA 2V1XA 3FBTA 9LDBA 3C6KA 5HUHA 3GN1A 5CCXA 3LRXA 3HZZA 2FG5A 1U5CA 3BQ9A 3OLZA 3QTTA 4IGIA 5AJYA 5EA2A 4L50A 5DXFA 4ZT3A 3HI6A 5TDHA 3R2MA 4FZRA 1N25A 2F9MA 1Q3TA 2HRDA 1IIRA 4H15A 3KKNA 3PIIA 1JJBA 2J5KA 3MOIA 5SYMA 4AKEA 5ALQA 3KA4A 1JEJA 2AN3A 1T36B 4ME6A 1BMTA 1N9GA 4IPTA 2L82A 2W0MA 1S8OA 3W6ZA 2JASA 2ZRLA 3ZWQA 1EFPA 3B20A 3B1VA 4ESHA 3RYTC 4AF7A 3FUUA 4B2LA 2FZGA 3IELA 4W7IA 4X63A 4XVQA 4NE9A 4CLOB 2XQVA 3FWHA 4L72A 4KKXB 1N1GA 1CUEA 1GCIA 2ZJ0A 2PA0A 5CTJA 5EHZA 4U3JA 5B7PA 4N12A 2PX3A 4GXQA 3QNUA 4WZAA 3AJOA 4QSMA 5AVRA 5GZ1A 2PIDA 3V4OA 1TT5B 2C0CA 1BA2A 1YK1A 3GPCA 3LAWA 3RKUA 2WE8A 1W36C 3HA2A 4ISCA 5DN6D 1XU7A 4IKPA 1GQ2A 1SXJA 3GMDA 3VKVA 4LG1A 2IX3A 2A5YB 4FYIA 3AF5A 3FKSD 1ISMA 2YYZA 3BKWA 3G8CA 3OU2A 4PIMA 1JLSA 4ZT5A 5P21A 2FFXJ 1JQLB 1QC5B 3PQ3A 3QF4B 2G5TA 4DR5B 2ICAA 4PZCA 2BFNA 2Q7XA 4Q9KA 1RWKA 1Y3DE 3U56A 1ZO8A 1ZU5A 2JFYA 4KVSA 1X8XA 4R69A 3A9SA 4M0MA 4EZBA 1W29A 5B37A 3DF7A 4PINA 1Z4MA 1HOXA 2DZDA 2ZROA 3UYKA 2VZLA 1XKXA 1TDJA 3CW2A 5IM5A 1YJBA 4B3JA 2V7BA 1EJBA 4XUEA 1ZWLA 3A3NA 2C9ZA 4MKRA 3VMFA 4I3FA 2JGIA 4B8WA 3ND5A 4P1ZA 4LRTB 4ZZ1A 1K0UA 1XTTA 1QO9A 3UKDA 4BL5A 3OJ5A 3EJWA 2NP7A 1U5AA 4O2BB 2VNKA 2ZR0A 3ONVA 3LD9A 3PCXA 7YASA 4V2UA 2D13A 2Q41A 4I46A 4QIHA 3LLMA 3IP3A 1W19A 3BDVA 1YV1A 3JWEA 4UDOA 5HJEA 3TQRA 1ZL0A 3T99A 2AFHE 2ECQA 1IPEA 2C7GA 5AI8A 3WDSA 1F33A 3UBTA 3I2GA 1T3SA 5KSYA 1Y37A 1C1YA 1EPUA 1WB4A 1YBVA 4MUXA 4ZYWA 3ZZNA 3KLOA 3CZ5A 5CYFA 4H9GA 4A92A 1R6DA 4J4HA 1YBMA 2I29A 4RM3A 3ZD8A 3LIIA 2ZTUA 4MDYA 3NHPA 4NBWA 2OSVA 4LZZA 5AH0A 1PGPA 3SQLA 1P2SA 2BGLA 1TT7A 2WU4A 1A9XA 3KOUA 2C9BA 1FCJA 4RSGA 4DNXA 1X1AA 3TLAA 1E5DA 2C03A 3BAZA 4OF4A 2VTBB 2GXAA 2IS2A 4K3UA 1BYUA 1FTYA 2DKFA 4BIIA 2QG9A 2R1VB 4E2ZA 4U0KA 4IIYA 4UOZA 3I01A 4LISA 2G1PA 1IY9A 2C2YA 2FZ4A 1P4JA 4A8HA 1UFRA 2W43A 3UYLA 1XMOB 1NDHA 1AXEA 3JW8A 4JODA 4BMYA 1UDCA 1UPTA 1M33A 4Z4IA 3L8MA 3MUEA 4YDRA 4LPMA 1MNAA 3ICVA 3V33A 4XKJA 2CK3D 4K05A 4WZBB 3KHUA 5LWHA 4NOKA 3PWFA 2P8SA 3MJRA 3K9FC 1V9LA 1ZR4A 2AN9A 2OH3A 4KHZA 2JFHA 1D0IA 1TT5A 3Q5DA 3WBKA 2DPGA 2JJ1A 5K3BA 3AHFA 3B82A 4IVPA 3BMXA 1KYXA 1N7JA 1YZTA 2Y1GA 3DYVA 4B31A 3W2HA 4CKCB 1O3YA 3HWSA 1DQNA 4QEZA 2V6MA 4AJ4A 2XTJA 3I6QA 3W7VA 4B6SA 5JBIA 3HXMA 2N75A 4NJOA 5U4XA 2FPKA 1SN7A 2W0SA 4PVCA 3LUGA 4R8KA 1V1RB 2I4NA 2Z4RA 3C48A 3DXXA 1QG6A 1XNHA 2X6QA 4I5IA 2BUAA 3HSYA 4NBUA 3C7CB 4P7BA 6ABPA 3MFYA 2JH8A 5FLYA 1P5JA 2GPTA 4LJYA 4CQLA 5KHLB 4CFZA 5HJ5A 5HZKA 1IBMB 1K4YA 4HAYA 1OR8A 2IZ1A 2YWGA 1XD2A 4NCKA 4XIGS 4BGVA 5C80A 4LDZA 1KRHA 2R7NA 1J7JA 3YASA 5IKMA 1PWEA 2ZANA 3EUAA 4CG1A 1YQUA 3D3NA 3KRTA 3PIDA 5T7BA 1WCXA 2A1UB 4FE7A 1ORWA 3S0JA 2HIHA 2WPDD 4CGYA 3X0DA 5EPOA 4RDIA 2P67A 4JI8B 1YNSA 2XHZA 3G1TA 3USCS 2G8LA 4ZQEA 1LSJA 3NC4A 1EFRA 3AFGA 1CJKC 4J1SA 6PFKA 1UDBA 4ZPXA 3KSZO 3QE9Y 3CLUC 3UJAA 4NI5A 4AUKA 5ER9A 4ZYXA 5EMLA 1Z3CA 1ESEA 3ZV6A 4PPFA 3JSXA 5AQEA 3FN4A 3I76A 2JGFA 3P9NA 2D7DA 2A58A 4MPPA 1RAFA 5I4KA 1Y9ZA 1NBAA 1XA0A 1Q21A 2CVZA 3V3KA 1KDRA 4A4DA 5D8RA 3GHHA 4JKOA 4JUDX 2LRHA 4Q7KA 4YLEA 2NUAB 1TA9A 1NN5A 4FE4A 2XGJA 2Z2IA 3BXHA 1PDOA 2AH5A 4I19A 4L4YA 1SUAA 2ZZMA 3FVTA 3QEAZ 2H08A 4K0KB 4R8MA 2BISA 3GLHE 5FTLA 5TF4A 4BVLA 1C0IA 5KNBA 1VPWA 1LKPA 1EE9A 2H2GA 1JEOA 4PAMA 2DT5A 4FEYA 2IPAB 3AB7A 5HCNA 2ILVA 3U19A 4QTXA 1PTKA 2JK0A 1BFDA 5ISMA 2FKNA 2XZPA 1FMLA 2GAJA 5CBPA 2WHPB 1PJCA 1JPVA 2GF0A 3JQ8A 1P75A 1RI4A 1TL7C 1J2RA 1EJ6A 4PC6A 4EI7A 3L06A 3VC2A 2CDRA 1JKFA 1E2NA 3K6KA 4KDFA 1U8XX 3G85A 1LZKA 5HE9A 4A73A 3P9SA 1Q0RA 4DQ0A 3TD6A 5EN4A 2VYCA 1JR2A 5EJAA 2PRJA 1RKUA 3PUXA 1G8SA 3EAFA 3DBYA 3PW1B 1M6VB 3G0HA 1NKSA 2DECA 2IYPA 3GP3A 4OYNA 1X80B 2X0EA 1WDMA 4ES6A 1GEEA 3QMMA 1X38A 2BCEA 2O2IA 3T9CA 1O0SA 5HKBA 4OHKA 3N2KB 4QOSA 4J6EA 4XD2A 4EKYA 1CS0B 1MIOA 5DNCA 3HFGA 2PMWB 1TCCA 2EJUA 3K1AB 4H59A 3WWZA 3GA0A 3MYRA 3U17A 2ECPA 4GM1A 4NZMA 1E98A 4O1MA 3WLOA 2WA2A 4RNDB 5ADUS 2C59A 1QSGA 3WNCA 1A95A 2IV7A 4OAQA 5LKAA 5P8WA 5GM1A 4BX8A 4MDHA 3ECSA 3C2QA 4PGGA 5LC1A 4N54A 3TK1A 1Z0IA 2XCUA 4YREA 1Z8HA 4Z9XA 3WNBA 1KBQA 4YIKA 1RWPA 4S24A 2JLYA 3ORFA 2OXRA 3ANLA 5CT6A 5LPNA 3VDNB 3I53A 4G9GA 2I4MA 4MIYA 1H0HA 1UFQA 1F9EA 3GH1A 3E23A 4RL6A 5LBHA 2OK8A 4HGQA 4B32A 1AU9A 2YWBA 1GZHB 3WFJA 4A1FA 3DL0A 3Q1KA 3LQ2A 4E2XA 2XCLA 3AJ8A 4CU5A 3RKRA 4M88A 4KEAA 2XYHA 5B1HA 4RHTA 4CEHB 1LSOA 3OIVA 4GR9A 3EPJA 4EA8A 4Z4GA 3KTFA 4HL6A 3PC8A 1HF3A 4KLAA 5AW9A 3SF8B 2F67A 1WBDA 4UATA 2I6GA 4ML3A 1G8YA 3KB8A 4N3NA 4P8RA 1DTSA 1NOKA 4P84A 4C2TA 1W8DA 5JXIA 4LJRA 1T0HB 2PRYA 2Z5FA 4RA9B 4Q1FA 3ITDA 5KOJA 1JB1A 2VYFA 1S8NA 1K88A 2FPMA 2J59A 3CO0S 4KYVA 5T8KC 4MA0A 3L79A 4YJGB 4C89A 2H1FA 3BK1A 3EGWA 3NFRA 2ZXFA 2ZE6A 1UBSB 4RVSA 5FPYA 4GOOD 4LXXA 4MR9B 4UFPA 1NP7A 2MDTA 4NCXA 4L7QA 4FCVA 2Q5OA 2ZQYA 4BKPA 1Y8ZA 1OROA 4MS4B 1INLA 1WMDA 1W4ZA 3S4YA 4BNUA 5EJGA 1GGKA 3H87A 3NOZX 1T6YA 3EJ6A 2YJZA 5BT8A 2JG3A 1Q1GA 3QH4A 3LUCA 4HZUA 2G36A 3N2GB 1FDUA 4AY5A 3GX1A 1HEYA 4QOEA 4WZZA 4JV5B 3F73A 2ACVA 3TOSA 1JLLB 3NT2A 4L5YA 4QQNA 4AMVA 2YWCA 3KBBA 1HFWA 1OHHA 3Q12A 4DLPA 3LL4A 5EJ5A 5DYNA 4ZAVA 2HF9A 3H18A 2XT9A 1N6LA 1VI2A 2V4UA 4MJ7A 3WGVA 2ZR7A 1G5HA 1PFUA 1PYOA 4L8YA 1XG5A 1D6MA 3RK1A 5EEGA 2YRXA 4CWAA 4M9SA 5LDHA 2Q7DA 4OJNA 6REQB 1NFFA 3RPEA 3VVLA 2G0AA 2G06A 1R8XA 3X1WA 3GUYA 3NZEA 3QVDA 4MGKR 2JLCA 1EFRD 3KZNA 2QU8A 4RQTA 4URHA 1LVHA 1VLJA 3UF0A 4XB1A 1S2GA 1VE6A 1MXHA 4EABA 2W90A 4YJ3F 2E4XA 3KPYA 3V2IA 2RGCA 2ZUVA 3QNMA 1Z15A 4CBVA 2O5EA 1XQ1A 4JVLA 4W4TA 1H42A 2H9AA 4RMNA 3B6EA 4IICA 3ZN2A 4Q00A 3D6TB 2GHRA 3L9XA 2RHGB 4CU2A 3EVFA 4PRZA 4Q3AA 2BDUA 1H6BA 2FFQA 1X70A 1MOQA 1WBJB 2VLIA 4DNQA 2ZT5A 1KU0A 3JQAD 2ISQA 1YRWA 2W58A 2ZIEA 3AV3A 4H1WA 3FWPA 3UJCA 4CM9A 2OENG 3O8RA 1KMHA 1C81A 1YQEA 4B71A 4B47A 2MIIA 2X1HA 3FHCB 3R0QA 3KKEA 3PR1A 4ZI7A 1UANA 4YJHA 1PR4A 4IG4A 3OO1A 5EE3A 3OH8A 1WW3A 5DIZA 3D4LA 3FD8A 1OBVA 2J0UA 4WIAA 5E3HA 2VSQA 4DXAA 2R84A 3HKCB 4RTNA 1AOXA 1HPLA 1BW9B 4NU6A 3UICA 2W6ZA 3DE0X 3U4GA 4EFLA 2SKDA 1YB6A 2ZI5A 2XBLA 4HVLA 3ZK7A 4NRDA 1XVTA 3K20A 2D5AA 3FIUA 4YO7A 3TCXB 3TGPA 1TFUA 4FHZA 5FUXA 2IOQA 4PG4A 4BCCA 2BM8A 4ZQBA 3ZOKA 4D96A 3L4BC 5G41A 4MVJD 1U9JA 1R37A 3B2QA 3N6VA 1CK4A 3F9IA 3R5SA 4LXYA 4OMCA 3VVCA 3ELDA 1A9TA 5DV9A 5A3SA 3QOWA 2FZFA 4JT8A 3UB3A 1YJQA 1ONSA 1RWXA 4COKA 1X7XA 2VHWA 2ZYVX 1HT1E 1B8UA 4ZALA 1LF0A 1AUOA 2VTEA 2I6TA 2G9NA 3ZU2A 4EEZA 4C7OA 2WZCA 5AVUA 5A7HA 2VUIB 1ZQ9A 1JR3D 1O9GA 2FW9A 3LQ1A 2VK2A 2AF3C 1VJ5A 5CDTA 2FEXA 2MCFA 3VKHA 1U0EA 3HKDA 3VSBA 2Z2KA 1DAMA 2QRZA 1ILWA 1U11A 1JWAB 1J9ZA 2KM1A 4R2IA 1AX9A 5C52B 2NAPA 3AUUA 3MQ2A 1GIAA 1HDYA 3C3MA 4RNCA 2YFHA 3R0XA 2G5CA 3VR6D 1VPTA 3V46A 2QLJA 2VJMB 3D54D 3RM3A 1Y3HA 4HLUC 3Q9LA 2Q0SA 3N87A 2WEKA 2ZVPX 3OZFA 4WDRA 4BZWA 3RU3A 1JA9A 2IDKA 1T0PA 3RC3A 1SUWA 3BK2A 4FLFA 1ZFNA 3SWWA 3GG2A 1KKMA 2XKKA 1MD9A 1WM1A 2R1UA 1PRYA 1MABA 1O1YA 1S0UA 1T1EA 3EXAA 2A4KA 3FCEA 3QUSA 2CY0A 5E2BA 3UOWA 4MJXA 3NHLA 1VL2A 3VH3A 3NEJA 4HR7A 1YZVA 2X2OA 2JLAA 4UCQA 4C0WA 3N2IA 3GW8A 5AUQA 2C07A 3T3PB 3W5IA 4DM3A 3M6LA 5FFBA 1GA4A 5IRCD 3HY6A 4CIXA 2XJ4A 3ZY4A 3D6UA 3U44B 3AR9A