2OKCA

Crystal structure of type i restriction enzyme stysji m protein (np_813429.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
424
Chain Sequence
QSLTKKVWNLATTLAGQGIGFTDYITQLTYLLFLKMDAENVEMFGEESAIPTGYQWADLIAFDGLDLVKQYEETLKLLSELDNLIGTIYTKAQNKIDKPVYLKKVITMIDEEQWLIMDGDVKGAIYESILEKNGQDKKSGAGQYFTPRPLIQAMVDCINPQMGETVCDPACGTGGFLLTAYDYMKGQSSKEKRDFLRDKALHGVDNTPLVVTLASMNLYLHGIGTDRSPIVCEDSLEKEPSTLVDVILANPPFGTRPAGSVDINRPDFYVETKNNQLNFLQHMMLMLKTGGRAAVVLPDNVLFEAGAGETIRKRLLQDFNLHTILRLPTGIFYAQGVKANVLFFSKGQPTKEIWFYDYRTDIKHTLATNKLERHHLDDFVSCYNNRVEIYDAENNPQGRWRKYPVDEIIARDKTSLDITWIKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type I restriction enzyme StySJI M protein
publication title Crystal structure of Type I restriction enzyme StySJI M protein (NP_813429.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.20 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Transferase
total genus 133
structure length 424
sequence length 425
chains with identical sequence B
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02384 N6_Mtase N-6 DNA Methylase
A PF12161 HsdM_N HsdM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.30 Mainly Alpha Up-down Bundle Ferritin Ferritin 2okcA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2okcA02
4RVGA 3P2KA 5E1DA 4LECA 2BR3A 4RVFA 4IKPA 1R18A 3GDHA 4E2YA 3RW9A 1AF7A 1YUBA 2AOUB 2H11A 2ONZA 4FZVA 2CL5A 3UJAA 4DCGA 2B3TA 3T7RA 2PT9A 4RTRA 1N7IA 2R3SA 5HFJA 1QANA 3KPWA 5K0BA 3REOA 5CCXA 1X1DA 3NW9A 2OYRA 1L3CA 2NXJA 1TPYA 5IH3A 2IIPA 1JG4A 1G8AA 3OU2A 3GRVA 3LDFA 4RWZA 5ERGB 4KVZA 1NBHA 2AOXA 3MCZA 2ZSUA 5K0GA 2HR1A 3PLAE 2BR4A 3OU6A 3TM4A 4HTFB 1YB2A 1ZHFA 3EVGA 4HGYA 2PBFA 5DT2A 4AZWA 1Q0TA 2WA1A 5FULA 4YUWA 1SUIA 2HTEA 2NNWB 1FP1D 1JQDA 3PT9A 4QQKA 2FYTA 4PONA 3RIEA 3UA3A 1ZQ9A 4EKIA 4C08A 4WXHA 5DWQA 3MB5A 4JXJA 1P39A 3S68A 2JHAA 3DOUA 3TMAA 4DKJA 3FUVA 2YX1A 3FTCA 5DM2A 2BH2A 3OZSA 1R6AA 2JJQA 5EHGA 1XDUA 3CVOA 2OBFA 1XDZA 3BZBA 1IM8A 3GWZA 5E1MA 3LCUA 3TOSA 2EX4A 1IY9A 2BM9A 1D2HA 1EJ0A 3CC8A 3OFJA 4C05A 1U2ZA 3QOWA 2NP6A 3FZGA 3IV6A 1YZHA 2B78A 3KR0A 3LGAA 3KR9A 1EAMA 4FT4A 1BOOA 2YXDA 3P2IA 1G55A 2H00A 5KQRA 3CGGA 2HNKA 4GOOD 5C1IA 4RTNA 2GA9A 2YUIA 5BW5A 5JR3A 2ZBQA 3P2EA 1G60A 1SUSA 3R24A 2DULA 5K0JA 1PJZA 4OX9Y 3SM3A 3NDIA 4QTTB 5DM1A 5K0FA 3TM5A 3BXOA 3CJTA 2OB1A 4A6DA 3LBYA 3ER9A 1X1CA 3I53A 2A14A 3CBGA 4HSGA 1JG1A 1TW2A 5HEKA 4ER6A 2I9KA 1F38A 3EEOA 2XBMA 3KPYA 5KS2A 3C6MA 5FHQA 3T7TA 3BT7A 3FPFA 5E1OA 3LPMA 3P71T 4HG2A 1BC5A 1VLMA 3BWMA 3SMQA 1R8XA 4DMGA 4MQ4A 2QRVB 3HA7A 3CKKA 4POOA 5K09A 5FA5A 2ZZMA 1XDSA 2O0LA 5EHIA 2AN5A 5KQSA 1G38A 3U81A 2XVAA 3G8BA 3ME5A 3OZRA 4Y2HA 5DX1A 2CMGA 5DLYA 3SXJA 3EVDA 5P8WA 2OB2A 2PWYA 3ELYA 4LWPA 4DF3A 5D1NA 5K05A 4FP9A 1YFJA 5EOVA 3Q87B 1X1AA 2O57A 3M33A 2ADMA 3SSMA 3DH0A 3GIWA 4IWNA 4E2ZA 5LQNA 5CVJA 5ICCA 4GBED 4KRGA 4DQ0A 3THRA 3BWCA 2FK7A 3TR6A 3EGVA 4YV0A 2PT6A 3FPEA 4ISCA 5E1BA 2GAFA 2XYVA 3E23A 2EJUA 3A27A 3KPJA 5BW4A 2G72A 4PCLA 5ICGA 1O9HA 4PGGA 3A4TA 1Z3CA 5LQCA 4BLWA 3OPNA 5FUBA 1JTEA 4OA8A 2I6GA 2ZBRA 3FPHA 3GRZA 5C0OE 2C7PA 5FHRA 3B3GA 4PYIA 4E2XA 2B25A 3AXSA 3BGVA 5EZQA 3VC1A 2K4MA 3HCFA 2AOTB 2PXCA 1QZZA 3FRHA 3THSA 3LKDA 5K03A 2PSSA 2ERCA 4XUEA 4FSDA 2VP3A 3HVJA 2VDUE 1EJ6A 5E2AA 3PX2A 3F4KA 5LQJA 3NMUF 3DMGA 1YFLA 2PX8A 4P58A 5F2KA 2Q41A 4YV1A 4R05A 2C7QA 5K8VA 1M6EX 3GRYA 4KIFA 3HTXA 5K0EA 3KKZA 2G70A 3I64A 2O07A 1JSZA 5DXAA 4YUVA 5KVAA 4E32A 5MHTA 3G2MA 3SX0A 1RJFA 5E9QA 1KPHA 3GO4A 1SQFA 3HP7A 3O4FA 5GM1A 4RTOA 3R9XB 3UJ7A 1OR8A 2IBSA 1G6Q1 1KHHA 2YTZA 5EC8A 5EKXA 2ESRA 5DSTA 4ZTBA 3C3YA 4RSRA 4E33A 4AZSA 5EIWA 4C4AA 4RTLA 4F85A 2NXNA 3LKZA 2E5WA 1P91A 3AY0A 3KQOA 1UFKA 4QVGA 4EVIA 5DRYA 5EKUA 3MQ2A 2Z6QA 2ZIGA 5CVEA 1ZGAA 2B2CA 3FPGA 4PYOA 3UWPA 3JWGA 1M0EA 2PGXA 2NXEA 4OA5A 3KU1A 4QPNA 4PNEA 1UWVA 4GUAA 3FUTA 1ZGJA 3EVCA 1FP2A 2GS9A 4DCMA 3L8DA 4PINA 5CIYA 3E8SA 3KQWA 5H02A 3M70A 3GJYA 3HVIA 3LDGA 5HZMA 1EG2A 3KQPA 4HGZA 3BUSA 3DXXA 5K0LA 4PWYA 1JQEA 3KQTA 4RX1A 2IH5A 2AOUA 2XVMA 3EVBA 1I1NA 4OQEA 5CD1A 8MHTA 1PRYA 2QM3A 3BKXA 2PX2A 4LWOA 3V8VA 2IBTA 2ORED 3K0BA 2PXXA 4E30A 1FJXA 2P3QA 2G8NA 4KIGA 5C9ZA 4GOMD 3V97A 4EKGA 4ER7A 3G89A 3QOXA 3UJ9A 4DM3A 2ZIFA 4M36A 2VDVE 3HVKA 1DCTA 1EQAA 1QYRA 3DXZA 2GPYA 3LECA 2V74B 3GGDA 3LHDA 2OY0A 4AZVA 4CWAA 2ZW9A 3HM2A 2C7OA 4FGZA 4KDCA 4C04A 3FTDA 4HTFA 3JWHA 2DPMA 3O31A 1BHJA 1KPGA 4FSXA 1RI5A 2ZZNA 2P3OA 4CKEA 5KYGA 5FQNA 2UZ4A 1NV8A 3EEYA 3FUWA 5D1HA 4BLVA 4EQZA 2IH2A 3P9NA 4CTKA 4LG1A 2XYRA 3A26A 1WXWA 2O05A 5F2NA 3E7PA 1HNNA 3GCZA 2BM8A 3K6RA 5FA8A 2VDWA 1QAMA 2P35A 4KDRA 2HMYB 3HCCA 5EEGA 4RTMA 1SVUA 2C7RA 5DSXA 2HWKA 4V0QA 2HV9A 5K0NA 5CVUA 5EZSA 4UOEA 3ERCA 3LL7A 1P1CA 3ELDA 2VS1A 5G02A 2JG3A 4V0RA 1WS6A 1L3IA 3CJRA 2P7HA 3ELUA 3LSTA 3O7WA 1B42A 3MGGA 1VL5A 3B7PA 3KQQA 4MHTA 5CUQA 4RTJA 3UA4A 2ZWAA 4G56A 2AZTA 1JTFA 1X19A 4GOND 5E9WA 3RODA 4QDJA 4R6WA 4PYQA 4BP3A 3B3JA 4FR0A 1R74A 3G7UA 3G2PA 3OCJA 1RJGA 1NV9A 2P41A 2EG5A 2PXAA 4X1OA 5EEHA 1RI3A 2FCAA 4X41A 1KP9A 3C6KA 3NVKI 1AV6A 2F8LA 5DM4A 1I9GA 3BWYA 4PYMA 2P1DA 2IFTA 3ELWA 2PLWA 1T43A 4O29A 1JG2A 5DX0A 5E2BA 3HNRA 1JQ3A 1KYWA 3BGIA 5JUWA 2PY6A 3SGLA 2FHPA 3SVZA 3ORHA 9MHTA 4GEKA 7MHTA 3B3FA 4U7PB 3SSNA 5EMLA 5FQOA 2H1RA 3DUWA 3ANXA 2CWWA 2QRVA 5F2OA 3P9CA 5DTMA 3VC2A 3VSEA 4A6EA 2PX4A 5GINE 3MHTA 2JHCA 3TLJA 2IP2A 2YR0A 3R6TA 4RVHA 4HH4A 5ICEA 1EIZA 2Y1XA 2OKCA 1XCLA 3I5UA 4FS8A 2GLUA 3EGIA 1N7JA 3M4XA 4KWCA 2Z6AA 3D2LA 3G2QA 3PFHA 2I7CA 5DXJA 3UZUA 5IKMA 5DPMA 1NT2A 3HEMA 1O54A 4C07A 1ORHA 3TKYA 4EK9A 3R0QA 4X60A 4HC4A 5CVVA 4DZRA 2P3LA 4YUZA 4F84A 1VBFA 3R3HA 5GOZA 4QPPA 2ZVJA 3CCFA 4MIKA 1FBNA 3HCBA 1AQJA 1KYZA 2KW5A 2Y1WA 5E9JA 4KW7A 4XUCA 3KR1A 2PVCA 5EQJB 3FPJA 4R8RA 4U7TB 1BKYA 2LD4A 2AN4A 4QQNA 3GXOA 1UIRA 1N2XA 4R6XA 4RTKA 4OBXA 4XUDA 2P8JA 3P97A 1F3LA 2ONYA 1NKVA 1VIDA 2ZBPA 5EMKA 2ZTHA 2AOTA 3NWEA 2Z6UA 4BLUA 5T6BA 3NJRA 2P40A 2YXLA 1MHTA 1FPQA 2PWPA 2I62A 1WG8A 5FWAA 4AUKA 3A25A 2BZGA 3MCTA 3NDJA 4PYLA 1DUSA 5CM2Z 3BGDA 4OBWA 1WXXA 5T67A 2UYOA 3KPVA 2IH4A 1YZ3A 1WY7A 2IDKA 2WA2A 3FUUA 3LCVB 3NTVA 1VP9A 3SSOA 3KQVA 3X0DA 2AVDA 1ORIA 2EFJA 3UJCA 3MTEA 4CXMA 3KQYA 4C03A 1NW7A 1R00A 3OE4A 1Y8CA 3DR5A 4IV8A 3FUXA 5HIIA 3UJDA 4B17A 2PV0A 5ICFA 3HVHA 1RI2A 4CKCA 1KIAA 3P9IA 3HA3A 4GC9A 3KHKA 4P7FA 4ER3A 2UYQA 1D2GA 3FRIA 1D2CA 2PJDA 5DTQA 1JSXA 2YQZA 4GQBA 3C0KA 4EMSA 2JH9A 3B5IA 3TQSA 5LSAA 1XTPA 5HIJA 2NYUA 3DLIA 4ER5A 4CTJA 3M6VA 4AZTA 2BR5A 1RI4A 5GIPE 1SG9A 3HCEA 3IHTA 2R6ZA 4E31A 1V39A 5HILA 1JG3A 1NW3A 3T0IA 1NW5A 3UJBA 5FWDA 1RJEA 4GOLD 2OZVA 1WZNA 2ZWVA 5GWXA 5HIKA 4PCAA 5T64A 1XJ5A 4R8SA 5LQAA 10MHA 1INLA 3AJDA 5B1SA 1NE2A 2ZCJA 5GM2A 3E05A 3Q7EA 5EMJA 1I4WA 2XYQA 5LQRA 4XCXA 4HRAA 2GB4A 3LX6A 1QAOA 1RI1A 4YV2A 1SKMA 3KQMA 3TFWA 2ZZKA 2AS0A 1QAQA 3GNLA 5LR6A 3C3PA 3M6XA 4BY9E 3LDUA 4QVKA 4MWZA 3G88A 1NW8A 5E8RA 3DMHA 3FTEA 5CCBA 4M7RA 4Z2YA 3VYWA 3AWIA 5K01A 3AXTA 4E70A 3A7DA 4QDKA 3G2OA 3HCAA 5EVJA 3PFGA 3GRUA 3IYLW 4NECA 3PX3A 1L3BA 1O9GA 3KQSA 3M6WA 2QY6A 1ZKDA 1XCJA 2AN3A 3OE5A 5DM0A 5EIFA 2OO3A 3DTNA 3NVMB 3TRKA 2AVNA 3JWIA 4GC5A 5K0CA 3PTAA 3WSTA 5FCDA 4OQDA 3TKAA 2ZLBA 2JHPA 1M6YA 3PS9A 1KXZA 1RJDA 4DA4A 3G8AA 3KPUA 2UYCA 3DXYA 3PVCA 3QV2A 5BXYA 3DLCA 3GRRA 2ZIEA 1VE3A 4RTQA 4YMGA 4CKBA 1L1EA 4PGHA 1HMYA 2YVLA 3A7EA 3FYDA 2AR0A 1NBIA 2N47A 2IGTA 3CJQA 4F86A 1H1DA 3H2BA 3GU3A 1KR5A 1NW6A 2OPBA 1DL5A 3KR2A 3MAGA 1VQ1A 1YF3A 3TPZA 5GP1A 3EVFA 3IEIA 4Y30A 3G5TA 2EJTA 3FYCA 2IPXA 1Q0SA 1XVAA 1MJFA 5HOQA 3UJ8A 1XXLA 2WK1A 2G71A 3B89A 4RVDA 1JR4A 2CKDA 2G1PA 2AOVA 2OXTA 1ZG3A 3BKWA 3OU7A 3OZTA 5LQUA 5EMMA 2V7EA 2IDJA 3DP7A 2ZFUA 1IXKA 4M38A 4FT2A 4X61A 4RTPA 3HCDA 3EVEA 3T7SA 1TW3A 2FK8A 3BWBA 5CVDA 4PYNA 4WVLA 3EMBA 3EVZA 4RV9A 3G5LA 1X1BA 4L7VA 2QE6A 5DTRA 3ER8A 3HA5A 4P7KA 3UJ6A 2YXEA 2FRXA 4YMHA 3NWBA 2NXCA 2P7IA 1L9KA 5U4XA 5FADA 3OFKA 4C06A 3SR4A 5FTWA 2JH8A 3DULA 3I9FA 3ID6C 3LCCA 4MTLA 4RYLA 2B9EA 2PKWA 5E8JA 4YUXA 2UYHA 4QTUB 1G8SA 3UFBA 1VPTA 4YUYA 3P9KA 3FTFA 4M37A 2AOWA 3EPPA 5GIOE 3EVAA 3UBTA 2NP7A 4K6MA 2VZ9A 4P7GA 3PB3A 5DRTA 3LBFA 5EPEA 2O06A 2QYOA 3P8ZA 4PIMA 4ER0A 2PX5A 2ZULA 4P7JA 4PIPA 1AQIA 4GF5A 4BP1A 1R8YA 3DMFA 4E2WA 4RTSA 1VP3A 3JWJA 4PYKA 4ATNA 1P1BA 4X63A 4AX8A 3MTIA 2FPOA 5BP7A 4H0NA 1KPIA 2CMHA 5EG5A 3M6UA 4PYJA 5LQKA 5DX8A 3MERA 5M5BA 5HIMA 3I58A 2GH1A 5EGSA 1SQGA 3EGEA 4IV0A 3EMDA
chains in the Genus database with same CATH superfamily
1WDTA 1XRMA 1B16A 4F56A 5SV2A 4F71A 1WLSA 1A72A 1XKLA 3QF7A 3KFVA 4L5JA 3K8ZA 3LG2A 3NOXA 4LJSA 2O8BB 1YUBA 2IXBA 1LDBA 5ED0A 4U7JA 1EA5A 3PT5A 3UTCA 2OGZA 3IGFA 4KDEA 5HJ7A 3HKDB 5KKCA 2V4UA 4KKVA 3OHSX 3UWMA 5AJHA 4KNVA 2CLEB 1TPYA 4X6UA 5H68A 2KLHA 2QMZA 2Q2QA 3EXFA 1TRKA 4C01A 3PC3A 1VGQA 3OOJA 2HMAA 2N46A 3MD9A 5HS4A 3ENNA 4KAXA 3B36A 3HP4A 4XE5A 4FD2A 4EX6A 4JQOA 3WHKA 4C2AA 2CLUA 1RWBA 1U0FA 1ZR4A 3P9RA 1OI2A 3EVGA 5AIBA 2BFNA 3CEPB 1VPVA 1BHO1 2KI5A 2YVQA 3JXEA 2KS6A 5EFZA 4RC8A 3QXXA 4YMWA 3ZI7A 1JIUA 3OY7A 2GAJA 4YREA 3UA3A 4YH1A 2OP1A 5HKKA 2DYKA 4ZXFA 3GXBA 1R5NA 4KIWA 3T9JA 1P39A 3FZEA 3IT3A 1XK6A 1SOVA 5SICE 3MMNA 5DM2A 4EVSA 2OENG 1KDVA 1XDZA 3A10A 1Z39A 1VHWA 2EFCB 3ANTA 1P7ZA 1S6YA 1TU0A 2J9GA 3PC6A 5C31A 3WIUA 2VPPA 1U2ZA 4L4SA 4EPYA 4CR6A 3M6MD 1IVYA 2H57A 4ZU3A 4X62B 2E1PA 2MYNA 1SQ6A 2WIDA 3EEBA 5K2MA 5LBIA 1NTOA 3AIIA 2V9CA 1GN8A 4EYSA 4J1QA 1TADA 2CHFA 4JJ6A 5H7XA 4BKRA 1SZDA 4GMFA 4HFNA 3RIEA 1EZ4A 2WTXA 1MB9A 5FBLB 3R24A 4N7MA 1PJZA 1KGDA 1OY1A 2NYAA 2VAMA 2XH8A 4FFBA 1UDAA 5LBUA 3LQQA 1NBME 1R3UA 2A94A 4O1MA 4RMNA 2C4MA 1RQ7A 1PJSA 4HAIA 2OB1A 4YWHA 2ZXEA 1AK1A 1MO4A 3GMSA 5I7RA 5HEKA 3UOFA 1DC4A 2E4VA 3DPSA 1U63A 3KPYA 3TW8B 3KVYA 1U6IA 3RJMA 5AW4A 1XNRB 4GXTA 4Q4DA 5CB6A 2QOEA 2YMQA 4MYRA 4J0KA 1MXFA 4W7HA 2R6GA 3V1MA 4EATA 2HCFA 3QKWA 4KWTA 4BC1A 4D3FA 3H6HA 3AVPA 2Z5PA 1NNI1 2BFCB 4DIKA 1FSPA 1PBTA 2QR3A 4Q4LA 4POOA 3IT2A 2ZZMA 3EC7A 2ZRBA 4LOAA 5A9SA 1CQIB 2PU7A 2WPDD 3A6DA 4E88A 1JAZA 4Y2HA 1OHHD 1BDHA 5JZ9A 3IPRA 3JRNA 1PP4A 4REUA 1O8BA 2GBLC 4MVJH 4X7PA 5ALXA 5IWAB 3RVRA 2W2LA 5CG2A 1CD5A 1E96A 5G0TA 1EMDA 2FUNB 4V2IA 3E4DA 5HK9A 1JALA 2ZYDA 5I47A 1SCDA 1XVVA 3H9BA 4MWSA 3TMYA 4ABTA 2ZRJA 3IHWA 1CUZA 1I3OA 5LZ9A 2FZFA 1PJ4A 1KAQA 1RP1A 1JYFA 2YFHA 3OKPA 1K68A 3JAMA 6AT1A 1LC3A 1O9HA 3K3PA 4DMLA 4EPXA 4MYHA 2HK8A 4BLWA 5KKAA 5FPSA 2XWJI 3LQ2A 1DKLA 1SNYA 1TEHA 2KB0A 4LDRA 2Z98A 4DG9A 5BUSA 2B25A 2M6SA 1GKYA 3LS2A 3F96A 4GE3A 3OIDA 1SCNE 2BMFA 4Z0TA 1SKUA 5TB5A 3QHBA 1LDEA 1U0TA 4MGYR 2K2QB 4NYJQ 3KWMA 2YJJA 1HBJA 5BR8B 2A0KA 1I3LA 3F4KA 4WKBA 4A23A 4J94A 2V7GA 1S8OA 4CMKA 1RLMA 3I1YA 5ADHA 2JEZA 3HB1A 5F3RA 3IL2A 3O8QA 5BORA 4U2EA 1G6HA 5HKAA 1X13A 4AKEA 3LP8A 3PVYB 2NTNA 2PL1A 4Z5XA 2PK3A 1XX6A 5A7GA 1WMFA 4YXMA 1RYNA 1DOZA 2OFXA 4B80A 4ZJKA 2OK7A 4HVTA 3SX0A 4W5TA 2PRYA 3GO4A 3UMFA 2OOKA 4KPFC 2WSMA 3DMRA 2BGJA 2J07A 3KB8A 2P65A 4LF6B 1VLVA 3TNDA 1MRZA 2QW0X 1CULC 4WGGA 2IYRA 2I4LA 3IKJA 1TZBA 1LSOA 5HPYB 1QH1B 1Z0ZA 2J5QA 3KQOA 3EIFA 3PXUA 1NQXA 3TZ6A 4JBXA 1ZGAA 3MRXA 1Z18A 2WHXA 3GT3A 3JWGA 3O8NA 2C9ZA 3FCEA 3KU1A 3TLBA 1QIHA 1AKWA 3A1EA 3UMGA 3WGGA 4F4DA 4WJKB 5H02A 1CBUA 3OJCA 1IN5A 4TZ6A 2HDWA 4DWOA 2XZPA 2W00A 1ZM4A 1PGNA 1ABEA 3DXXA 4RX1A 2VSFA 2VEOA 2IU4A 2WI8A 2XVMA 2YNMD 5IC6A 1IUKA 2C2FA 1NJFA 3RDPA 2XNCA 3BKXA 2NZVG 4WZBA 3I39X 1XZNA 1O6GA 2ZXFA 3OWXA 4MB0A 4HEA1 4UM9B 2E4ZA 2GETA 1RQNA 3PUXA 1Z0FA 5JV5A 5I3ZA 5FH9A 2YYYA 3L7AA 5HKKD 4OHOA 2R84A 4XYLA 3PQ8A 4CVSA 4NK5A 4ETWA 2YV4A 3W6ZA 4I4NA 3S8MA 3SOPA 2K2WA 3BE6A 2QXUA 2H2AA 4WA7A 1NN0A 2IYWA 3QEJA 1DDOA 1JMKC 2G9QA 4LOIA 2OWEA 3RQSA 3GA5A 1B26A 4KACA 2YN2A 3A26A 1KI9A 3YASA 1KRXA 1MW9X 1GPJA 2NNLD 4BGEA 1P80A 4PLTA 2C59A 4NXNB 2FZEA 4GM1A 1R4MA 2XGMA 2QGZA 3B9PA 2FQXA 1HMPA 4KK4A 4LBVA 1A9PA 3GZJA 5K0NA 3TLMA 2VP5A 1CQPA 2BP7B 2QLJA 3Q7SA 4A2WA 4DFDA 4URHA 4ZYWA 3C8MA 2C2WA 3NVAA 4B6FA 1R03A 1XTQA 3ETEA 3JASA 4QYIA 2P7HA 2GN9A 1GYRA 5LA6A 1HLGA 3G2KA 1RM0A 1X9HA 3VNBA 5FORA 1XGKA 4JD5A 3UB4A 1EUYA 2Y1GA 2WF7A 2NO5A 3IO3A 3AFIA 3P45A 4KAJA 4AJOA 3EGXA 1FJ2A 1PX2A 1GUDA 4WHMA 3EGDB 4DRZA 2J08A 1A95A 2AG1A 4UNSA 2XA1A 2VPIA 1KP9A 1WPGA 2JARA 4J0HA 3CUWA 3UPUA 1I9GA 2QTVA 1ZM2A 4AUEA 2OESA 1UUFA 5IW8A 1KRWA 3IAAA 1JG6A 4O29A 3IS7A 3GH1A 4M21A 4Y6PA 5AXSA 2JBAA 1JKJB 2OHVA 3BPSA 2WSLA 2ZBFA 1RAAA 3R0VA 2EL9A 4I7EA 2W2LD 4ML3A 1NJ5A 2OV8A 1S01A 1IY2A 2J31A 4UREA 2W93A 5AXCA 2QJTA 1HDOA 3ZVMA 1JVBA 5E9AA 2P9ZA 5FQOA 1UEXC 2GHRA 2QDXA 4MLCA 2ZUDA 5HQOA 2QUJA 1MJGM 1YQ9A 1LLDA 4MLPA 4TGLA 5AM1A 5BYJA 1XP8A 2OFPA 4M0DA 2PUFA 5DYWA 4UHBA 5ALQA 5BPHA 4OSOA 4OUKX 1X80B 1KMIY 2XEXA 4C3VA 1DI0A 5ALWA 3HS3A 3SX2A 2PYIA 2RC5A 2OKCA 2Y1XA 4JJIA 4RVOA 3TTUA 4YPVA 5BUZA 4XQ9A 1Y8RB 3SLGA 5IKMA 1J07A 1EVZA 4DBVO 2FFXJ 3CISA 3PQ5A 4AMUA 4BOYA 4EW3A 3BB1A 2NZYA 1Z5WA 1BWSA 1GCGA 2ACKA 3BMOA 3F71A 4J0CA 3EFBA 5T3YA 2J4CA 2G1KA 3ZWYA 2D2EA 4H7JA 1ETUA 3CZCA 5GOZA 2FW7A 2FZ4A 1AXGA 4O0LA 5BSMA 2O48X 5TS2A 4KQ9A 3NP7A 4B79A 1TQ4A 3EX7C 2RJ3A 4PZEA 1S5PA 2HA4A 1CRQA 2Q1XA 4OX9B 1QRDA 2ON6A 1JKUA 2NV6A 1K3UB 3E22B 3JWEA 4WXEA 3V1TC 1Z6ZA 2WRZA 4B5KA 1WL8A 4DM7A 1JHDA 2Q2WA 2RARA 5IBRA 1ZOPA 2D2FA 1T9GR 4Y08A 2ZPUA 2YJKA 3REGA 3AM1A 2I3DA 1QDEA 2WF6A 4PC1A 4CN9A 3E2MA 1ENPA 3KIPA 1L0BA 4LPSA 1KWGA 4LVCA 3C3XA 4IHAA 1NXSA 2FF7A 2ETXA 2LVBA 2BZGA 2X0EA 2IIVA 3DHVA 3LRXA 4EA8A 1ZZEA 2PMKA 4MK4A 3T9EA 5LFAA 2UYOA 3Q3EA 4U5QA 2WA2A 5LMNB 1B2RA 2OE2A 4HLDA 5CK4A 5D7NA 5CDYA 3J80A 4CF4A 3FYSA 1BO6A 1YR3A 3LCRA 2QYSA 3MTEA 1EUMA 3GGSA 4GM0A 4N39A 4LOHA 3LYLA 1VM6A 1AGRA 1G21E 4EGSA 4CM8B 4NE7A 2DH6A 1Q1NA 3Q7PA 2IP1A 3GJ3A 4LY6A 5HIIA 3GNSA 1Y3FE 2OQRA 4BPRA 1HEUA 1LVHA 4GC9A 3WWZA 2EJVA 2HK7A 4N9WA 5LXTB 1QWOA 4G4GA 5KNBH 3SQOA 3HKCB 4LYDA 3VBEA 4HNSA 1GPH1 4B5LA 4KNYA 1PDWA 2A5YB 3ENKA 5BN5A 4LJ8A 2G77B 3GR6A 4IMIB 2WTNA 1GQFA 1QYCA 1Q12A 3X1JA 1U0NA 4MSUA 4AZTA 3O4RA 1Y98A 2IEGA 3HI6A 2WTBA 1RI4A 1Z3IX 2FKNA 2JGRA 2HSEA 4RK1A 2WWFA 5IVKA 2AQ8A 2B30A 2I2FA 2QAJA 2QLMA 3HQ4O 2OPHA 4AYTA 4KJZA 2GBGA 2Q2VA 5JJCA 4MW7A 2G36A 4FEEA 2ZWVA 1CEYA 5T64A 2VYVA 4NDNE 1NE2A 4ZREA 5GM2A 3E05A 3Q7EA 4OGFA 1FOEB 3QX3A 5LQRA 1QHHA 1SVSA 1JREA 1O95A 5K3BA 4HWOA 1T8PA 2YWXA 4MVJE 3HCNA 3KSZO 3UTDA 1UAAA 2HTNA 2A5JA 2WTMA 2VTDA 3SC6A 3UOIA 4M55A 5CXUA 2CSXA 1U9ZA 4TKUB 5C8XA 4R2HA 2W6NA 3LDUA 5LNK1 2BW1A 4U9HS 3PKIA 3HU5A 3TNLA 4YRGA 2P0EA 3WRVA 1GR0A 3RO7A 4O02B 1ADCA 3N53A 1CR0A 1L5QA 3HYNA 4HJRA 4MGHA 4BN4A 1NOIA 2BF7A 1B8NA 4FNAA 1MW8X 1XPJA 4YP9A 4NECA 4R69A 4P3NA 5I4IA 1GFSA 1Z4PX 2O2ZA 5IYZB 2JJ1A 2WVHA 5BOVA 2JHFA 1BQEA 2FU5C 3KYJB 2XMQA 2YW9A 4C4OA 3PEEA 4Q7JB 5FWYB 1FYDA 3FSEA 1XA3A 2JHPA 4YKHA 3ESXA 1J42A 1KI4A 3L41A 4BVFA 3ORQA 2I3GA 1Z6XA 4C5BA 5HCNA 4DB2A 4DXHA 4JYAB 1F30A 3G8AA 4GMKA 1IMJA 3FIUA 1DXYA 2QI9C 3IELA 4G1CA 3C7KA 3SDSA 4TUYF 4F1JA 1X77A 3PQ7A 2OQVA 3PL1A 4FBGA 4QL3A 4C30A 3RUDA 3VKWA 2ZP1A 4PSVA 3N2KA 4W6QA 2PR7A 1FX0B 5HFNA 2BUCA 3CJQA 3WBKA 4NF2A 3X1KA 4DR3B 3TFOA 3JQ7B 1N0IA 1G8HA 4G23A 3FMPB 2VJNA 4TYQA 2FI1A 2PA0A 3KR2A 1AS3A 3ACBA 1O6ZA 3PWTA 1ZJ5A 3CO0S 1XMJA 3PC8C 1KKLA 3S44A 4CIAA 3M5WA 3HXPA 1F12A 5BV7A 1P1JA 4M9CA 2VZBA 1ODFA 2XJNA 1D0SA 2JHGA 3WS7A 4J4TA 5B3JA 2FLWA 3L7LA 4KGVA 5E7IA 2VSXA 2WD7A 2GK4A 1TVCA 2YFKA 3PFNA 4J4HA 4X61A 4B75A 4MPRA 4AJEA 2HOQA 3QV1A 3BWBA 3C8ZA 2NUPB 3VVMA 3A1DA 3IIIA 3MNFA 4QOJA 2VDPB 1RXIA 4JLNA 3WL6A 4R81A 5ADWA 4ZEVA 4IXKA 4HN9A 3ZHVA 4LC1A 1BN6A 2AFHE 4BUCA 2BHTA 3D2CA 4HNAB 2C31A 3SLRA 2J48A 3GD5A 4RKRA 1WD7A 4DLUA 4PAWA 2R7KA 1W2WB 5G4KA 3IBTA 1J6UA 2W2MA 3NYWA 4GX5A 5FADA 5U4XA 3KSAC 4EYKA 1YI8A 4YAUA 1E9DA 4RIEA 2J3KA 5A3QA 1QJ4A 2UYHA 2ZJ5A 1PGQA 4M98A 3KO8A 2JIBA 2P2YA 2GKGA 1HT1E 4C21A 4TKZA 1FB5A 1JLRA 1T2CA 3W7AA 1JU3A 5GIOE 2YKGA 3QU7A 3AVWA 2PPVA 2YVKA 1DTWA 1KYTA 3BEDA 5CCDA 4GU5A 4PIMA 1Q7RA 2HHCA 2WV9A 1JHAA 2PX5A 1XLWA 4FMBB 5CJPA 2IT1A 1C14A 3DMFA 1VL8A 4Q1DA 2QZ9A 5AO9A 3A1VA 1DATA 3GJSA 4QBGB 1QGOA 5ALGA 3K94A 1E8MA 1MAWA 3UJPA 1IJBA 2A0UA 2AW3A 2ZE5A 4ETMA 3WAJA 1YKGA 5A62A 4IUDS 4YQYA 4YYEA 2WFMA 1C29B 3BD8A 3HU1A 2GHIA 4K9MA 1SO8A 4JXXA 1OBCA 1UZUA 3H2SA 3GPBA 521PA 4COOA 3EDCA 4E2YA 5FUVA 2CNDA 5HCUA 4ZO8A 2IHYA 4XPZA 1LX7A 1VE1A 3AEKB 2X0FA 3O2NA 5ARBA 3GUCA 5T4BA 1YZGA 1QGDA 1LQ2A 2F4VB 3UICA 4M7WA 3NQ41 2N02A 1IN7A 2O8NA 4S2UA 5DYYA 2M1ZA 2Q7DA 4A16A 3RYIB 5DWVA 1IXRC 4BGVA 2QF9A 1BU8A 1USWA 2JD80 1OXBB 3OI7A 3ZX5A 4YCLA 3FVQA 2AA3A 2JVKA 1CY7A 4OMFG 4XVRA 3CPEA 3TA8A 2AOXA 2ZRHA 4KPUB 1FF9A 5EJEA 3PLAE 3WNWA 4JNCA 2WNIA 3RYHA 2XKBA 1V8FA 3JQRA 3RD5A 5BV0A 5IZCA 1C0LA 4JELA 1DBIA 1RT9A 2HGZA 3F98A 2W2PA 1ZU4A 5FULA 3HGTA 3UXMA 2HTEA 4KREA 3U5TA 2P1RA 3MF4A 1HT3A 4CLHA 1Z2CA 5EYPB 3WVNA 5AP9A 2ORWA 5B1IA 5FFDA 2XZTA 4DSZA 2VYVD 6CHYA 4P6VF 5F5NA 1DQNA 1TYEB 3QX8A 2VT7A 5DP2A 5DBOA 4CQMA 5EMNA 3I4CA 2W5UA 4WSOA 2HQBA 3AM5A 1JTSA 1XDUA 2NO0A 1O95D 1DXOA 2NSJA 3BZBA 3WJ1A 5CXXA 1LBQA 1P9LA 1KOJA 1VJ5A 3GVCA 3PDWA 3QRWA 2XRYA 1PT5A 2BFEA 1KAHA 2BM9A 5CVCA 4U2GA 2QLBA 1P3DA 1W94A 3RTBA 2CLSA 3H4TA 2BKCA 4X1KA 3KAPA 3LGAA 2DUUA 2Q4BA 4AY4A 4X3CA 2VJYA 4W1RA 5A03A 1R9JA 1RAHA 2B1JA 1HZZC 2J09A 2YXDA 4TV8A 4UW9A 4Y6OA 4YAKA 2XTNA 2VIIA 3CNNA 1OTYA 2I6UA 5IAGA 4BKQA 7AT1A 2P68A 5CDHA 4RTNA 2ZBQA 2YMMA 1E2HA 3BXXA 3PL5A 5LBHA 1RU3A 1Y8QA 4YXJA 5K0JA 2JJ1D 4C6TA 3OIYA 2C5BA 1CLEA 1OGIA 3I1IA 3F1LA 2GAAA 4AT1A 1WKVA 4QGSA 3K8QA 5K0FA 4QUDA 1SBZA 4YJ3F 4MB2A 3ER9A 3C15C 4NNOA 2XBMA 2PUEA 2QP9X 1U6KA 1M6VB 3EZNA 3LT5A 3ONEA 3RAVA 3BL8A 3BKNA 1NJSA 4X00A 5HVNA 4AB1A 2WABA 4LC9A 3CGWA 5DB4A 4W1SA 4UKDA 2Z08A 4UFPA 5J93A 3NXSA 3RASA 2O5EA 1Z2PX 4B33A 4D4KA 2D4HA 1NI4A 2A9OA 3HA7A 4TV9F 3BHJA 5FLYA 4K9DA 3UWDA 3TD2A 4F8JA 3EGWA 3LDHA 4UCQA 1XFDA 3F90A 1ITZA 3ZDRA 2CMGA 2UVQA 3CVJA 2G4HA 2BTQA 5HZHA 4QAJA 4UATA 3UC9A 4AG3A 2XQGA 1VMIA 1XTSA 3HZOA 1ZHHA 2AMFA 3VU8A 5CMQA 3PD0A 4JA2A 1VKJA 5DOZA 1ULUA 1N5MA 2PE5A 3ZWOA 4DQ0A 2H92A 3WNZA 4A1FA 3FRSA 2PT6A 3FPEA 3NKVA 2P27A 3JALA 1MA0A 4FDLA 4WXRA 4B8YA 5K8LA 1TI7A 2P6MA 3L84A 1WX1A 3N05A 4M60A 1IEWA 4PCLA 3RSZA 1GOTA 2FQQA 3OPNA 4A8JA 5FUBA 3HB5X 2HIGA 3ICWA 2KE5A 1I24A 4X90A 3AI2A 3ZGOA 3M7IA 2OZLB 4ZT3A 5KMGB 2C1EA 2VUHB 3JQBA 1BHSA 4ZK2A 3OFSA 5MN5A 4WLOA 3THWB 4LYUA 1RBQA 1FXSA 1UP7A 2E9SA 2R751 2ZPTX 3KZOA 4H16A 4TT3D 4WXYB 3VC1A 3PQCA 2V5VA 4I6GA 2B1IA 4LS3A 4CT5A 3HVJA 5GGXA 3EAGA 1A2QA 3KKPA 4IEEA 1FLVA 1EJ6A 1C9MA 2D06A 2QEQA 2AG6A 3AF3A 2BBOA 2Y9MB 1F6WA 1UJNA 4QTYA 1U2DA 3GAAA 4DLBA 2X5JO 4JKOA 2PX8A 1T1RA 4Q1EA 4E7OA 4P8RA 1Z15A 4PPNA 4UMDA 1E9EA 1MG5A 4FEAA 1OGJA 1Z56C 2W37A 3FNBA 4YECA 1CQZA 5MHTA 1BCRB 5ENZA 2G1JA 3HP7A 2RCNA 4HWTA 4O4IF 4XZ3A 5F5LA 2EKQA 5AI9A 1PAUA 2FG6C 4GZMA 3LKZA 3EQ6A 4WBNB 3S81A 1PS9A 1N6NA 2HBRA 4BNKA 2WJGA 2C2MA 4PQYA 2NZ2A 1PD0A 3EC1A 4IJUA 1I7LA 3V2UA 5I9LA 4KR3A 1M0EA 1VB3A 1QVVA 1QTQA 3DEZA 2PGXA 2RKOA 1RXWA 1ELOA 2A1TS 2DTXA 1Z82A 3U9LA 3WHPA 2PLRA 2VR1A 3NGXA 4DR4B 1RYFA 3KKEA 3KQWA 3Q8XB 4AQDA 3L1JA 4WXPA 3ZY4A 3DPUA 2ZR0A 3GLHB 3M3HA 4OFXA 3O4VA 2C00A 3LUGA 4JT8A 3DBOB 4JX9A 3E9RA 2XQIA 4Q3KA 2EYUA 4EY6A 4FN5A 3TW0A 2VRWA 1OX4B 3ZXXA 4E30A 4HDSA 3FAZA 5JKLG 1Z74A 2HRQA 3WJ7A 4EGQA 4XQGA 3SE1A 2H2FA 3CX8A 1VDMA 2VHCA 4WD3A 3DC2A 2R87A 2X170 2NV0A 2VLIA 4KXMA 3WP0A 1II9A 2G6TA 2WIGA 4O4HA 4M0MA 5TIIA 2GPYA 5L6MB 2UZ1B 3AX6A 3GGDA 1QE0A 3LLUA 4HNUA 1OX5A 4YJHB 4QPDA 4I1IA 4IJQA 3GGYA 3JAWB 4CQMD 4FC6A 1GEGA 4UOQA 5KI6A 4JP2A 1T4CB 3NT5A 4EDHA 1XMXA 2ZK7A 3G6KA 2PGOA 3VO8A 4EQZA 2D6FA 2H8GA 1XTKA 2XYRA 3LXRA 4KDFA 3SYTA 2O05A 4GYKA 3V80A 3A70A 5LD2C 3E1LA 3HACA 2VDWA 4UUMA 4AKGA 2Q9AA 2GBFA 2JC3A 2QQFA 3ZWDA 4YCMA 4YCDA 4AS1A 4DS3A 1I6KA 4FYWA 1DC5A 4CZ2A 1E7QA 1VA4A 2PMEA 3GNTA 3WO1A 3ZR4B 1L7QA 3AEUB 1XMOB 2JG3A 2OHIA 1JHQA 3NEJA 4NJOA 3C3CA 3GZTB 1X0VA 5DIFA 3GHYA 2JVIA 4R2IA 4S0ZA 1MD9A 2XNJA 4R83A 4XX0A 3B13B 3DVSX 2OP0A 4DIFA 5ERKA 1G4AE 5JO9A 4OI0A 3IPYA 1R12A 3R3ZA 3WR5A 4WA8A 1FK8A 3PYMA 1YGYA 3EK2A 3JPWA 4DLYA 4EITA 2YY7A 4GKVA 3WMXA 2KJQA 2P2CA 1RAEA 4X41A 4I9GA 4YJ2B 1UDRA 4XWGA 3UENA 1EX9A 2PMWB 1ML4A 1WZUA 2ZT6A 3KZXA 5JD3A 3RC3A 4DG5A 1IJEA 3GFQA 5J4HA 3I5YA 1JG2A 1TL7C 1ZC3A 1EDEA 4OGKA 4MAMA 3LD9A 3BYZA 2J0UA 1L5YA 3EG9A 5FNVF 3SVZA 1AKMA 1JR3E 4GEKA 1P4RA 5IT0A 1SRQA 2WE7A 1DQZA 4LJAA 5AKGA 1FBTA 3F34A 1XZ8A 1NONA 4YI5A 4HDNA 2LTAA 1M0WA 1ZNZA 3OKAA 4IM7A 3UHAA 1CVLA 4I55B 1UM9A 1E1YA 4Q7KA 4NBVA 3PQEA 2AV6A 4DR2B 2H4YA 3QBVA 3I9V1 4TVOA 4UTPA 4LOKA 2FKAA 3PZBA 2HJWA 5KSYA 4NMXB 4W9MC 2HPAA 3N2GB 3OEWA 4JOQA 3W5CA 1NVFA 2E55A 4X60A 3EQ9A 3KJZA 4MS1A 5A04A 2O8EA 2QW8A 1OIXA 2PRKA 2PKYX 2PGNA 3P5BA 4G8BA 3D3JA 3PPIA 1TFUA 2BGUA 1YR8A 1UP4A 5CNKA 3U6BA 1H2EA 2HLDA 3PXBA 3NC1C 4M86A 3BERA 4OUDA 4R8RA 1F2VA 1SM4A 1A5SB 4EUEA 4TZ0A 1JBKA 3I09A 4R6XA 5DHAA 3GP5A 3OZ7A 4DCOA 4DN6A 3GX1A 3UBMA 4LQJA 4H4DA 2HRDA 3C24A 3T06B 4WN9A 2P4EA 4ZVKA 5EMKA 2DOKA 5BR4A 4HWGA 1UZNA 2B1RA 3L0YA 1SPXA 4BLUA 4EJSB 5A02A 3UFXA 3A3NA 1FPQA 1ADJA 3F5QA 4UBLA 4DAEA 4EEXA 3F5FA 4UEKA 4OQZA 1JV2B 3RK4A 3W5DA 3CX6A 3GY0A 5EUBA 1DTSA 4AW9A 4D56A 5CM2Z 5FUQA 2FG7C 3MOGA 3UXEA 1CZRA 5KNCA 2XCRB 2SBTA 1UOEA 1X1SA 1SUBA 1C7FA 1H4TA 5IRCD 5AJWA 5D3MA 1ORRA 3CXUA 5KQMA 1B23P 2VXIA 4QGHA 4Z9FA 1EAYA 4YV7A 4RY2A 2O0HA 4BMVA 3P4YA 4RACA 2XZLA 1ZNWA 4ANFA 3PD1A 4LHVA 4N65A 2YV5A 5D8XA 1KIAA 1IB0A 1P0CA 2AFHB 4AU1A 1CVRA 2SECE 3R2RA 3ZU3A 2JL1A 5KYXA 3P9XA 3TGWA 3WG9A 3AJOA 1P45A 2YOFA 4DQDA 3MUEA 3K09A 4HZUB 4P3KA 4WOJA 3QWHA 3BQNB 2ITBA 3ML1A 5KJEA 1R1DA 4KHPB 3RARA 5I9MA 4AJLA 1PZGA 2FMUA 2NW6A 3L7BA 4FZ5A 4PEVA 3OF2A 3CF4G 4MI6A 5FPHA 5BSTA 4UTZA 5JYEA 1U0HC 4KN8A 4KU4A 1CZLA 3HFSA 4RGBA 4E6PA 4GICA 1TVKB 3I2KA 1E61A 3Q4QA 2VYFA 1RJEA 4J16C 4Q16A 1A5ZA 4F96A 1VA5A 3AETB 3QBDA 1KI2A 1P74A 4HYYA 3NJ8A 5IJZA 5LQAA 2RB5A 1IEVA 4KH0A 2CXTA 4TWZA 1KQGA 1GAXA 3TR5A 4YRNA 1QGHA 2QUIA 2HQRA 5GJBA 5ES3A 821PA 2NVWA 4G0PA 1SVWA 1RPNA 4PRLA 2XQFA 2Y05A 1PFVA 3AIKA 2G82A 3QE3A 3WWOA 4NHEA 1MCZA 1T25A 3P2MA 3CW9A 5EIHA 2RGNC 3TJMA 3HHEA 4HQRA 2YWCA 3U2QA 1CZUA 2QTAA 3RSGA 2D5LA 2CXSA 3FDZB 3QW4B 1GFWA 1N3YA 1FDRA 1N9KA 2B0CA 2DFKB 5LA6F 3T5MA 5K6AA 5G0UA 5HTOA 1W87A 3HN7A 3DGEC 3GRUA 1SCAA 3PX3A 6Q21A 3PQDA 4ZANA 4Q9DA 1RLJA 4ZCQA 4HQ6A 2C4WA 3A1TA 4LJ9A 4B4UA 3LXUX 4IH1A 1H2RS 2WBLC 1M6YA 1A8PA 3DZBA 2VJPA 3HHPA 4UAVA 3QSGA 5FBRB 5J1SB 3L6RA 3KPUA 4M1TA 3A4VA 1R64A 1P60A 5AW7A 5H3LA 2FZVA 4IJMA 4KC0A 1QFYA 3ZE1B 2FDRA 1SY7A 2VYCA 1NBIA 4OAOA 4ZO9A 1T1IA 1IZ0A 4A8PA 4IZIA 2RGDA 5AI6A 3V1UA 3OQIB 4U7GA 3KXUA 2V8UA 1FRZA 2C5FA 3NHUA 4W5HA 2AC4A 5DBHX 1G1AA 1Z6AA 3IEMA 1U7XA 2FN8A 1I32A 3A4NA 3ZUGA 1ONBA 1R6TA 2FPWA 3BMCB 2GVNA 3GG2A 1QG2A 1ZXXA 1QXSA 3WGTA 1VECA 5J8SA 1JEEA 3ETCA 4UM7A 2W8BA 3M4JA 4I1YA 4LGMA 2Z43A 2JNWA 3R5FA 5DBIA 4IMJB 3UB3A 3WIOA 1W8IA 2CWLA 3JATB 2GKSA 2IODA 2V6FA 4X64B 4KE7A 3AVYA 3Q72A 5FI5A 5TS3A 4DLRA 1MT3A 2QMYA 5LYJB 1IYZA 2H9YA 3HXTA 4D5GA 2PWAA 4E5YA 5EJMA 1WU8A 2NZUG 3WYAA 1JEYB 1PW5A 2FUCA 3R7FA 4LCJA 3IBFA 3MWGA 4BRSA 3WKEA 1WUJS 3FHLA 4I14A 1WSBA 2AJDA 1HZJA 2XR1A 5CDGA 4TYPA 1REQA 1M33A 3FZYA 3VSAA 2HLDD 2VQEB 3UAZA 2B9EA 2IY9A 4U00A 3U44B 4QUKA 3Q3CA 3OE7A 3V8BA 1SIUA 1L8IA 1DCMA 4G4JA 3QUAA 4M8IA 1ZN7A 3OJFA 4WECA 4WNAB 4XGIA 4FM9A 2QD5A 2X22A 4CCAA 3C3MA 1W59A 2O06A 3AEQB 3P8ZA 2NOAA 1D03A 1E4EB 4NL4H 4A92A 3OZEA 1ZLXA 1Y5IA 1EVLA 3CY6A 3NM4A 8LDHA 3GGJA 4Q3NA 3IRVA 1X7GA 3DAOA 3NOVA 4LRXA 3UOWA 4ATNA 2PYDA 4AY2A 2OO5A 1YJAA 3BK7A 4BNJA 4H17A 3TIFA 1KERA 2DHEA 3JAKA 6ABPA 4CFSA 4UVDA 1CS0A 2ALJA 3W04A 5B2FA 5KNCD 4G9EA 3SS8A 1TDJA 2MJLA 2HWXA 1VSQA 4HH3C 3H6GA 3L7MA 1U2PA 3BSYA 1G5TA 1SH7A 5F2EA 3M89A 3ECCA 4YLYA 1FFCA 2N1MA 1YE3A 3FZNA 4L5IA 4KTVE 4QTXA 5F7ZA 3VAYA 1PR1A 1VYUA 3MHPA 3ZK7A 4A1OA 1A77A 4OSEA 1A7JA 3K15A 3RUEA 2QN3A 2V96A 3FGOA 3EC2A 3NWJA 4ZCMA 3GA0A 3W9SA 3ODGA 3QXHA 2I2AA 2G9UA 3DLAA 2DFPA 4N48A 1ZX1A 1SVMA 2YW6A 2OCGA 4Z5SA 4RC9A 5LU8A 2Q9CA 1V3QE 3TINA 4E14A 1NT4A 1RZ3A 4C5CA 4HGYA 4MKUA 5AQEA 4DBLE 4FGUA 2YOHA 2VH5R 5FOVA 2J30A 1B8OA 2EIXA 4HX2A 2NNWB 4LXTA 4MGZR 1FC0A 4L0MA 4OOEA 3JX9A 4P4UA 2VTBA 2C9CA 1RWQA 2X41A 3Q2IA 2GF0A 1OPXA 3A05A 3B2QA 1W4BA 4PZUA 4WXHA 1RR6A 4FLMA 1WCXA 1PNVA 2FFRA 1L4KA 3H9JA 4JXJA 4CIYA 2JHAA 3A6EA 3TMAA 3IP1A 3JQFA 1KY2A 2LIPA 3NHYA 2H5JA 4ZHQB 4RJIA 4FX5A 1TIBA 1U5BB 2AD1A 2AD5A 2XUOA 4IGEA 5EHGA 5B5SA 4QJ4A 4LJ7A 5L8VA 1SB9A 1YA4A 3AY7A 3ISTA 4B9EA 1Z0JA 1OE0A 4EA7A 2V7XA 4Y6QA 3TEJA 4KQCA 1JUDA 2XGOA 2Q7OE 1R0RE 1Y82A 2CL7X 4JU8A 1ZUWA 1GZ4A 3EDMA 3PNVA 4IVRA 1BOOA 1ICEA 4RPJA 1TTHA 2O1SA 1E0SA 3BA1A 5C52B 1A2KC 1JU9A 2FJUA 2H00A 4FBLA 4H7HA 1Z8FA 4MLZA 4ZT4A 1HM5A 1PUJA 1T2UA 1RKVA 1Z25A 3F46A 1YWGO 1HYEA 1XRNA 2BSAA 3Q3GE 3N8NA 2D8AA 3HI4A 4WY8A 5BW5A 3FOFC 3LBIA 4OX9Y 4Z53A 1K8YB 2WT4A 4Z9BA 1IN6A 3LK6A 4IHJB 2G7ZA 4QOHA 3KETA 3TM5A 5L53A 2I4NA 2R4QA 4HSGA 1RPTA 1JG1A 1WMSA 2FPPB 4MMZB 3WWYA 2R1VB 3WRYA 3HM9A 3F5SA 2GGSA 3C6MA 1QSGA 3CMMA 3H1BA 3L0SA 4QXPA 3L9XA 2Z2XA 2YY6A 3HCRA 4MI9A 3MRSA 4PLCA 3PVTB 1H0HA 2G76A 1KXJA 3SMQA 3M82A 5BWMA 1UM8A 4A5OA 1D5CA 1W2GA 5L7TA 5DNDA 1SU6A 1CQJB 5AESA 1E62A 1W96A 2VSQA 2V9ZA 3SXJA 1QZXA 3QTTA 2OCYC 1ONNA 1CF2O 3A9TA 2QTHA 3C14C 3GFOA 4KRXA 4OAQA 3VYUB 3ZWCA 1AKVA 1U0SY 2ASEA 2Q4EA 1WUHS 2NACA 2B92A 4H15A 1R9NA 2HA7A 4HL6A 4YYZA 3TB4A 1SXGA 2H0QA 1YFJA 5KYUB 3M33A 4H77A 5H82A 1Z2EA 2QI9F 2Y1CA 5JADA 2P9CA 4ZQHA 3KQLA 1Z07A 1RRFA 2ZIXA 3SZLA 1T5HX 1P0QA 3IH5A 4LE2A 5D7BA 3VAZA 8ADHA 4DPLA 3WLEA 2FP4A 1CVIA 3RC2A 1A9ZA 1VJTA 4R42A 1SBNE 1FVOA 3F9CA 4IVQA 4N5NA 1R6BX 2QRHA 3ES9A 2V15A 1N6KA 4NDZA 4MHOA 4WFQA 1ODIA 3ESRA 3D1LA 4OA8A 5IDWA 1U8CB 1HNWB 4B2IA 4E4TA 4E5DA 4C7KA 3VKGA 3GRZA 3HL4A 3NEAA 3GZ4A 1E2KA 1P8AA 2K4MA 5SZIA 3GJ6A 4DNQA 4TWAA 1JQLB 4PHFA 2WM9B 5K0SA 1RXCA 3LY7A 4MEJA 4OY3A 3KZKA 4NE9A 3OE7D 2B35A 1C1XA 3LC0A 4IR7A 2C4HA 3AP1A 4J7UA 1XTRA 3EA5A 1UVHA 1YXMA 3ONDA 4LC0A 4QDZA 4RFSB 1TUBB 4IDPA 1P8JA 2VDRB 1DWUA 1HDYA 1NVDA 2VF8A 4ARUA 3AEXA 1V96A 5A6VA 1AHNA 1GPWB 3HTXA 4P33A 4NBNA 3STYA 2G70A 2ID4A 4Q3OA 4R8VA 1G9SA 4H0CA 2RHJA 3HMKA 1IDOA 3R2LA 2ATIA 1CF9A 1ZH0A 1RW4A 3L1KA 3HPRA 3WXBA 3O4FA 1VGVA 2EGUA 3QLVA 2ZDHA 3C6ZA 1LI4A 1OR8A 4H2DA 3UJ7A 2XF8A 3B9BA 2HGSA 2XD4A 1GUZA 3ANMA 5ARCA 4E51A 4E33A 2YQ4A 2NT3A 1CU1A 1Q0QA 3TLYA 4CDRA 1RRVA 1MIOA 1SA0A 2NXNA 1M5UA 4G36A 4MIYA 3ST7A 4IGFA 3VSCA 3FPGA 4YMLA 3RS8A 1ISFA 2F17A 2FY8A 3BGSA 4CEIB 1OI7A 3EVCA 4YFVA 4JT2A 1G8JA 5LOVF 1WHTA 3HBLA 2O3UA 5CIYA 2R86A 4ZJUA 4J0QA 3QGMA 4A10A 3G9ZA 1YK0A 3KXLA 3QI7A 4XR9A 4ZVOA 4YBZA 2WJYA 3BREA 2B8JA 3H5OA 4GKJB 1GPLA 2GFIA 2YWDA 2X9QA 2O9JA 2WKQA 3GYBA 4GMHA 4XAQA 3VHRA 5J2TA 1XZ3A 1Q7GA 3AF0A 1RYBA 3MRVA 1J99A 3PPXA 4PTLA 4UZFA 2ORED 4ZOLB 4DAOA 1A8HA 4BATA 5K3OA 4UXIA 3A2MA 4FOSA 5IARA 1F2TB 5TC4A 1EXMA 3DMYA 3RI3A 4DT1B 5ELXA 3V7YA 1FXUA 2E4YA 1A1VA 4P80A 4BFXA 3U3KA 4Y1RB 4NCAA 4LDAA 3H7AA 4JR2A 5FWXB 2Y1EA 2REXB 1TM7E 1HOXA 2CJFA 2OY0A 3FLMA 4BASA 5HF5A 4C7BA 2JGDB 4FGZA 5BN4B 3VZSA 4BQSA 5EQDA 4WKOA 2D5IA 4BNFA 2Y6VA 4QYSA 4HNGA 5IAEA 1KO8A 3U7IA 4FGJA 1LBTA 4O4JB 4PXYA 1J9ZA 1NVAA 2C84A 2WQ7A 3OM0A 1IIRA 3MBKA 4CTKA 4GOKA 4CIWA 1NP6A 4Z1OA 5IHPA 4G0YA 3A2KA 1YV9A 4KDRA 1H8ED 2OYCA 3BJZA 4PXSA 5DSXA 5BMVA 1QZTA 1Y6ZA 1GV0A 1Y6GA 2QLNA 4ZO4A 3NDBB 3ERCA 2XUJA 3EZ2A 3LUCA 3QELA 3ELDA 3AJRA 3LBHA 5HUJA 4BQIA 3CH6A 2XDAA 5GOTA 1F2UA 3QHCA 1L3IA 4MR9A 4OQMA 1T9DA 4D3DA 3PPVA 1EXWA 5I6DA 1MOPA 1Y48E 2BKUA 1HLFA 2HLNA 2R85A 4KWHA 2OBMA 3B7PA 2IUUA 3WV4A 2EZ4A 4B7CA 1U0JA 3P52A 1OW3B 2XYPA 4E40A 3WGYA 3OUZA 5D00A 4DDWA 4L8GA 4DOMA 5AUPB 1C30A 1PL8A 4PYQA 1E59A 3D3WB 2ZSHA 1RJGA 1BFDA 1VLJA 2JH3A 1RI3A 2ETVA 3TDMA 1L7PA 3DLHA 5GONA 1DQRA 2H7VA 4PYMA 5EJ2A 2IEZA 2X23A 2DWPA 3JTEA 4IQ4A 2Q5LA 5K3CA 2GHTA 5E2BA 4ZN6A 4DJAA 3A0RB 3DDCA 1MBZA 2JGJA 3T3DA 1XLTC 3MTQA 5JH7B 1FRNA 3IDQA 3NKLA 3DZGA 3W2IA 3VHLB 5LDDC 2WYHA 4TOBA 2G80A 3V7UA 7MHTA 1DBQA 5CCEA 4LDPA 4CEHB 4PZCA 3EXEA 4CN8A 5EE3A 1QYXA 4JBIA 2XNDA 3DLTA 3HL1A 1W9HA 1PZNA 3D4LA 5JSZB 1B0AA 4QYMA 1A5BB 2P9HA 4J90A 4BNUA 4UTRA 3R6TA 4DZ0A 1UEJA 1WCIB 1CJMA 2PH1A 2XE6A 5K7SA 1KY4A 2PAAA 3ITDA 5FV4A 5JPIA 4TSFA 2GLUA 3VH1A 4UJ3A 5JT1A 3L7OA 2Z6AA 1QMGA 2JFYA 1NIJA 1M3SA 2CLMB 2C94A 3RS4A 3I52A 1NQTA 5K3AA 1TM1E 5CVVA 3R41A 4UEWA 1XNQB 3FTPA 5C5IA 3F8TA 2P9FA 3CSUA 1XD2B 1T3TA 1H66A 1S2IA 2Q29A 3CCFA 5J1TB 1PDOA 3OPYI 3SDBA 2GHQA 4R9RA 4X65B 2Y1WA 2C57A 1CUWA 1OCEA 1ECJA 2ZRLA 4BB5A 1EFPA 3ADOA 3NRJA 4ZPXA 4MVYA 1MA3A 3IUEA 2Z1NA 4GR9A 2BL4A 2AHOA 4R3NA 1H42A 1QHYA 3K92A 1FNCA 1NZFA 4FEGA 2J59A 2BGWA 2NO7A 1NPYA 4OQNA 1DKMA 1KAOA 2H07A 3KUCA 4NICA 4XUDA 4PHGA 2ONYA 4MQLA 4B6OA 1C81A 2LBPA 4N12A 2R8PA 4MW6A 4CG1A 1JDSA 1UMDB 2NU7B 2QD3A 1SEPA 2YXLA 1MHTA 2I62A 1T10A 4DCCA 5H81A 4R5HA 5JI3E 1WD5A 5CA0A 2VZ0A 3PXGA 3THXB 1DRKA 3KTFA 4Q0MA 4BEJA 1PR4A 5ALNA 3HKBA 4D02A 2PZMA 3F8WA 5KB3A 3EZ0A 2DQKA 5CXQA 2G0AA 3C41J 1ORIA 1L4BA 3HY3A 4UDXX 3ZGNA 3DYIA 2ZSBA 3AB7A 2GEDA 1BJTA 3HC7A 4C03A 1AMNA 2G0TA 4DLZA 5HKOA 4KLZA 2VHEA 3OE4A 4L08A 1Y8CA 1A7AA 4BO4A 3UJDA 1N2IA 1ORTA 1MNAA 4N3GA 3U4AA 1H1LB 1NWCA 1RI2A 3K9FC 2O59A 2C96A 5L4SA 3LNCA 2QZPA 3M6LA 2CHVA 4EVQA 3M1IA 3HA2A 2JCBA 1AZSC 1WTCA 2I1WA 2WF9A 3SS7X 1ATIA 3BE8A 4C4TA 1K0UA 2QM0A 4ZIRB 1PYGA 3ZD6A 3PUYA 1AK9A 4O4HF 3PJFA 1U2GC 1NY6A 1OAAA 3K20A 4GYWA 3T7JA 3FHTA 2K6GA 4M9UA 2X8LA 3E7XA 2N75A 4PLHA 1TTTA 2NN3C 1JG3A 5UKDA 2Y71A 1DC8A 2XOEA 1O89A 2B94A 3MN1A 2PA3A 2PH3A 4GOLD 3K2IA 4QU0A 3PGKA 3SS9X 4F92B 2A1UA 1JLMA 1FHAA 3OPMA 4WBXC 1C8LA 1VTKA 2QTMA 3G2IA 2REOA 1HG1A 2C7BA 5A4DA 3HO1A 1FUUA 1HYGA 4K26A 3TCNA 3V8VA 4X71A 1YASA 3ZEAA 2HA6A 2P75A 5DI3A 1BTOA 3HSSA 4UBKA 3LA8A 3OA2A 3TOXA 3ND9A 4LIPD 4U7WA 1NMYA 2HU2A 1X0XA 3RG2A 3R5XA 1T34A 4RGVA 2H85A 1E3QA 2JFUA 2VBCA 4BY9E 1G66A 1HI9A 4LK3A 1VI6A 3KLBA 1FPMA 2RGYA 3OP1A 3QMMA 1N2GA 5JDOA 1PE0A 3VJRA 1GNRA 1LNZA 2WYOA 1YKFA 2XUPA 1G5FA 3NAGA 1R10A 4NDAA 3RVJA 3UANA 3KNZA 3FJYA 4OLFA 5B4TA 3GDGA 1T0HB 3OAAA 3X1ZA 1W88A 1FRFS 1XCJA 1DJQA 2AN3A 3NVMB 2ZCUA 4H0FA 3T3OA 3DTTA 1J8VA 1M7BA 3EMVA 2I6SA 4J9VA 3HXKA 2NGRA 3ACCA 4N7BA 4U7FA 5K0CA 3P9QA 4NAVA 5LWHA 1W85A 1BEUB 2ZLBA 3QUBA 5E6RB 2GAIA 4RZ3A 4UBMA 2QA5A 4WK2B 2EDAA 4HQNA 1RMYA 1O6FA 5CPFA 1K5HA 5BXYA 1OTHA 3NEYA 3D31A 4PZLA 2M1XA 3TRDA 2QAGA 4DW8A 2F43B 5JAHA 4YMGA 3LC2O 4XVCA 3ASUA 4L3OA 1G98A 3DCYA 3C5CA 2QTFA 3CCCA 1ZD4A 3MFYA 4EMBA 2MGYA 1M6HA 2R6HA 1FP7A 1BE0A 3BMXA 4AF8A 4IIUA 5LN1A 4F1KA 2WHPA 5DK4A 2WNHA 2NO1A 4HH0A 3V8QA 1LVGA 3EXHB 2NUBA 3H87A 1BRMA 4H1VA 3OUTA 2ZM6B 3LW8A 3O03A 2AN1A 3WK6A 4FJ1A 3NHFA 3KD2A 3FOEC 3O75A 4L2IB 4K0RA 3USCS 5DE3A 1DLIA 4GG1A 5HOQA 1PZEA 2VNKA 2XNDD 3NHLA 3Q7QA 4L4YA 4L4ZA 2B8WA 5KTRA 3D43A 3HB4X 3H1AA 2AOVA 3V4PB 2G1PA 4U3JB 2AG5A 3T35A 2XWSA 3KL2A 4H59A 2HKIA 4OGGA 4F5YA 4TSFD 4KFSA 3KKLA 3AEZA 1QE5A 1AS0A 1BFKA 3CNHA 4B3RB 4IV5A 4MA4A 1ISPA 3G23A 5LYYA 3O1LA 4QPZA 1I0IA 4EPWA 4IGIA 5IKPA 4JB8A 4YMHA 2DFDA 1USGA 1W9MA 1H96A 4G8DA 3K6JA 1JGCA 1DDIA 2TRSB 1OZHA 4WZBE 3HXQA 3L7CA 2H2IA 3NTLA 3SR4A 1W8DA 3DGFC 2Z4SA 2A84A 2FPLA 3KTDA 4LMAA 3MYRA 4FI3C 4LV5B 1T8SA 4ND8B 2IHNA 3E1KA 4HAZA 3IV9A 3K5WA 3DDWA 5FUXA 5A7HA 3TZLA 3RVQA 4BRZA 1HDGO 4EO9A 2P9JA 4AKHA 4Z0NA 2Z58A 4CVNA 1Z2NX 1QVZA 1GL9B 5JYCA 1PZFA 3AR5A 2OCAA 3R75A 4ZRNA 1NURA 2HH9A 4BAUA 4ESOA 3HRIA 5CYGA 2DHQA 3F3YA 4AX8A 4EWLA 2Y67A 3QP9A 1H6CA 3K0EA 5BP7A 1W4LA 1M8JA 5I8ZA 5HM8A 2H1OA 2LRHA 3QFCA 1QONA 3ZDXB 4HFRA 1DVRA 2IHVA 3V00A 4ENVA 3HV2A 2J0SA 3OM9A 4HX5A 2Q7XA 1XKTA 1R18A 2KX7A 3KTAA 4CLXA 4QELA 1C4WA 5TGDA 2IHTA 1KDYA 4NENB 5CLHA 3NC4A 2RJOA 4RTRA 2FR0A 4GI2A 4RF4A 4D8YA 1QANA 2JB9A 4WACA 4GXQA 5THXA 4FB4A 3TZHA 2W2VA 4OMCA 1STOA 4OJMX 1IWOA 5HU6D 2BD0A 4GI3A 1XZLA 4N5LA 3FHOA 1Q6ZA 4ZVQA 2HYIC 2QT1A 3BXEA 5JS6A 2GWRA 1VJGA 2BKXA 2KWIA 3GRVA 4JX8A 1U7PA 1QLWA 2DUNA 3MELA 1AB5A 1NSFA 3WRXA 3KOXA 3D0KA 3NBAA 3OU6A 3SICE 3V2IA 4HTAA 4CDNA 3DNFA 1HORA 2AZDA 4ENUA 1QNLA 2TMGA 3DLPX 4F06A 3GLFA 4LRQA 2C2ZA 2VP0A 4L50A 3PR2B 1XYYA 3L1UA 3EASA 3MMXA 4P0TA 1RWVA 2WAMA 3IP5A 3PHLA 2BM1A 1XU7A 3EFOB 3FNQA 3KE8A 1MO6A 1RQ2A 2P2DA 3GEHA 2FZGA 1Y1SA 4BNGA 2MDTA 1MVOA 2XMSA 3C1ZA 1Z8NA 1SKBA 2WM3A 4BBZA 3KA9A 2XAUA 3SQMA 4DNFA 4A27A 1UC9A 5CH8A 4F7DA 5C7LO 1OJ7A 3AHJA 2QLFA 3OZSA 1DWPA 4TMTA 1I7NA 5E6SA 4WKGA 2ZYTX 4L51A 4WPGA 3WLKX 4JC8A 3OFJA 4G9GA 4Q7MB 4X1IB 4HEQA 5F77A 5FUWA 4B0PA 1OC4A 1USIA 1HTTA 1S96A 1YVDA 1PDVA 2X86A 2B78A 2W9XA 3AFGA 3OOYA 4FT4A 4O25A 1SC3A 1LNQA 2IY4A 1G55A 3TZEA 4H7KA 4L15A 4QGGA 3WYFA 2JAPA 1HTBA 3WOHA 2V54A 3MWEA 2HBQA 5JR3A 4RZXA 1HLPA 1NQWA 1THTA 3LJKA 3OAAD 4KO1S 4TTRA 5AKZA 3VPAA 5EJ4A 3E9NA 4EHNA 1NMQA 2FSSA 2OSVA 1IIBA 1LI5A 1ZA1A 2H9AA 1BA2A 4WRRA 2P90A 2VQDA 5CD9A 4MQUA 3SR3A 5KWSA 3BAZA 5KVQA 1V6CA 3A3KA 4ZD6A 5KYWA 3L40A 4MR8B 4NG4A 4C0XA 2CD7A 4L5AA 3ZJYA 3HK2A 5FJIA 3OOSA 3MOSA 3AUKA 4PF1A 5C2JB 3HBAA 5C53B 3HUDA 2OLEA 2ZA6A 1QH9A 1C3LA 1P2FA 1ZN8A 1R8XA 3EEIA 2D62A 1ZSYA 5INTA 3BWDD 3OJEA 2FG5A 1II8B 1TT5B 1JHZA 4RK4A 1PSZA 3WGQA 1GAJA 3SP1A 4ZT6A 1E2PA 1Z7EA 3GEDA 3NORA 4QFMA 4A0GA 5K8CA 2H4XA 3GLTA 4QATA 1BFRA 3FOAA 1W5SA 4YX9A 1LZLA 1K3FA 3DVAB 1ORWA 3Q87B 3UK7A 1MC1A 1XN4A 4RJJA 1PJQA 1QS0B 4XPIB 4EENA 3CVWA 1SWWA 1TX4B 1P1RA 3BE5A 1Z68A 2HZBA 3TR6A 1VKRA 1UEIA 3PUIA 1BX0A 4GP7A 3S2IA 2DT8A 2GAFA 4H60A 4YDRA 1I7QB 3AK8A 3W1VA 1C1DA 5CT5A 3KDQA 1WU7A 2FUG6 2BMDA 5BW4A 3IPLA 1P29A 4EJFA 2Q3HA 5DGIA 3VNAA 2O6LA 5THQA 1SBYA 3CMCO 5JRZA 1PQ4A 1U0GA 2XXJA 1OXTA 4ERXA 3B2EA 2ZYUX 2ENWA 4EY3A 2ARKA 4GPAA 2EEPA 3TRJA 2ZUWA 4ILKA 4Y2JA 1P17A 2AZMA 4YRZA 1KI6B 1VG8A 2VDUE 4IJ5A 5JCZA 1H05A 1MORA 1E9CA 2VQSA 3LX8A 2CFTA 1A50B 1TIKA 1Z6OA 2X2PA 3EXIB 3GCWA 4LYJA 4PZDA 4TMZA 1YFLA 1G7TA 3QPAA 2Z09A 4P58A 2GRAA 3IEXA 5GY7A 1E0DA 3AKZA 1W36D 2WIBA 2DKFA 1VSUA 1O08A 1NE7A 3UUEA 3I64A 3ZHBA 5BN3A 2O07A 5HJ5A 4LBYA 3SK0A 5K9ZA 4RLHA 4ESVA 2H8KA 2Q62A 1WHSA 4XYGA 4RMGA 3WL7A 4MKXA 2GPSA 2XIQA 3A9CA 3R3XA 5GM1A 4LXYA 5K51A 1G4UR 3HKEB 1SC1A 4FYHA 1W73A 2GN6A 2FOLA 3I9LA 4PFKA 4C20A 2IU3A 3DOHA 1WXDA 4FHGA 1QVWA 1HF3A 1PV1A 3N8KA 1LVUA 3UK6A 4RTLA 5EJ5A 1QRUA 2IS2A 1K63A 1Z4QA 1LDNA 1AKTA 1R6DA 5EWMA 4E7PA 1LTKA 5AOAA 5B3LA 1OLSB 3FWKA 2PL9A 2QENA 3C5HA 2GN0A 1L5SA 3EVNA 3NBUA 4MP8A 4YRMA 3UWPA 5EY5B 5KTPA 2WWYA 4BJ6A 1SZPA 3F74A 2CY0A 4G09A 4GUAA 3HDYA 1N9ZA 3N86A 1LA2A 3NNNA 4JUDX 5HJFA 3L4SO 1SXJE 1V25A 2HDOA 4OTZA 4QEZA 3E8SA 1IG3A 1N2ZA 1ZGHA 4LI0A 1J25A 3JQGA 1RCDA 3BIFA 4OMUA 1IRXA 3GL9A 2O8BA 3WKBA 2PEZA 3BUSA 4RORA 5K0LA 5ES4B 3EVBA 3M9WA 2QL6A 3LRPA 3JU3A 1M1NB 2JIRA 4FKBA 2GZSA 1X6VA 1ML3A 4GZ6A 3HKDA 3E53A 1TCCA 4OGWA 1S2OA 4LE0A 4EKGA 1ODJA 5BYKA 2ZRNA 2ROQA 4K46A 4F21A 1XDBA 4FMDF 1ANKA 2H1FA 1DCTA 1YIAA 3WYNA 2V74B 3EF3A 1G7SA 4CWAA 1Q74A 1VCNA 2IB0A 3I2YX 3CVXA 2FMFA 3ZW8A 3EEFA 2YZNA 1YR2A 4EMUA 2L17A 2P3OA 3E6AA 4KLAA 1G0OA 1PTJA 4Z9AA 5FQNA 3EFEA 1YR7A 3N6RA 4E11A 2YXNA 3OC6A 1YBHA 2IBMA 4M8LA 4JOCA 4I3HA 2HHAA 3UAWA 4BFZA 4MUEA 3LKBA 1ZRHA 1V3UA 2WW8A 4AJNA 5FA8A 2JK0A 1QAMA 3WGMA 1TYCA 1ZYUA 3PWQA 3KSUA 1A9TA 1XTZA 5TQ0B 4BKMA 3DAPA 3WOVA 1BXRB 1CPYA 4KR6A 1XZBA 1YHNA 4B3IA 5D8SA 1VL0A 3F36A 4P31A 1CUIA 2D1FA 4LF5B 1BDJA 1RQPA 3IQEA 2IUYA 3BC1A 5JFTA 1D4ZA 4Q15A 3TLEA 4MDFA 2PV7A 4UEJA 3COPA 1PFQA 3EF1A 3PI6A 5CUQA 2NIPA 1YVPA 3EIOA 3R9WA 5BVHB 1JJVA 4OLBA 3VNUA 4NYMQ 2MINB 1Y34E 1TF7A 3LOQA 1CJCA 1KVSA 2HD4A 2Y92A 4BP3A 3C7DB 4UD2A 1N5OX 1WW2A 2AEFA 4K9RA 3SZUA 2F8LA 3MJCA 5IM4F 1NG9A 1X7WB 1CW2B 4NBKA 2AUMA 4F60A 4ZKHA 1RAIA 3KJNA 1GGJA 3R8CA 2AYZA 3TW8A 5JVDB 3AF2A 3ADCA 2R4UA 5JUWA 1XMPA 1ZSNA 4MRMB 4BVLA 1O87A 1LPPA 1PZMA 2KSQA 4ZAXA 4CL3A 3K70D 2GYYA 2BFCA 2P5SA 5AKLA 4F2HA 3O47A 1RVV1 2QN1A 3VOTA 1GQQA 2ECFA 4LAFA 3VSEA 2CNOA 4ETNA 1YL7A 2PX4A 5ADVA 4XKUA 2PZ8A 1QP7A 2IS4A 5IU6A 4NQZA 1DT5A 1H0SA 4YRAA 3TF5A 1RKBA 1KF0A 2Y3IA 1IESA 3B1YA 4TLEA 5FXMA 5HUQA 5HNKA 4KRFA 3TUZC 3PEYA 1HE8B 4CYBA 1D2EA 2GYWA 3VR2A 3N2EA 4EW6A 1W35A 4NLLA 1JIXA 1SAYA 1Q22A 5K52A 3KYDB 5DPMA 4LDNA 4XDZA 1ISHA 5HGXA 3IV7A 2ZWOA 2IE0A 4P4TA 3QWIA 1E60A 3M8KA 3TKYA 1ZBQA 2APJA 4M4SA 2DERA 5HHTA 4B46A 1FXWA 4XQEA 1WMDA 3EDYA 4LY3A 2GZ3A 1IAVA 2PKQO 4FFMA 5C7IO 1IJKA 4DM4A 3OSUA 3JR7A 5B30A 2ID7A 2P4HX 3P9YA 5EQJB 1ZVMA 1BKYA 2POCA 3DBHB 2LD4A 4L9WA 1TCBA 5F64A 4EHDA 5JIBA 4F6LA 4Z7JA 1SELA 1G42A 1AQLA 1XO1A 1R4NB 1X9IA 3IC5A 4G5HA 3B1XA 4JOSA 5KDLA 1TMGE 4C0WA 1X7YB 4ZRMA 3N9IA 1KMCA 5KNCH 3NWEA 4UC0A 2DLCX 2W6IA 3NI2A 3OCCA 4MKHA 1U1FA 1WG8A 2O7VA 4FGKA 4CF7A 4G0OA 3LPAA 4UNPA 3PUZA 4D97A 1NBOA 4K3VA 4R98A 3N7AA 4TODA 1WXXA 1WY7A 3FUUA 3L0BA 1EUDB 5AVJA 5CDFA 3Q2KA 5T8KA 4MCJA 3UMYA 1KMQA 2JVJA 5M29A 1OFVA 3PVYA 1NW7A 2OORA 3ESYA 2BMVA 2Z2ZA 3PA8A 1QHEA 1KI3A 4G5GA 1PKXA 4EUHA 2A4KA 3P9ZA 3K05A 4B6RA 3A14A 1V95A 4DSTA 1RQGA 1Z0UA 3QLUA 2PYBA 3WKCA 4L76A 4B3TB 1M2OB 2G17A 2EQ5A 2Z4RA 1I30A 2UUAB 2Q0SA 4RHTA 3RTEA 4BGUA 2C41A 1THGA 1QH1A 3MTGA 3T9DA 2R0QC 3E3AA 3RUFA 4LF9B 4AO8A 3H9UA 4M6WA 3RBXA 2VWQA 3LP5A 4CTJA 1NPTO 1Z29A 4ENRA 3WO0A 1DQPA 1J21A 2VDQB 2KLBA 4RHEA 1FNDA 4LPKA 4UMVA 3S2ZA 3WB2A 3PFWO 3HCEA 3FKJA 4YTEA 2R6ZA 5F76A 5I8PA 1PKEA 1M83A 3BA6A 1LRLA 3BSSA 4RKEA 4IDCA 4C14A 1QPGA 4FGSA 5JNUA 4BYGA 3E9ZA 4PLZA 4BAGA 2GJ8A 2QG9A 4AG6A 2BKVA 4RD1A 3K2BA 1NBEA 2IKSA 3FWYA 1YZTA 3IPCA 3H2YA 1U9CA 5JCOA 2HHHB 1Z13A 1YJBA 3IEUA 5ILQA 2XYQA 2PX6A 2A4MA 3EFHA 4DUGA 3MG9A 1QAOA 3UK0A 4K6KA 4TZTA 2Y4OA 1P33A 3MZ0A 5IJXA 1PJ8A 1PWHA 3A6HA 2QJWA 4FC7A 3EIUA 2X8BA 4JGIA 4I2NA 3ZTTA 3M6XA 1MZPA 4AIIA 3E7WA 4XKTA 1SU7A 3K9GA 3PFKA 3JASB 3SNHA 5CCBA 3FTEA 4MV8A 3T7RA 3A6KA 1ICIA 1Y3IA 1TJNA 3AXTA 3ES3A 3CZ5A 2J6BA 4EHKA 2X0DA 3OJWA 5H4GA 3G2OA 5U9CA 1OBHA 1IHYA 1DINA 2I91A 4OHKA 1PWZA 2BCEA 4QIHA 1CIPA 4YIHA 3OTIA 3NBXX 1SCBA 3KKMA 4QUIA 1AT1A 2IS6A 3T9FA 3PTAA 3L93A 1ZDMA 4Z6KA 3FI0A 2RI6A 1R3DA 4LVUA 2EKDA 2EKLA 3MGKA 4N0MA 3J81k 1KXZA 2Q1YA 2BP7A 1SUCA 3M4YA 5BQOA 4A73A 3GRRA 3DVLA 5F5XA 4ZCRA 3Q85A 1BROA 5CDSA 5JQGF 4OHMA 1T15A 2WG0A 2WJVA 3B7GA 2RHMA 3ND8A 5J2UB 1OLOA 1Y4ZA 3FYDA 1UBCA 4IS3A 3UKDA 3DSRA 4WW0A 4CBVA 2IGTA 3P5SA 4HB2A 3H2BA 3V1YA 3B9RA 5EXPA 3HZRA 1WZ2A 3RS3A 1U28A 4DABA 3AU8A 4LHXA 3MAGA 2P4QA 3PQ2A 4BB6A 3TPZA 4YR9A 2G9VA 1LW6E 1G5PA 4Y0VA 1NBWB 3EGDA 4OHPA 1EZ1A 1UQUA 3Q0IA 2BISA 3WLNA 4X9XA 3U7GA 4DTCA 3T34A 5DHPA 1YQWA 5LP6C 1SR8A 1YIOA 1JX6A 3UJ8A 2J85A 2DFLA 1PW7A 3M3PA 3V8EA 1IQRA 5KTOA 2FF5A 4D4JA 1VMEA 3T5PA 3G5MA 2DY1A 2WU0A 5CFPA 5LQUA 1B3RA 1ZZGA 1BGWA 1QPBA 3DP7A 5ECWA 1JKJA 5FTLA 3C39A 2OHXA 3LRTA 3KBBA 3NTUA 4MCHA 3JVEA 5ESDA 3VR2D 1MO3A 4F9GA 1CEXA 4Q9HA 3MVEA 5F7OA 4UNQA 2AQIA 2H48A 3PFIA 1BKSB 4TKVA 3NALA 4UDOA 1NQUA 3T52A 4RO0A 1E1NA 2JF0A 5BUQA 1AUOA 2BW0A 3CURA 4J2HA 4BXOB 5B4UA 4EG0A 1GTVA 3LVRE 1JPUA 2YHSA 2H08A 1Z62A 1WZEA 4IWXA 3I04A 3PRYA 3UJ6A 4LJ5A 4N3BA 3I4LA 3OGHA 1Z63A 3W5AA 1FSFA 1HE4A 2DBRA 2CWDA 1J8YF 5B2ZA 1Y8RA 3U3DA 1Z4AA 3C3AA 3VC3A 1DHRA 4F2PA 4MVJP 1R5JA 3ZH2A 4Z7QB 3W77A 5I4BA 1P5JA 3KD3A 4BNZA 4LHZA 4QOFA 2RH4A 3RJ5A 3AUUA 2YCBA 3TTXA 2CNKA 4Y2QA 5F33A 3UT6A 1YQTA 1U7UA 1NR7A 2W6ID 5BWOA 4BJHB 1EDZA 4K8RB 1LBIA 4E2WA 4RW0A 5LVAA 4Q3AA 2LPMA 3I23A 3KKNA 3E22A 1PN3A 2C99A 4KBGA 1C3VA 2CMHA 3MS7A 1Q91A 4KI0A 1U94A 3WLRA 5KJCA 3B53X 4B8ZA 5JDCA 1RC8A 4BBJA 4MINA 2GNPA 2GN1A 3VV3A 1ADFA 4HX9A 3R76A 4RVFA 3QPVA 1GGEA 4JL6A 4WTOA 3IEPA 4BRWA 1QNFA 5GADl 1WEHA 1MHPA 3PNSA 3Q7TA 2D54A 3UJAA 2Z4TA 4F11A 1HR0B 4JJFA 1T5TA 1N2OA 1XCGB 3DYVA 3JQ9A 4NQRA 3SFVA 2F1HA 1R88A 3DCIA 3ET5A 3RGGA 3HJBA 4ZI7F 1J22A 2OYRA 1MH1A 1TUGA 3QXCA 1BCSA 3BOSA 3RU3A 4L1KA 1D2MA 4LHWA 4N6OA 4B82A 2FMKA 2JRCA 2AMJA 3ANLA 1JS1X 3IODA 4GX1A 4MV1A 3WGKA 5JS8A 1KEVA 1MB4A 1NBHA 1XCPA 1DXQA 4RSRA 5K0GA 4M1ZA 4CM8A 1IHUA 1T36B 3HGMA 4AZWA 5BOSB 1V8PA 3BWEA 2C82A 3F3KA 4TXLA 4NBLA 2XKKA 1JAIA 1VSVA 1N3LA 3EG5A 3GHHA 5FL7A 5LXTA 4G1EB 2UXBB 9ATCA 1CEQA 3HKCA 5TLSA 1UJ4A 3R7BA 2YIVX 4LZOA 1G8FA 2IEDA 1H2WA 2UZ0A 3NTQA 3HNPA 3VTAA 1G59A 2IS1A 3N2IA 4MX8A 8MHTA 1UT8A 1GGNA 3UCEA 1L4LA 2AYXA 2JI4A 4UM9D 2C2KA 4C78A 3WNDA 4DUGD 1Y81A 5AJUA 2HK6A 3PUVA 4YDQA 3D4NA 3GUVA 1KEUA 1FNBA 2Q1WA 1I3NA 3LPNA 3TEFA 3IBSA 1PNOA 3D8NA 3AZOA 3PFCA 3F35A 4KFRA 1J0AA 3A28A 2P2NA 3BFXA 4GR5A 3KR0A 5AXAA 1UBTS 3RU2A 4RCZA 5TQJA 3PZAA 5IJWA 4UULA 3OZFA 4RWEA 3TW4A 3CUVA 2RGUA 3CF0A 1VE7A 4DR7B 2OV4A 4MUHA 4D96A 1JFTA 1Z5PA 1T91A 2PS0A 1XRPA 2WUVA 4IWKA 2IQ5A 5C8VA 4EJ2A 2QRGA 1SXJB 1PJ2A 2CFOA 2UUPA 3LLMA 4RQBA 5DHUA 5ECDA 3ZNPA 2DULA 1X38A 3HVUA 3DZ8A 3A4LA 1U1DA 2HXGA 3SZOA 4JFAA 4TKUA 4IIDA 4HK4A 4QWMA 4R16A 1F4LA 5A3SA 3SC2B 5EJ7A 1ZD8A 2C2XA 4JLMA 1YS6A 1P62B 3FX2A 4LF8B 3AHIA 3W06A 2X5OA 4Q9AA 4WCFA 3P1JA 2GAOA 2BZSA 2LDXA 5IYZA 3Q9LA 1BS2A 3F6EX 4BN0A 4ZVMA 5K09A 1V71A 4N7RA 1OC2A 2IYYA 4G0WA 4IZHA 2DM6A 3C98A 1VHLA 5FWYA 1KH3A 1WJGA 3NHSA 1K7CA 4I5FA 1CDDA 1VE6A 3H97A 3P9SA 4G5SA 4Y7DA 5P8WA 3WQSB 2PL5A 4LWZA 1XSEA 3DB1A 4E94A 4MKGA 3WXMA 2NSYA 4TOGA 1KBQA 1UJMA 1XYVA 1KDRA 1NF3A 4Y2XA 1FX0A 1X1AA 2QPLA 4PZ9A 3FR7A 3WA6A 3DH0A 5A9SB 1HL7A 4RPHA 3JQ7A 2QRQA 2R6FA 3WB0A 1KHTA 4NPHA 2PSHA 3AMVA 3G2JA 2Z6VA 5BRAA 3LAWA 3WSVA 4WE3A 4ISCA 3BF7A 3J81A 1A7KA 1QG0A 4BMNA 2HW8A 621PA 1XXHE 4QNMA 3D8RA 1YR9A 3KPJA 4KFUA 4BGDA 1QLJA 4V02A 2X13A 4FYPA 4NAHA 1UBUS 5G4KB 5IN4A 2QN6A 2V2LA 2UUBB 4H7DA 3TWOA 3K9HA 2MCFA 1P5FA 2NUAB 4DLNA 4KFCA 5IC5A 4IO1A 2QBYB 4GYYA 5JXHA 4UHCA 1FQJA 2DJIA 3THOA 1KEEB 2A92A 3FRHA 2HSDA 3ROGA 3ZZNA 1UT5A 3WA7A 2EXXA 1I5OA 3KLOA 2XMDA 3SC4A 1JE1A 4OLJA 3EPRA 3RC7A 1CY6A 3PBKA 4HNAA 1FQWA 4QODA 4CRWB 3WK8A 1NG1A 2JKZA 1WAMA