4IXKA

Anaerobic crystal structure of iron soaked (2 h) ferritin from pseudo-nitzschia multiseries
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
156
structure length
155
Chain Sequence
EELLDLFNRQVTQEFTASQVYLSASIWFDQNDWEGMAAYMLAESAEEREHGLGFVDFANKRNIPIELQAVPAPVSAEWSSPEDVWQSILELEQANTRSLLNLAEAASTCHDFAVMAFLNPFHLQQVNEEDKIGSILAKVTDENRTPGLLRSLDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title Mechanism of ferrous iron binding and oxidation by ferritin from a pennate diatom.
pubmed doi rcsb
source organism Pseudo-nitzschia multiseries
molecule tags Transport protein
total genus 70
structure length 155
sequence length 156
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4ixkA00
2YJKA 4ZL5A 3GHQA 5HQOA 3BT5A 4MJYA 5GOUA 3E6SA 3PVYA 4ZTTA 2CF7A 2G4HA 1ZUJA 1YV1A 2V15A 3EZUA 4ZL6A 2V2PA 1YUXA 2YW7A 4IWKA 3E6RA 1BFRA 4DZ0A 2BK6A 2CHPA 4A25A 3E1LA 4CMYA 4ZMCA 4LQNA 1QYBA 3A68A 4CVRA 3OGHA 3EZ0A 4RC8A 5GU2X 2CEIA 5CZUA 2YJJA 3PW1B 3E1MA 1J30A 2CLBA 3HIUA 1JYBA 4RC5A 4LYUA 4DYUA 2CLUA 3ERZA 4EVDA 5LS9A 3ES3A 5JKLA 3F35A 3AF9X 1IERA 3Q4OA 2Z5QA 5D8QA 1TK6A 2IY4A 3H7GA 3KA3A 4M34A 4ITWA 4EVBA 1JREA 1TKOA 1UVHA 1UMNA 4RC6A 1VEIA 4IXKA 3HL1A 5CMQA 4TOGA 5E2DA 3RD0A 4ZKHA 3IS7A 1LKPA 4ERUA 4REUA 4ML5A 4ZLWA 3VNXA 4EVCA 2IB0A 5ERKA 1VEQA 4TOAA 2GS4A 2RBDA 4M32A 1KRQA 1VJXA 3PVRB 2ZA7A 2FHAA 3R2KA 1RYTA 5J8SA 2UX1A 4AM2A 1NF4A 3RAVA 3QHCA 5FFDA 3Q4RA 3BKNA 5I4JA 4II4A 4YKHA 4Z5SA 2ZA6A 4TOCA 3FVBA 3FI6A 3E1NA 2FG4A 2HTNA 3BVEA 4TOHA 5J93A 3NP2X 3MPSA 1MOJA 3T9JA 3E1QA 1O9RA 3RE7A 3E2CA 1RCCA 4ITTA 4ZJKA 1BG7A 2CN7A 3NP0X 2Z5PA 4IWJA 5D8SA 3IS8A 4CY9A 5FFAA 5LBHA 2C6RA 3PVYB 2GYDA 5JACA 1VLGA 3SIDA 4OYNA 4LPNA 2V2LA 5JKLG 1L8IA 4DASA 1LKOA 2WLAA 4M33A 3QHBA 3PZAA 2IU2A 3Q4NA 1HRSA 1NFVA 3FSEA 2FL0A 2ZA8A 3KA6A 1FHAA 2V2OA 3PVTA 4TOEA 1JKUA 1OTKA 4CMYV 5ERJA 4RC5B 2WTLA 3NOZX 3F36A 5AXSA 4AM5A 1SOFA 3R2LA 4QUWA 4LPMA 1BCFA 1R03A 2VXIA 1IESA 3PW1A 2ZG8X 3KWOA 4CYAA 5K53A 2Y3QA 3F38A 5D8XA 4KVRA 2Z6MA 4RC6B 1YUZA 4P18A 4U3GA 2V2NA 4LQHA 2PYBA 5HJHA 2BKCA 3WNWA 5C6FA 3AJOA 2C2UA 4ZKWA 5K52A 4XKUA 4R42A 2V2JA 3R2MA 3GE4A 1MFRA 5LG2A 1O9IA 2QF9A 3O7SA 4MN9A 5D8PA 2BW1A 4PGIA 5D8OA 3RGDA 2C2FA 4M35A 3UNOA 3KA9A 3AJPA 2ITBA 5HJFA 3R2HA 2ZG9X 1ZS3A 3PW8A 5GU3X 3PVRA 4II4B 3AF7X 2OH3A 1TJOA 3KA4A 3F33A 4ISPA 1H96A 3R2SA 4Y08A 3E1OA 1JI4A 3F32A 1QGHA 3AJQA 3SH6A 1NNQA 5GN8A 3WVUA 1XZ3A 2JD80 1DPSA 1EUMA 4RC7A 3TA8A 4MY7A 1L8HA 4DYXA 2V2IA 4XKSA 3AK8A 1LKMA 3IQ1A 2CHIA 1S30A 3WVVA 3KXUA 4LQJA 2XJOA 4MUDA 2OC5A 4PG1A 1F30A 4XGSA 4DE6A 1F33A 3KX9A 4LQVA 3GVYA 3BVFA 4CYBA 1RCGA 4CVSA 3AK9A 3EGMA 4TODA 4ISMA 2WLUA 2CN6A 1Z6OM 2JD70 3PWQC 3BVIA 5CMRA 4PG0A 3R2RA 1Z6OA 3R2OA 3UOFA 2F7NA 2CIHA 2Z90A 3ISEA 3PVTB 5GU1X 3A9QA 4CVTA 1TKPA 3BVKA 5J8WA 3KA8A 3BVLA 1JTSA 5J9VA 5FFEA 1SQ3A 2W0OA 2C2JA 2Z5RA 4KVSA 4Z3BA 1RCDA 3F34A 3PWQA 3QZ3A 1N1QA 2ZURX 2V2MA 1JGCA 1B71A 2D5KA 1DATA 3Q4QA 3ISFA 5GU0X 3QB9A 3U90A 3PW8C 5FFBA 3RBCA 2ZG7X 2VXXA 2FJCA 3F39A 3E1PA 2X170 5FFCA 2FFXJ 3SHXA 1S2ZA 4EVEA 4CVPA 4DYZA 4TOFA 3OJ5A 2XJNA 4TOBA 3WVWA 4LYXA 1LB3A 5FEJA 2XKQA 5JKMG 4TO9A 4ETRA 1VELA 5LG8A 3QVDA 1XZ1A 4TW3A 5E1UA 4E6KA 1RCEA 3E1JA 2XGWA 4DYYA 5D8RA 2QQYA 3UOIA 2HR5A 2JD60 2V2RA 1JIGA 2V2SA 2VZBA 4KVQA 1DVBA 4MKUA 1JKVA 1RCIA 3F37A 2FG8A 5JKMA 1JI5A 2FZFA 3PWFA 2FKZA 5IX6A 5GN8B 4XKTA 3SE1A 4ZKXA 4LPJA 1AEWA 1GWGA 4DI0A 4RC7B 4PGKA 2C41A 2BJYA 2YW6A 2GYQA 4AM4A 1NF6A 1Z4AA 2XJMA 3AF8X 3QD8A 1S3QA 5D8YA 3O7RA
chains in the Genus database with same CATH superfamily
2YJKA 4ZL5A 3GHQA 5HQOA 3BT5A 4MJYA 5GOUA 3E6SA 3PVYA 4ZTTA 2CF7A 2G4HA 1ZUJA 5JDOA 1YV1A 2V15A 3EZUA 4ZL6A 2V2PA 1YUXA 2YW7A 4IWKA 3E6RA 1BFRA 4W4KB 4DZ0A 2BK6A 2CHPA 4A25A 3E1LA 4CMYA 4ZMCA 3M6JA 4LQNA 1QYBA 3A68A 4CVRA 3KDQA 3OGHA 3EZ0A 4RC8A 5GU2X 2CEIA 5CZUA 2YJJA 3PW1B 3E1MA 1J30A 2CLBA 3C1YA 3HIUA 1JYBA 4RC5A 4LYUA 4DYUA 2CLUA 3ERZA 4EVDA 5LS9A 3L0MA 3ES3A 5JKLA 3F35A 3JZ9A 3AF9X 1IERA 3Q4OA 2Z5QA 5D8QA 1TK6A 2IY4A 3H7GA 3KA3A 4M34A 4ITWA 4EVBA 1JREA 1TKOA 1UVHA 1UMNA 4RC6A 1VEIA 2WWXB 4IXKA 3HL1A 3KHKA 5CMQA 4YVZA 4TOGA 5E2DA 3RD0A 4ZKHA 3IS7A 1LKPA 3FRSA 4ERUA 4REUA 4ML5A 4ZLWA 3VNXA 4EVCA 2IB0A 5ERKA 1VEQA 3GGYA 4TOAA 3C23A 2GS4A 2RBDA 4M32A 1KRQA 1VJXA 3PVRB 5HU6D 2ZA7A 2FHAA 3R2KA 1RYTA 5J8SA 2UX1A 4AM2A 1NF4A 3RAVA 4YXMA 3QHCA 5FFDA 3Q4RA 2G38B 3BKNA 5I4JA 4II4A 4YKHA 4Z5SA 2V8TA 2ZA6A 4TOCA 3FVBA 3FI6A 2N02A 3E1NA 2FG4A 2HTNA 3C1ZA 3BVEA 4TOHA 3W54A 5J93A 3NP2X 3MPSA 3VVAA 1MOJA 3T9JA 2AR0A 3E1QA 1O9RA 3RE7A 3E2CA 1RCCA 4ITTA 3N6OA 4ZJKA 2OKCA 1BG7A 2CN7A 3JZAB 3NP0X 2Z5PA 4IWJA 5D8SA 3IS8A 4CY9A 5FFAA 5LBHA 2C6RA 3PVYB 2GYDA 5JACA 1VLGA 3LKDA 3SIDA 4OYNA 3VV9A 4LPNA 2V2LA 5JKLG 1L8IA 4DASA 1LKOA 2WLAA 3QHBA 4M33A 3PZAA 2IU2A 3Q4NA 1HRSA 1NFVA 3FSEA 2FL0A 2ZA8A 3KA6A 1FHAA 2V2OA 3PVTA 4TOEA 1JKUA 1OTKA 4CMYV 5ERJA 4RC5B 2WTLA 3NOZX 3F36A 5AXSA 4AM5A 1SOFA 3R2LA 3UFBA 4QUWA 4LPMA 1BCFA 1R03A 2VXIA 1IESA 3PW1A 2ZG8X 3KWOA 4CYAA 5K53A 2Y3QA 3F38A 5D8XA 4KVRA 2Z6MA 4RC6B 3C21A 1YUZA 4P18A 4U3GA 2V2NA 4LQHA 2PYBA 5HJHA 2BKCA 3WNWA 5C6FA 2MGYA 3AJOA 2C2UA 4ZKWA 5K52A 4XKUA 4R42A 2V2JA 3R2MA 3GE4A 1MFRA 5LG2A 1O9IA 2QF9A 3O7SA 4MN9A 5D8PA 2BW1A 4PGIA 5D8OA 3RGDA 2C2FA 4M35A 3UNOA 3KA9A 3AJPA 2ITBA 5HJFA 3R2HA 2ZG9X 1ZS3A 3PW8A 5GU3X 3PVRA 4II4B 3AF7X 2OH3A 1TJOA 3KA4A 3F33A 4ISPA 1H96A 3R2SA 4Y08A 3E1OA 1JI4A 3F32A 1QGHA 3AJQA 3SH6A 2V8UA 1NNQA 5GN8A 3WVUA 1XZ3A 2JD80 1DPSA 1EUMA 4RC7A 3TA8A 4WJG4 4MY7A 1L8HA 4DYXA 2V2IA 4XKSA 3AK8A 1LKMA 3IQ1A 2CHIA 1S30A 3WVVA 3KXUA 4LQJA 2XJOA 4MUDA 2OC5A 4PG1A 5JDOB 1F30A 4XGSA 4DE6A 1F33A 3KX9A 4LQVA 3GVYA 3BVFA 3DBYA 4CYBA 1RCGA 4CVSA 3AK9A 3EGMA 4TODA 4ISMA 2WLUA 2CN6A 1Z6OM 2JD70 3PWQC 3BVIA 5CMRA 4PG0A 3R2RA 1Z6OA 3R2OA 3UOFA 2F7NA 2CIHA 2Z90A 3ISEA 3PVTB 4X0JA 5GU1X 4E40A 3A9QA 4CVTA 1TKPA 3BVKA 5J8WA 3KA8A 3BVLA 1JTSA 5J9VA 5FFEA 3D19A 1SQ3A 2CWLA 2W0OA 2C2JA 2Z5RA 4KVSA 4Z3BA 1RCDA 3F34A 3PWQA 3QZ3A 3V3KB 1N1QA 2ZURX 2V2MA 1JGCA 1B71A 2D5KA 1DATA 3Q4QA 3ISFA 5GU0X 3QB9A 3U90A 3PW8C 5FFBA 3RBCA 2ZG7X 2VXXA 2FJCA 3F39A 3E1PA 2X170 5FFCA 4MXPA 2FFXJ 3SHXA 1S2ZA 4EVEA 4CVPA 4DYZA 4TOFA 3FRRA 3OJ5A 2XJNA 4TOBA 3WVWA 4LYXA 1LB3A 5FEJA 4YXJA 2XKQA 5JKMG 4TO9A 4ETRA 1VELA 5LG8A 3QVDA 1XZ1A 4KXRB 4TW3A 5E1UA 4E6KA 1RCEA 3E1JA 2XGWA 4DYYA 5D8RA 2QQYA 3UOIA 2HR5A 2JD60 2V2RA 1JIGA 2V2SA 2VZBA 4KVQA 1DVBA 4MKUA 1JKVA 1RCIA 3F37A 2FG8A 5JKMA 1JI5A 2FZFA 3PWFA 2FKZA 3GGZA 5IX6A 5GN8B 4XKTA 3SE1A 4ZKXA 4LPJA 2Y44A 4W4LB 1AEWA 1GWGA 4DI0A 4RC7B 4PGKA 2C41A 2BJYA 2YW6A 2GYQA 4AM4A 1NF6A 1Z4AA 2XJMA 3AF8X 3QD8A 1S3QA 5D8YA 3O7RA
chains in the Genus database with same CATH topology
2YJKA 4ZL5A 3GHQA 5HQOA 3BT5A 4MJYA 5GOUA 3E6SA 3PVYA 4ZTTA 2CF7A 2G4HA 1ZUJA 5JDOA 1YV1A 2V15A 3EZUA 4ZL6A 2V2PA 1YUXA 2YW7A 4IWKA 3E6RA 1BFRA 4W4KB 4DZ0A 2BK6A 2CHPA 4A25A 3E1LA 4CMYA 4ZMCA 3M6JA 4LQNA 1QYBA 3A68A 4CVRA 3KDQA 3OGHA 3EZ0A 4RC8A 5GU2X 2CEIA 5CZUA 2YJJA 3PW1B 3E1MA 1J30A 2CLBA 3C1YA 3HIUA 1JYBA 4RC5A 4LYUA 4DYUA 2CLUA 3ERZA 4EVDA 5LS9A 3L0MA 3ES3A 5JKLA 3F35A 3JZ9A 3AF9X 1IERA 3Q4OA 2Z5QA 5D8QA 1TK6A 2IY4A 3H7GA 3KA3A 4M34A 4ITWA 4EVBA 1JREA 1TKOA 1UVHA 1UMNA 4RC6A 1VEIA 2WWXB 4IXKA 3HL1A 3KHKA 5CMQA 4YVZA 4TOGA 5E2DA 3RD0A 4ZKHA 3IS7A 1LKPA 3FRSA 4ERUA 4REUA 4ML5A 4ZLWA 3VNXA 4EVCA 2IB0A 5ERKA 1VEQA 3GGYA 4TOAA 3C23A 2GS4A 2RBDA 4M32A 1KRQA 1VJXA 3PVRB 5HU6D 2ZA7A 2FHAA 3R2KA 1RYTA 5J8SA 2UX1A 4AM2A 1NF4A 3RAVA 4YXMA 3QHCA 5FFDA 3Q4RA 2G38B 3BKNA 5I4JA 4II4A 4YKHA 4Z5SA 2V8TA 2ZA6A 4TOCA 3FVBA 3FI6A 2N02A 3E1NA 2FG4A 2HTNA 3C1ZA 3BVEA 4TOHA 3W54A 5J93A 3NP2X 3MPSA 3VVAA 1MOJA 3T9JA 2AR0A 3E1QA 1O9RA 3RE7A 3E2CA 1RCCA 4ITTA 3N6OA 4ZJKA 2OKCA 1BG7A 2CN7A 3JZAB 3NP0X 2Z5PA 4IWJA 5D8SA 3IS8A 4CY9A 5FFAA 5LBHA 2C6RA 3PVYB 2GYDA 5JACA 1VLGA 3LKDA 3SIDA 4OYNA 3VV9A 4LPNA 2V2LA 5JKLG 1L8IA 4DASA 1LKOA 2WLAA 3QHBA 4M33A 3PZAA 2IU2A 3Q4NA 1HRSA 1NFVA 3FSEA 2FL0A 2ZA8A 3KA6A 1FHAA 2V2OA 3PVTA 4TOEA 1JKUA 1OTKA 4CMYV 5ERJA 4RC5B 2WTLA 3NOZX 3F36A 5AXSA 4AM5A 1SOFA 3R2LA 3UFBA 4QUWA 4LPMA 1BCFA 1R03A 2VXIA 1IESA 3PW1A 2ZG8X 3KWOA 4CYAA 5K53A 2Y3QA 3F38A 5D8XA 4KVRA 2Z6MA 4RC6B 3C21A 1YUZA 4P18A 4U3GA 2V2NA 4LQHA 2PYBA 5HJHA 2BKCA 3WNWA 5C6FA 2MGYA 3AJOA 2C2UA 4ZKWA 5K52A 4XKUA 4R42A 2V2JA 3R2MA 3GE4A 1MFRA 5LG2A 1O9IA 2QF9A 3O7SA 4MN9A 5D8PA 2BW1A 4PGIA 5D8OA 3RGDA 2C2FA 4M35A 3UNOA 3KA9A 3AJPA 2ITBA 5HJFA 3R2HA 2ZG9X 1ZS3A 3PW8A 5GU3X 3PVRA 4II4B 3AF7X 2OH3A 1TJOA 3KA4A 3F33A 4ISPA 1H96A 3R2SA 4Y08A 3E1OA 1JI4A 3F32A 1QGHA 3AJQA 3SH6A 2V8UA 1NNQA 5GN8A 3WVUA 1XZ3A 2JD80 1DPSA 1EUMA 4RC7A 3TA8A 4WJG4 4MY7A 1L8HA 4DYXA 2V2IA 4XKSA 3AK8A 1LKMA 3IQ1A 2CHIA 1S30A 3WVVA 3KXUA 4LQJA 2XJOA 4MUDA 2OC5A 4PG1A 5JDOB 1F30A 4XGSA 4DE6A 1F33A 3KX9A 4LQVA 3GVYA 3BVFA 3DBYA 4CYBA 1RCGA 4CVSA 3AK9A 3EGMA 4TODA 4ISMA 2WLUA 2CN6A 1Z6OM 2JD70 3PWQC 3BVIA 5CMRA 4PG0A 3R2RA 1Z6OA 3R2OA 3UOFA 2F7NA 2CIHA 2Z90A 3ISEA 3PVTB 4X0JA 5GU1X 4E40A 3A9QA 4CVTA 1TKPA 3BVKA 5J8WA 3KA8A 3BVLA 1JTSA 5J9VA 5FFEA 3D19A 1SQ3A 2CWLA 2W0OA 2C2JA 2Z5RA 4KVSA 4Z3BA 1RCDA 3F34A 3PWQA 3QZ3A 3V3KB 1N1QA 2ZURX 2V2MA 1JGCA 1B71A 2D5KA 1DATA 3Q4QA 3ISFA 5GU0X 3QB9A 3U90A 3PW8C 5FFBA 3RBCA 2ZG7X 2VXXA 2FJCA 3F39A 3E1PA 2X170 5FFCA 4MXPA 2FFXJ 3SHXA 1S2ZA 4EVEA 4CVPA 4DYZA 4TOFA 3FRRA 3OJ5A 2XJNA 4TOBA 3WVWA 4LYXA 1LB3A 5FEJA 4YXJA 2XKQA 5JKMG 4TO9A 4ETRA 1VELA 5LG8A 3QVDA 1XZ1A 4KXRB 4TW3A 5E1UA 4E6KA 1RCEA 3E1JA 2XGWA 4DYYA 5D8RA 2QQYA 3UOIA 2HR5A 2JD60 2V2RA 1JIGA 2V2SA 2VZBA 4KVQA 1DVBA 4MKUA 1JKVA 1RCIA 3F37A 2FG8A 5JKMA 1JI5A 2FZFA 3PWFA 2FKZA 3GGZA 5IX6A 5GN8B 4XKTA 3SE1A 4ZKXA 4LPJA 2Y44A 4W4LB 1AEWA 1GWGA 4DI0A 4RC7B 4PGKA 2C41A 2BJYA 2YW6A 2GYQA 4AM4A 1NF6A 1Z4AA 2XJMA 3AF8X 3QD8A 1S3QA 5D8YA 3O7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJK A;  4ZL5 A;  3GHQ A;  5HQO A;  3BT5 A;  4MJY A;  5GOU A;  3E6S A;  3PVY A;  4ZTT A;  2CF7 A;  2G4H A;  1ZUJ A;  1YV1 A;  2V15 A;  3EZU A;  4ZL6 A;  2V2P A;  1YUX A;  2YW7 A;  4IWK A;  3E6R A;  1BFR A;  4DZ0 A;  2BK6 A;  2CHP A;  4A25 A;  3E1L A;  4CMY A;  4ZMC A;  4LQN A;  1QYB A;  3A68 A;  4CVR A;  3OGH A;  3EZ0 A;  4RC8 A;  5GU2 X;  2CEI A;  5CZU A;  2YJJ A;  3PW1 B;  3E1M A;  1J30 A;  2CLB A;  3HIU A;  1JYB A;  4RC5 A;  4LYU A;  4DYU A;  2CLU A;  3ERZ A;  4EVD A;  5LS9 A;  3ES3 A;  5JKL A;  3F35 A;  3AF9 X;  1IER A;  3Q4O A;  2Z5Q A;  5D8Q A;  1TK6 A;  2IY4 A;  3H7G A;  3KA3 A;  4M34 A;  4ITW A;  4EVB A;  1JRE A;  1TKO A;  1UVH A;  1UMN A;  4RC6 A;  1VEI A;  4IXK A;  3HL1 A;  5CMQ A;  4TOG A;  5E2D A;  3RD0 A;  4ZKH A;  3IS7 A;  1LKP A;  4ERU A;  4REU A;  4ML5 A;  4ZLW A;  3VNX A;  4EVC A;  2IB0 A;  5ERK A;  1VEQ A;  4TOA A;  2GS4 A;  2RBD A;  4M32 A;  1KRQ A;  1VJX A;  3PVR B;  2ZA7 A;  2FHA A;  3R2K A;  1RYT A;  5J8S A;  2UX1 A;  4AM2 A;  1NF4 A;  3RAV A;  3QHC A;  5FFD A;  3Q4R A;  3BKN A;  5I4J A;  4II4 A;  4YKH A;  4Z5S A;  2ZA6 A;  4TOC A;  3FVB A;  3FI6 A;  3E1N A;  2FG4 A;  2HTN A;  3BVE A;  4TOH A;  5J93 A;  3NP2 X;  3MPS A;  1MOJ A;  3T9J A;  3E1Q A;  1O9R A;  3RE7 A;  3E2C A;  1RCC A;  4ITT A;  4ZJK A;  1BG7 A;  2CN7 A;  3NP0 X;  2Z5P A;  4IWJ A;  5D8S A;  3IS8 A;  4CY9 A;  5FFA A;  5LBH A;  2C6R A;  3PVY B;  2GYD A;  5JAC A;  1VLG A;  3SID A;  4OYN A;  4LPN A;  2V2L A;  5JKL G;  1L8I A;  4DAS A;  1LKO A;  2WLA A;  4M33 A;  3QHB A;  3PZA A;  2IU2 A;  3Q4N A;  1HRS A;  1NFV A;  3FSE A;  2FL0 A;  2ZA8 A;  3KA6 A;  1FHA A;  2V2O A;  3PVT A;  4TOE A;  1JKU A;  1OTK A;  4CMY V;  5ERJ A;  4RC5 B;  2WTL A;  3NOZ X;  3F36 A;  5AXS A;  4AM5 A;  1SOF A;  3R2L A;  4QUW A;  4LPM A;  1BCF A;  1R03 A;  2VXI A;  1IES A;  3PW1 A;  2ZG8 X;  3KWO A;  4CYA A;  5K53 A;  2Y3Q A;  3F38 A;  5D8X A;  4KVR A;  2Z6M A;  4RC6 B;  1YUZ A;  4P18 A;  4U3G A;  2V2N A;  4LQH A;  2PYB A;  5HJH A;  2BKC A;  3WNW A;  5C6F A;  3AJO A;  2C2U A;  4ZKW A;  5K52 A;  4XKU A;  4R42 A;  2V2J A;  3R2M A;  3GE4 A;  1MFR A;  5LG2 A;  1O9I A;  2QF9 A;  3O7S A;  4MN9 A;  5D8P A;  2BW1 A;  4PGI A;  5D8O A;  3RGD A;  2C2F A;  4M35 A;  3UNO A;  3KA9 A;  3AJP A;  2ITB A;  5HJF A;  3R2H A;  2ZG9 X;  1ZS3 A;  3PW8 A;  5GU3 X;  3PVR A;  4II4 B;  3AF7 X;  2OH3 A;  1TJO A;  3KA4 A;  3F33 A;  4ISP A;  1H96 A;  3R2S A;  4Y08 A;  3E1O A;  1JI4 A;  3F32 A;  1QGH A;  3AJQ A;  3SH6 A;  1NNQ A;  5GN8 A;  3WVU A;  1XZ3 A;  2JD8 0;  1DPS A;  1EUM A;  4RC7 A;  3TA8 A;  4MY7 A;  1L8H A;  4DYX A;  2V2I A;  4XKS A;  3AK8 A;  1LKM A;  3IQ1 A;  2CHI A;  1S30 A;  3WVV A;  3KXU A;  4LQJ A;  2XJO A;  4MUD A;  2OC5 A;  4PG1 A;  1F30 A;  4XGS A;  4DE6 A;  1F33 A;  3KX9 A;  4LQV A;  3GVY A;  3BVF A;  4CYB A;  1RCG A;  4CVS A;  3AK9 A;  3EGM A;  4TOD A;  4ISM A;  2WLU A;  2CN6 A;  1Z6O M;  2JD7 0;  3PWQ C;  3BVI A;  5CMR A;  4PG0 A;  3R2R A;  1Z6O A;  3R2O A;  3UOF A;  2F7N A;  2CIH A;  2Z90 A;  3ISE A;  3PVT B;  5GU1 X;  3A9Q A;  4CVT A;  1TKP A;  3BVK A;  5J8W A;  3KA8 A;  3BVL A;  1JTS A;  5J9V A;  5FFE A;  1SQ3 A;  2W0O A;  2C2J A;  2Z5R A;  4KVS A;  4Z3B A;  1RCD A;  3F34 A;  3PWQ A;  3QZ3 A;  1N1Q A;  2ZUR X;  2V2M A;  1JGC A;  1B71 A;  2D5K A;  1DAT A;  3Q4Q A;  3ISF A;  5GU0 X;  3QB9 A;  3U90 A;  3PW8 C;  5FFB A;  3RBC A;  2ZG7 X;  2VXX A;  2FJC A;  3F39 A;  3E1P A;  2X17 0;  5FFC A;  2FFX J;  3SHX A;  1S2Z A;  4EVE A;  4CVP A;  4DYZ A;  4TOF A;  3OJ5 A;  2XJN A;  4TOB A;  3WVW A;  4LYX A;  1LB3 A;  5FEJ A;  2XKQ A;  5JKM G;  4TO9 A;  4ETR A;  1VEL A;  5LG8 A;  3QVD A;  1XZ1 A;  4TW3 A;  5E1U A;  4E6K A;  1RCE A;  3E1J A;  2XGW A;  4DYY A;  5D8R A;  2QQY A;  3UOI A;  2HR5 A;  2JD6 0;  2V2R A;  1JIG A;  2V2S A;  2VZB A;  4KVQ A;  1DVB A;  4MKU A;  1JKV A;  1RCI A;  3F37 A;  2FG8 A;  5JKM A;  1JI5 A;  2FZF A;  3PWF A;  2FKZ A;  5IX6 A;  5GN8 B;  4XKT A;  3SE1 A;  4ZKX A;  4LPJ A;  1AEW A;  1GWG A;  4DI0 A;  4RC7 B;  4PGK A;  2C41 A;  2BJY A;  2YW6 A;  2GYQ A;  4AM4 A;  1NF6 A;  1Z4A A;  2XJM A;  3AF8 X;  3QD8 A;  1S3Q A;  5D8Y A;  3O7R A; 
#chains in the Genus database with same CATH topology
 2YJK A;  4ZL5 A;  3GHQ A;  5HQO A;  3BT5 A;  4MJY A;  5GOU A;  3E6S A;  3PVY A;  4ZTT A;  2CF7 A;  2G4H A;  1ZUJ A;  5JDO A;  1YV1 A;  2V15 A;  3EZU A;  4ZL6 A;  2V2P A;  1YUX A;  2YW7 A;  4IWK A;  3E6R A;  1BFR A;  4W4K B;  4DZ0 A;  2BK6 A;  2CHP A;  4A25 A;  3E1L A;  4CMY A;  4ZMC A;  3M6J A;  4LQN A;  1QYB A;  3A68 A;  4CVR A;  3KDQ A;  3OGH A;  3EZ0 A;  4RC8 A;  5GU2 X;  2CEI A;  5CZU A;  2YJJ A;  3PW1 B;  3E1M A;  1J30 A;  2CLB A;  3C1Y A;  3HIU A;  1JYB A;  4RC5 A;  4LYU A;  4DYU A;  2CLU A;  3ERZ A;  4EVD A;  5LS9 A;  3L0M A;  3ES3 A;  5JKL A;  3F35 A;  3JZ9 A;  3AF9 X;  1IER A;  3Q4O A;  2Z5Q A;  5D8Q A;  1TK6 A;  2IY4 A;  3H7G A;  3KA3 A;  4M34 A;  4ITW A;  4EVB A;  1JRE A;  1TKO A;  1UVH A;  1UMN A;  4RC6 A;  1VEI A;  2WWX B;  4IXK A;  3HL1 A;  3KHK A;  5CMQ A;  4YVZ A;  4TOG A;  5E2D A;  3RD0 A;  4ZKH A;  3IS7 A;  1LKP A;  3FRS A;  4ERU A;  4REU A;  4ML5 A;  4ZLW A;  3VNX A;  4EVC A;  2IB0 A;  5ERK A;  1VEQ A;  3GGY A;  4TOA A;  3C23 A;  2GS4 A;  2RBD A;  4M32 A;  1KRQ A;  1VJX A;  3PVR B;  5HU6 D;  2ZA7 A;  2FHA A;  3R2K A;  1RYT A;  5J8S A;  2UX1 A;  4AM2 A;  1NF4 A;  3RAV A;  4YXM A;  3QHC A;  5FFD A;  3Q4R A;  2G38 B;  3BKN A;  5I4J A;  4II4 A;  4YKH A;  4Z5S A;  2V8T A;  2ZA6 A;  4TOC A;  3FVB A;  3FI6 A;  2N02 A;  3E1N A;  2FG4 A;  2HTN A;  3C1Z A;  3BVE A;  4TOH A;  3W54 A;  5J93 A;  3NP2 X;  3MPS A;  3VVA A;  1MOJ A;  3T9J A;  2AR0 A;  3E1Q A;  1O9R A;  3RE7 A;  3E2C A;  1RCC A;  4ITT A;  3N6O A;  4ZJK A;  2OKC A;  1BG7 A;  2CN7 A;  3JZA B;  3NP0 X;  2Z5P A;  4IWJ A;  5D8S A;  3IS8 A;  4CY9 A;  5FFA A;  5LBH A;  2C6R A;  3PVY B;  2GYD A;  5JAC A;  1VLG A;  3LKD A;  3SID A;  4OYN A;  3VV9 A;  4LPN A;  2V2L A;  5JKL G;  1L8I A;  4DAS A;  1LKO A;  2WLA A;  3QHB A;  4M33 A;  3PZA A;  2IU2 A;  3Q4N A;  1HRS A;  1NFV A;  3FSE A;  2FL0 A;  2ZA8 A;  3KA6 A;  1FHA A;  2V2O A;  3PVT A;  4TOE A;  1JKU A;  1OTK A;  4CMY V;  5ERJ A;  4RC5 B;  2WTL A;  3NOZ X;  3F36 A;  5AXS A;  4AM5 A;  1SOF A;  3R2L A;  3UFB A;  4QUW A;  4LPM A;  1BCF A;  1R03 A;  2VXI A;  1IES A;  3PW1 A;  2ZG8 X;  3KWO A;  4CYA A;  5K53 A;  2Y3Q A;  3F38 A;  5D8X A;  4KVR A;  2Z6M A;  4RC6 B;  3C21 A;  1YUZ A;  4P18 A;  4U3G A;  2V2N A;  4LQH A;  2PYB A;  5HJH A;  2BKC A;  3WNW A;  5C6F A;  2MGY A;  3AJO A;  2C2U A;  4ZKW A;  5K52 A;  4XKU A;  4R42 A;  2V2J A;  3R2M A;  3GE4 A;  1MFR A;  5LG2 A;  1O9I A;  2QF9 A;  3O7S A;  4MN9 A;  5D8P A;  2BW1 A;  4PGI A;  5D8O A;  3RGD A;  2C2F A;  4M35 A;  3UNO A;  3KA9 A;  3AJP A;  2ITB A;  5HJF A;  3R2H A;  2ZG9 X;  1ZS3 A;  3PW8 A;  5GU3 X;  3PVR A;  4II4 B;  3AF7 X;  2OH3 A;  1TJO A;  3KA4 A;  3F33 A;  4ISP A;  1H96 A;  3R2S A;  4Y08 A;  3E1O A;  1JI4 A;  3F32 A;  1QGH A;  3AJQ A;  3SH6 A;  2V8U A;  1NNQ A;  5GN8 A;  3WVU A;  1XZ3 A;  2JD8 0;  1DPS A;  1EUM A;  4RC7 A;  3TA8 A;  4WJG 4;  4MY7 A;  1L8H A;  4DYX A;  2V2I A;  4XKS A;  3AK8 A;  1LKM A;  3IQ1 A;  2CHI A;  1S30 A;  3WVV A;  3KXU A;  4LQJ A;  2XJO A;  4MUD A;  2OC5 A;  4PG1 A;  5JDO B;  1F30 A;  4XGS A;  4DE6 A;  1F33 A;  3KX9 A;  4LQV A;  3GVY A;  3BVF A;  3DBY A;  4CYB A;  1RCG A;  4CVS A;  3AK9 A;  3EGM A;  4TOD A;  4ISM A;  2WLU A;  2CN6 A;  1Z6O M;  2JD7 0;  3PWQ C;  3BVI A;  5CMR A;  4PG0 A;  3R2R A;  1Z6O A;  3R2O A;  3UOF A;  2F7N A;  2CIH A;  2Z90 A;  3ISE A;  3PVT B;  4X0J A;  5GU1 X;  4E40 A;  3A9Q A;  4CVT A;  1TKP A;  3BVK A;  5J8W A;  3KA8 A;  3BVL A;  1JTS A;  5J9V A;  5FFE A;  3D19 A;  1SQ3 A;  2CWL A;  2W0O A;  2C2J A;  2Z5R A;  4KVS A;  4Z3B A;  1RCD A;  3F34 A;  3PWQ A;  3QZ3 A;  3V3K B;  1N1Q A;  2ZUR X;  2V2M A;  1JGC A;  1B71 A;  2D5K A;  1DAT A;  3Q4Q A;  3ISF A;  5GU0 X;  3QB9 A;  3U90 A;  3PW8 C;  5FFB A;  3RBC A;  2ZG7 X;  2VXX A;  2FJC A;  3F39 A;  3E1P A;  2X17 0;  5FFC A;  4MXP A;  2FFX J;  3SHX A;  1S2Z A;  4EVE A;  4CVP A;  4DYZ A;  4TOF A;  3FRR A;  3OJ5 A;  2XJN A;  4TOB A;  3WVW A;  4LYX A;  1LB3 A;  5FEJ A;  4YXJ A;  2XKQ A;  5JKM G;  4TO9 A;  4ETR A;  1VEL A;  5LG8 A;  3QVD A;  1XZ1 A;  4KXR B;  4TW3 A;  5E1U A;  4E6K A;  1RCE A;  3E1J A;  2XGW A;  4DYY A;  5D8R A;  2QQY A;  3UOI A;  2HR5 A;  2JD6 0;  2V2R A;  1JIG A;  2V2S A;  2VZB A;  4KVQ A;  1DVB A;  4MKU A;  1JKV A;  1RCI A;  3F37 A;  2FG8 A;  5JKM A;  1JI5 A;  2FZF A;  3PWF A;  2FKZ A;  3GGZ A;  5IX6 A;  5GN8 B;  4XKT A;  3SE1 A;  4ZKX A;  4LPJ A;  2Y44 A;  4W4L B;  1AEW A;  1GWG A;  4DI0 A;  4RC7 B;  4PGK A;  2C41 A;  2BJY A;  2YW6 A;  2GYQ A;  4AM4 A;  1NF6 A;  1Z4A A;  2XJM A;  3AF8 X;  3QD8 A;  1S3Q A;  5D8Y A;  3O7R A; 
#chains in the Genus database with same CATH homology
 2YJK A;  4ZL5 A;  3GHQ A;  5HQO A;  3BT5 A;  4MJY A;  5GOU A;  3E6S A;  3PVY A;  4ZTT A;  2CF7 A;  2G4H A;  1ZUJ A;  5JDO A;  1YV1 A;  2V15 A;  3EZU A;  4ZL6 A;  2V2P A;  1YUX A;  2YW7 A;  4IWK A;  3E6R A;  1BFR A;  4W4K B;  4DZ0 A;  2BK6 A;  2CHP A;  4A25 A;  3E1L A;  4CMY A;  4ZMC A;  3M6J A;  4LQN A;  1QYB A;  3A68 A;  4CVR A;  3KDQ A;  3OGH A;  3EZ0 A;  4RC8 A;  5GU2 X;  2CEI A;  5CZU A;  2YJJ A;  3PW1 B;  3E1M A;  1J30 A;  2CLB A;  3C1Y A;  3HIU A;  1JYB A;  4RC5 A;  4LYU A;  4DYU A;  2CLU A;  3ERZ A;  4EVD A;  5LS9 A;  3L0M A;  3ES3 A;  5JKL A;  3F35 A;  3JZ9 A;  3AF9 X;  1IER A;  3Q4O A;  2Z5Q A;  5D8Q A;  1TK6 A;  2IY4 A;  3H7G A;  3KA3 A;  4M34 A;  4ITW A;  4EVB A;  1JRE A;  1TKO A;  1UVH A;  1UMN A;  4RC6 A;  1VEI A;  2WWX B;  4IXK A;  3HL1 A;  3KHK A;  5CMQ A;  4YVZ A;  4TOG A;  5E2D A;  3RD0 A;  4ZKH A;  3IS7 A;  1LKP A;  3FRS A;  4ERU A;  4REU A;  4ML5 A;  4ZLW A;  3VNX A;  4EVC A;  2IB0 A;  5ERK A;  1VEQ A;  3GGY A;  4TOA A;  3C23 A;  2GS4 A;  2RBD A;  4M32 A;  1KRQ A;  1VJX A;  3PVR B;  5HU6 D;  2ZA7 A;  2FHA A;  3R2K A;  1RYT A;  5J8S A;  2UX1 A;  4AM2 A;  1NF4 A;  3RAV A;  4YXM A;  3QHC A;  5FFD A;  3Q4R A;  2G38 B;  3BKN A;  5I4J A;  4II4 A;  4YKH A;  4Z5S A;  2V8T A;  2ZA6 A;  4TOC A;  3FVB A;  3FI6 A;  2N02 A;  3E1N A;  2FG4 A;  2HTN A;  3C1Z A;  3BVE A;  4TOH A;  3W54 A;  5J93 A;  3NP2 X;  3MPS A;  3VVA A;  1MOJ A;  3T9J A;  2AR0 A;  3E1Q A;  1O9R A;  3RE7 A;  3E2C A;  1RCC A;  4ITT A;  3N6O A;  4ZJK A;  2OKC A;  1BG7 A;  2CN7 A;  3JZA B;  3NP0 X;  2Z5P A;  4IWJ A;  5D8S A;  3IS8 A;  4CY9 A;  5FFA A;  5LBH A;  2C6R A;  3PVY B;  2GYD A;  5JAC A;  1VLG A;  3LKD A;  3SID A;  4OYN A;  3VV9 A;  4LPN A;  2V2L A;  5JKL G;  1L8I A;  4DAS A;  1LKO A;  2WLA A;  3QHB A;  4M33 A;  3PZA A;  2IU2 A;  3Q4N A;  1HRS A;  1NFV A;  3FSE A;  2FL0 A;  2ZA8 A;  3KA6 A;  1FHA A;  2V2O A;  3PVT A;  4TOE A;  1JKU A;  1OTK A;  4CMY V;  5ERJ A;  4RC5 B;  2WTL A;  3NOZ X;  3F36 A;  5AXS A;  4AM5 A;  1SOF A;  3R2L A;  3UFB A;  4QUW A;  4LPM A;  1BCF A;  1R03 A;  2VXI A;  1IES A;  3PW1 A;  2ZG8 X;  3KWO A;  4CYA A;  5K53 A;  2Y3Q A;  3F38 A;  5D8X A;  4KVR A;  2Z6M A;  4RC6 B;  3C21 A;  1YUZ A;  4P18 A;  4U3G A;  2V2N A;  4LQH A;  2PYB A;  5HJH A;  2BKC A;  3WNW A;  5C6F A;  2MGY A;  3AJO A;  2C2U A;  4ZKW A;  5K52 A;  4XKU A;  4R42 A;  2V2J A;  3R2M A;  3GE4 A;  1MFR A;  5LG2 A;  1O9I A;  2QF9 A;  3O7S A;  4MN9 A;  5D8P A;  2BW1 A;  4PGI A;  5D8O A;  3RGD A;  2C2F A;  4M35 A;  3UNO A;  3KA9 A;  3AJP A;  2ITB A;  5HJF A;  3R2H A;  2ZG9 X;  1ZS3 A;  3PW8 A;  5GU3 X;  3PVR A;  4II4 B;  3AF7 X;  2OH3 A;  1TJO A;  3KA4 A;  3F33 A;  4ISP A;  1H96 A;  3R2S A;  4Y08 A;  3E1O A;  1JI4 A;  3F32 A;  1QGH A;  3AJQ A;  3SH6 A;  2V8U A;  1NNQ A;  5GN8 A;  3WVU A;  1XZ3 A;  2JD8 0;  1DPS A;  1EUM A;  4RC7 A;  3TA8 A;  4WJG 4;  4MY7 A;  1L8H A;  4DYX A;  2V2I A;  4XKS A;  3AK8 A;  1LKM A;  3IQ1 A;  2CHI A;  1S30 A;  3WVV A;  3KXU A;  4LQJ A;  2XJO A;  4MUD A;  2OC5 A;  4PG1 A;  5JDO B;  1F30 A;  4XGS A;  4DE6 A;  1F33 A;  3KX9 A;  4LQV A;  3GVY A;  3BVF A;  3DBY A;  4CYB A;  1RCG A;  4CVS A;  3AK9 A;  3EGM A;  4TOD A;  4ISM A;  2WLU A;  2CN6 A;  1Z6O M;  2JD7 0;  3PWQ C;  3BVI A;  5CMR A;  4PG0 A;  3R2R A;  1Z6O A;  3R2O A;  3UOF A;  2F7N A;  2CIH A;  2Z90 A;  3ISE A;  3PVT B;  4X0J A;  5GU1 X;  4E40 A;  3A9Q A;  4CVT A;  1TKP A;  3BVK A;  5J8W A;  3KA8 A;  3BVL A;  1JTS A;  5J9V A;  5FFE A;  3D19 A;  1SQ3 A;  2CWL A;  2W0O A;  2C2J A;  2Z5R A;  4KVS A;  4Z3B A;  1RCD A;  3F34 A;  3PWQ A;  3QZ3 A;  3V3K B;  1N1Q A;  2ZUR X;  2V2M A;  1JGC A;  1B71 A;  2D5K A;  1DAT A;  3Q4Q A;  3ISF A;  5GU0 X;  3QB9 A;  3U90 A;  3PW8 C;  5FFB A;  3RBC A;  2ZG7 X;  2VXX A;  2FJC A;  3F39 A;  3E1P A;  2X17 0;  5FFC A;  4MXP A;  2FFX J;  3SHX A;  1S2Z A;  4EVE A;  4CVP A;  4DYZ A;  4TOF A;  3FRR A;  3OJ5 A;  2XJN A;  4TOB A;  3WVW A;  4LYX A;  1LB3 A;  5FEJ A;  4YXJ A;  2XKQ A;  5JKM G;  4TO9 A;  4ETR A;  1VEL A;  5LG8 A;  3QVD A;  1XZ1 A;  4KXR B;  4TW3 A;  5E1U A;  4E6K A;  1RCE A;  3E1J A;  2XGW A;  4DYY A;  5D8R A;  2QQY A;  3UOI A;  2HR5 A;  2JD6 0;  2V2R A;  1JIG A;  2V2S A;  2VZB A;  4KVQ A;  1DVB A;  4MKU A;  1JKV A;  1RCI A;  3F37 A;  2FG8 A;  5JKM A;  1JI5 A;  2FZF A;  3PWF A;  2FKZ A;  3GGZ A;  5IX6 A;  5GN8 B;  4XKT A;  3SE1 A;  4ZKX A;  4LPJ A;  2Y44 A;  4W4L B;  1AEW A;  1GWG A;  4DI0 A;  4RC7 B;  4PGK A;  2C41 A;  2BJY A;  2YW6 A;  2GYQ A;  4AM4 A;  1NF6 A;  1Z4A A;  2XJM A;  3AF8 X;  3QD8 A;  1S3Q A;  5D8Y A;  3O7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...