3EGMA

Structural basis of iron transport gating in helicobacter pylori ferritin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
172
structure length
172
Chain Sequence
b'HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title The crystal structure of ferritin from Helicobacter pylori reveals unusual conformational changes for iron uptake.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 79
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3egmA00
1LKPA 5CZUA 3PW8C 2OH3A 4ZLWA 2UX1A 3KA9A 4E6KA 2CN7A 5C6FA 4DZ0A 2V2IA 2FG4A 4P18A 2FHAA 1Z6OM 1RCDA 2Z5QA 3E1NA 4RC5A 3GE4A 2V2LA 5FFCA 1O9IA 5HJFA 4MN9A 5JACA 4II4A 5LS9A 4RC6B 2BK6A 1YV1A 2CIHA 4PGIA 2C2FA 3E6SA 2BW1A 4ITTA 5E1UA 4ISMA 2IY4A 4ZKWA 2ZG8X 2V2JA 4ML5A 4Y08A 2YW6A 4KVSA 2FL0A 5D8YA 3UOFA 1N1QA 1DATA 2QQYA 1IERA 2XJOA 5D8XA 3PZAA 1ZS3A 4ZMCA 1JREA 3PVRB 1RYTA 1YUZA 5ERKA 3RAVA 1TKOA 3PWQA 1S3QA 4MKUA 1UVHA 2IU2A 3FI6A 3KA4A 5JKLA 3O7SA 1KRQA 5HJHA 1JI5A 4QUWA 3F36A 5J8SA 1IESA 5FFBA 3PVYA 2XJNA 2WTLA 4AM2A 3HL1A 3E2CA 4M35A 3PWFA 2ITBA 3QVDA 3SHXA 5FEJA 2CF7A 2GYQA 4IWJA 3PW1A 3F39A 5CMRA 2YJKA 2ZG7X 4MUDA 3EZ0A 4ZJKA 3KA6A 5ERJA 5GU1X 2ZURX 2Z5PA 1XZ1A 2Z5RA 2F7NA 3ERZA 1BFRA 2V2MA 2XGWA 3GVYA 4IWKA 4TODA 3AK9A 1TJOA 2ZA6A 1LB3A 1HRSA 2C6RA 3UNOA 4TOAA 3QB9A 2CLBA 1JIGA 3BT5A 4Z5SA 1JTSA 3IQ1A 3E6RA 3Q4QA 3KX9A 4CVSA 4MJYA 1QYBA 4TOBA 4CYAA 4CMYA 5GOUA 2HTNA 4XKSA 2BJYA 4DYYA 4EVBA 2YW7A 3F34A 1S30A 1L8HA 4EVCA 3KWOA 1JKUA 4TOEA 3WVUA 2WLUA 3F37A 3ISEA 3SIDA 2FKZA 2RBDA 1JYBA 1VELA 3BVEA 4DYXA 3ISFA 1S2ZA 3F35A 2Z6MA 3AJPA 3FVBA 1MFRA 4EVDA 1L8IA 3PVTA 4ZTTA 3OJ5A 3PVRA 1R03A 2PYBA 4XKUA 2HR5A 1RCGA 3H7GA 4IXKA 3SH6A 5IX6A 5LG8A 2ZG9X 1SOFA 3T9JA 3WVWA 3BVFA 3Q4OA 2V2RA 2FJCA 1O9RA 3FSEA 4ZL5A 4TOHA 2VXIA 4RC7A 1VEIA 3F38A 2CHIA 4RC5B 5K53A 4OYNA 1AEWA 3R2SA 5LG2A 1JKVA 5FFDA 4ZKXA 4II4B 3ES3A 4MY7A 4TO9A 3RGDA 3E1LA 4ISPA 3AK8A 3KXUA 4U3GA 2CLUA 4LPNA 5GN8B 5D8SA 3EZUA 4EVEA 2V2PA 2G4HA 4AM5A 1F30A 1TKPA 4CYBA 2FFXJ 4TOCA 3R2HA 3F32A 5D8RA 5J9VA 3KA3A 4CMYV 5K52A 4KVRA 2CEIA 1JGCA 5GU0X 1EUMA 1FHAA 3SE1A 1Z4AA 1XZ3A 5FFEA 4YKHA 1OTKA 4LQJA 4XGSA 2V15A 4REUA 1LKMA 4DYUA 3QHCA 3R2KA 4ZL6A 3AF7X 2VXXA 1JI4A 3WVVA 4LPJA 2ZA7A 3PVYB 2V2NA 4RC6A 4ERUA 1MOJA 5JKMG 4DASA 1BG7A 3U90A 4XKTA 4PGKA 2C41A 3A9QA 3UOIA 3RBCA 1RCCA 3IS8A 3AF9X 1NFVA 3GHQA 1RCIA 5E2DA 2BKCA 3OGHA 4ZKHA 4CVPA 1VJXA 5J93A 4CY9A 4LQHA 3E1JA 4LPMA 3HIUA 4TOFA 1H96A 4PG0A 2OC5A 3R2OA 3RD0A 4M32A 2C2UA 3AJQA 2W0OA 2JD80 3R2LA 1VLGA 2VZBA 1F33A 4Z3BA 3E1QA 2FG8A 5J8WA 3AJOA 3E1PA 3BVIA 2XKQA 3QD8A 5GN8A 4DE6A 2Z90A 2ZA8A 1NF6A 1J30A 2V2SA 5AXSA 3EGMA 1LKOA 1TK6A 2D5KA 3E1OA 3AF8X 3E1MA 2X170 4LYXA 4CVRA 2Y3QA 3A68A 4PG1A 1UMNA 5D8PA 5HQOA 3VNXA 1SQ3A 4M34A 1NNQA 4LQNA 3PVTB 2QF9A 2CN6A 5LBHA 2GS4A 4LYUA 4LQVA 3R2MA 3IS7A 4DI0A 2V2OA 3NP0X 3NP2X 1RCEA 3NOZX 2XJMA 2JD60 3F33A 5GU3X 2FZFA 3PW8A 3QZ3A 4ITWA 3BVKA 1BCFA 2GYDA 5JKLG 4RC8A 4DYZA 4AM4A 5FFAA 4RC7B 4TW3A 5I4JA 3O7RA 1DVBA 3BVLA 5CMQA 1B71A 3MPSA 4R42A 2IB0A 5JKMA 4ETRA 3R2RA 1DPSA 1YUXA 4M33A 2C2JA 5GU2X 3BKNA 2JD70 3WNWA 2WLAA 4A25A 1QGHA 4CVTA 4TOGA 4KVQA 3TA8A 3Q4NA 1Z6OA 5D8OA 3PW1B 3Q4RA 5D8QA 2YJJA 3PWQC 1ZUJA 3RE7A 1NF4A 2CHPA 3QHBA 1VEQA 3KA8A 1GWGA
chains in the Genus database with same CATH superfamily
1LKPA 5CZUA 3PW8C 2OH3A 4ZLWA 2UX1A 3KA9A 4E6KA 2CN7A 5C6FA 4DZ0A 2V2IA 2FG4A 4P18A 2FHAA 1Z6OM 1RCDA 2Z5QA 3E1NA 4RC5A 3GE4A 3M6JA 3N6OA 2V2LA 5FFCA 1O9IA 5HJFA 4MN9A 5JACA 4II4A 5LS9A 4RC6B 2BK6A 1YV1A 2CIHA 4PGIA 3VV9A 2C2FA 3E6SA 2BW1A 4ITTA 5E1UA 4ISMA 2IY4A 4ZKWA 2ZG8X 2V2JA 4ML5A 4Y08A 2OKCA 2YW6A 3JZAB 4KVSA 2FL0A 5D8YA 2CWLA 3UOFA 1N1QA 1DATA 2QQYA 1IERA 2XJOA 5D8XA 3PZAA 2V8TA 1ZS3A 4ZMCA 1JREA 3PVRB 1RYTA 1YUZA 5ERKA 3RAVA 3KHKA 1TKOA 3PWQA 2AR0A 1S3QA 4MKUA 1UVHA 2IU2A 3FI6A 3KA4A 5JKLA 3O7SA 1KRQA 5HJHA 1JI5A 2Y44A 4QUWA 3F36A 5J8SA 1IESA 5FFBA 3PVYA 2XJNA 2WTLA 4AM2A 3HL1A 3E2CA 3C1ZA 4M35A 3PWFA 2ITBA 3QVDA 3SHXA 5FEJA 2CF7A 2GYQA 4IWJA 3PW1A 3F39A 5CMRA 2YJKA 2ZG7X 4MUDA 3EZ0A 4ZJKA 3KA6A 5ERJA 5GU1X 2ZURX 2Z5PA 1XZ1A 2Z5RA 2F7NA 3ERZA 1BFRA 2V2MA 2XGWA 3GVYA 4IWKA 4TODA 3AK9A 1TJOA 2ZA6A 1LB3A 1HRSA 2C6RA 3UNOA 4TOAA 3QB9A 2CLBA 1JIGA 3BT5A 4Z5SA 3DBYA 1JTSA 5JDOB 3IQ1A 3E6RA 3KDQA 3Q4QA 3KX9A 3LKDA 4CVSA 4MJYA 1QYBA 4TOBA 4CYAA 4CMYA 5GOUA 2HTNA 4XKSA 2BJYA 4DYYA 4EVBA 2YW7A 3F34A 1S30A 1L8HA 3FRSA 4WJG4 4EVCA 3KWOA 1JKUA 4TOEA 3WVUA 2WLUA 3F37A 3ISEA 3SIDA 2FKZA 2RBDA 1JYBA 1VELA 3BVEA 4DYXA 3ISFA 1S2ZA 3F35A 2Z6MA 3AJPA 3FVBA 1MFRA 4EVDA 1L8IA 3PVTA 4ZTTA 3OJ5A 3PVRA 1R03A 2PYBA 4XKUA 3L0MA 2HR5A 1RCGA 3H7GA 4IXKA 3SH6A 5IX6A 5LG8A 2ZG9X 1SOFA 3T9JA 3WVWA 3BVFA 3Q4OA 2V2RA 2FJCA 1O9RA 3FSEA 3VVAA 4ZL5A 4TOHA 2VXIA 4RC7A 1VEIA 3F38A 3C23A 2G38B 2CHIA 4RC5B 5K53A 4OYNA 1AEWA 3FRRA 3R2SA 5LG2A 1JKVA 5FFDA 4ZKXA 4II4B 3ES3A 4MY7A 4TO9A 3RGDA 3E1LA 4ISPA 3AK8A 3KXUA 4U3GA 2CLUA 4LPNA 5GN8B 5D8SA 3EZUA 4EVEA 2V2PA 2G4HA 3W54A 1F30A 4AM5A 1TKPA 4CYBA 2FFXJ 4TOCA 3R2HA 3D19A 3F32A 5JDOA 5D8RA 5J9VA 3KA3A 4CMYV 5K52A 4KVRA 2CEIA 1JGCA 5GU0X 1EUMA 1FHAA 3SE1A 1Z4AA 1XZ3A 5FFEA 4YKHA 1OTKA 4LQJA 4XGSA 2V15A 4REUA 4W4LB 1LKMA 4DYUA 3QHCA 3R2KA 4ZL6A 3AF7X 2VXXA 1JI4A 3WVVA 4LPJA 2ZA7A 3PVYB 2V2NA 4RC6A 4ERUA 1MOJA 3V3KB 5JKMG 4DASA 1BG7A 3U90A 4XKTA 4PGKA 2C41A 3A9QA 3UOIA 3RBCA 2N02A 1RCCA 3IS8A 3AF9X 1NFVA 3GHQA 1RCIA 5E2DA 2BKCA 3OGHA 4ZKHA 4CVPA 1VJXA 5HU6D 5J93A 2WWXB 4CY9A 4LQHA 3E1JA 2MGYA 4YXJA 4LPMA 3HIUA 2V8UA 4TOFA 4YVZA 1H96A 4PG0A 2OC5A 3R2OA 3RD0A 4M32A 2C2UA 3AJQA 2W0OA 2JD80 3R2LA 1VLGA 2VZBA 1F33A 4Z3BA 3E1QA 2FG8A 4MXPA 5J8WA 3AJOA 3E1PA 3BVIA 2XKQA 3QD8A 5GN8A 4DE6A 2Z90A 4X0JA 2ZA8A 1NF6A 1J30A 2V2SA 5AXSA 3EGMA 1LKOA 4E40A 1TK6A 2D5KA 3E1OA 3AF8X 3E1MA 2X170 4LYXA 4CVRA 2Y3QA 3A68A 4KXRB 4PG1A 1UMNA 5D8PA 5HQOA 3JZ9A 3VNXA 1SQ3A 4M34A 1NNQA 4LQNA 3PVTB 2QF9A 2CN6A 5LBHA 2GS4A 4LYUA 4LQVA 3R2MA 3C21A 3IS7A 4DI0A 2V2OA 3NP0X 3NP2X 1RCEA 3NOZX 2XJMA 2JD60 3F33A 5GU3X 2FZFA 3PW8A 3QZ3A 4ITWA 3BVKA 1BCFA 2GYDA 5JKLG 4RC8A 4DYZA 4AM4A 5FFAA 4RC7B 4TW3A 5I4JA 3O7RA 1DVBA 3BVLA 5CMQA 1B71A 3GGZA 3MPSA 3UFBA 3GGYA 4R42A 2IB0A 5JKMA 4ETRA 3R2RA 1DPSA 1YUXA 4M33A 2C2JA 5GU2X 3BKNA 4W4KB 2JD70 3WNWA 3C1YA 2WLAA 4A25A 1QGHA 4CVTA 4TOGA 4KVQA 3TA8A 3Q4NA 1Z6OA 5D8OA 4YXMA 3PW1B 3Q4RA 5D8QA 2YJJA 3PWQC 1ZUJA 3RE7A 1NF4A 2CHPA 3QHBA 1VEQA 3KA8A 1GWGA
chains in the Genus database with same CATH topology
1LKPA 5CZUA 3PW8C 2OH3A 4ZLWA 2UX1A 3KA9A 4E6KA 2CN7A 5C6FA 4DZ0A 2V2IA 2FG4A 4P18A 2FHAA 1Z6OM 1RCDA 2Z5QA 3E1NA 4RC5A 3GE4A 3M6JA 3N6OA 2V2LA 5FFCA 1O9IA 5HJFA 4MN9A 5JACA 4II4A 5LS9A 4RC6B 2BK6A 1YV1A 2CIHA 4PGIA 3VV9A 2C2FA 3E6SA 2BW1A 4ITTA 5E1UA 4ISMA 2IY4A 4ZKWA 2ZG8X 2V2JA 4ML5A 4Y08A 2OKCA 2YW6A 3JZAB 4KVSA 2FL0A 5D8YA 2CWLA 3UOFA 1N1QA 1DATA 2QQYA 1IERA 2XJOA 5D8XA 3PZAA 2V8TA 1ZS3A 4ZMCA 1JREA 3PVRB 1RYTA 1YUZA 5ERKA 3RAVA 3KHKA 1TKOA 3PWQA 2AR0A 1S3QA 4MKUA 1UVHA 2IU2A 3FI6A 3KA4A 5JKLA 3O7SA 1KRQA 5HJHA 1JI5A 2Y44A 4QUWA 3F36A 5J8SA 1IESA 5FFBA 3PVYA 2XJNA 2WTLA 4AM2A 3HL1A 3E2CA 3C1ZA 4M35A 3PWFA 2ITBA 3QVDA 3SHXA 5FEJA 2CF7A 2GYQA 4IWJA 3PW1A 3F39A 5CMRA 2YJKA 2ZG7X 4MUDA 3EZ0A 4ZJKA 3KA6A 5ERJA 5GU1X 2ZURX 2Z5PA 1XZ1A 2Z5RA 2F7NA 3ERZA 1BFRA 2V2MA 2XGWA 3GVYA 4IWKA 4TODA 3AK9A 1TJOA 2ZA6A 1LB3A 1HRSA 2C6RA 3UNOA 4TOAA 3QB9A 2CLBA 1JIGA 3BT5A 4Z5SA 3DBYA 1JTSA 5JDOB 3IQ1A 3E6RA 3KDQA 3Q4QA 3KX9A 3LKDA 4CVSA 4MJYA 1QYBA 4TOBA 4CYAA 4CMYA 5GOUA 2HTNA 4XKSA 2BJYA 4DYYA 4EVBA 2YW7A 3F34A 1S30A 1L8HA 3FRSA 4WJG4 4EVCA 3KWOA 1JKUA 4TOEA 3WVUA 2WLUA 3F37A 3ISEA 3SIDA 2FKZA 2RBDA 1JYBA 1VELA 3BVEA 4DYXA 3ISFA 1S2ZA 3F35A 2Z6MA 3AJPA 3FVBA 1MFRA 4EVDA 1L8IA 3PVTA 4ZTTA 3OJ5A 3PVRA 1R03A 2PYBA 4XKUA 3L0MA 2HR5A 1RCGA 3H7GA 4IXKA 3SH6A 5IX6A 5LG8A 2ZG9X 1SOFA 3T9JA 3WVWA 3BVFA 3Q4OA 2V2RA 2FJCA 1O9RA 3FSEA 3VVAA 4ZL5A 4TOHA 2VXIA 4RC7A 1VEIA 3F38A 3C23A 2G38B 2CHIA 4RC5B 5K53A 4OYNA 1AEWA 3FRRA 3R2SA 5LG2A 1JKVA 5FFDA 4ZKXA 4II4B 3ES3A 4MY7A 4TO9A 3RGDA 3E1LA 4ISPA 3AK8A 3KXUA 4U3GA 2CLUA 4LPNA 5GN8B 5D8SA 3EZUA 4EVEA 2V2PA 2G4HA 3W54A 1F30A 4AM5A 1TKPA 4CYBA 2FFXJ 4TOCA 3R2HA 3D19A 3F32A 5JDOA 5D8RA 5J9VA 3KA3A 4CMYV 5K52A 4KVRA 2CEIA 1JGCA 5GU0X 1EUMA 1FHAA 3SE1A 1Z4AA 1XZ3A 5FFEA 4YKHA 1OTKA 4LQJA 4XGSA 2V15A 4REUA 4W4LB 1LKMA 4DYUA 3QHCA 3R2KA 4ZL6A 3AF7X 2VXXA 1JI4A 3WVVA 4LPJA 2ZA7A 3PVYB 2V2NA 4RC6A 4ERUA 1MOJA 3V3KB 5JKMG 4DASA 1BG7A 3U90A 4XKTA 4PGKA 2C41A 3A9QA 3UOIA 3RBCA 2N02A 1RCCA 3IS8A 3AF9X 1NFVA 3GHQA 1RCIA 5E2DA 2BKCA 3OGHA 4ZKHA 4CVPA 1VJXA 5HU6D 5J93A 2WWXB 4CY9A 4LQHA 3E1JA 2MGYA 4YXJA 4LPMA 3HIUA 2V8UA 4TOFA 4YVZA 1H96A 4PG0A 2OC5A 3R2OA 3RD0A 4M32A 2C2UA 3AJQA 2W0OA 2JD80 3R2LA 1VLGA 2VZBA 1F33A 4Z3BA 3E1QA 2FG8A 4MXPA 5J8WA 3AJOA 3E1PA 3BVIA 2XKQA 3QD8A 5GN8A 4DE6A 2Z90A 4X0JA 2ZA8A 1NF6A 1J30A 2V2SA 5AXSA 3EGMA 1LKOA 4E40A 1TK6A 2D5KA 3E1OA 3AF8X 3E1MA 2X170 4LYXA 4CVRA 2Y3QA 3A68A 4KXRB 4PG1A 1UMNA 5D8PA 5HQOA 3JZ9A 3VNXA 1SQ3A 4M34A 1NNQA 4LQNA 3PVTB 2QF9A 2CN6A 5LBHA 2GS4A 4LYUA 4LQVA 3R2MA 3C21A 3IS7A 4DI0A 2V2OA 3NP0X 3NP2X 1RCEA 3NOZX 2XJMA 2JD60 3F33A 5GU3X 2FZFA 3PW8A 3QZ3A 4ITWA 3BVKA 1BCFA 2GYDA 5JKLG 4RC8A 4DYZA 4AM4A 5FFAA 4RC7B 4TW3A 5I4JA 3O7RA 1DVBA 3BVLA 5CMQA 1B71A 3GGZA 3MPSA 3UFBA 3GGYA 4R42A 2IB0A 5JKMA 4ETRA 3R2RA 1DPSA 1YUXA 4M33A 2C2JA 5GU2X 3BKNA 4W4KB 2JD70 3WNWA 3C1YA 2WLAA 4A25A 1QGHA 4CVTA 4TOGA 4KVQA 3TA8A 3Q4NA 1Z6OA 5D8OA 4YXMA 3PW1B 3Q4RA 5D8QA 2YJJA 3PWQC 1ZUJA 3RE7A 1NF4A 2CHPA 3QHBA 1VEQA 3KA8A 1GWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKP A;  5CZU A;  3PW8 C;  2OH3 A;  4ZLW A;  2UX1 A;  3KA9 A;  4E6K A;  2CN7 A;  5C6F A;  4DZ0 A;  2V2I A;  2FG4 A;  4P18 A;  2FHA A;  1Z6O M;  1RCD A;  2Z5Q A;  3E1N A;  4RC5 A;  3GE4 A;  2V2L A;  5FFC A;  1O9I A;  5HJF A;  4MN9 A;  5JAC A;  4II4 A;  5LS9 A;  4RC6 B;  2BK6 A;  1YV1 A;  2CIH A;  4PGI A;  2C2F A;  3E6S A;  2BW1 A;  4ITT A;  5E1U A;  4ISM A;  2IY4 A;  4ZKW A;  2ZG8 X;  2V2J A;  4ML5 A;  4Y08 A;  2YW6 A;  4KVS A;  2FL0 A;  5D8Y A;  3UOF A;  1N1Q A;  1DAT A;  2QQY A;  1IER A;  2XJO A;  5D8X A;  3PZA A;  1ZS3 A;  4ZMC A;  1JRE A;  3PVR B;  1RYT A;  1YUZ A;  5ERK A;  3RAV A;  1TKO A;  3PWQ A;  1S3Q A;  4MKU A;  1UVH A;  2IU2 A;  3FI6 A;  3KA4 A;  5JKL A;  3O7S A;  1KRQ A;  5HJH A;  1JI5 A;  4QUW A;  3F36 A;  5J8S A;  1IES A;  5FFB A;  3PVY A;  2XJN A;  2WTL A;  4AM2 A;  3HL1 A;  3E2C A;  4M35 A;  3PWF A;  2ITB A;  3QVD A;  3SHX A;  5FEJ A;  2CF7 A;  2GYQ A;  4IWJ A;  3PW1 A;  3F39 A;  5CMR A;  2YJK A;  2ZG7 X;  4MUD A;  3EZ0 A;  4ZJK A;  3KA6 A;  5ERJ A;  5GU1 X;  2ZUR X;  2Z5P A;  1XZ1 A;  2Z5R A;  2F7N A;  3ERZ A;  1BFR A;  2V2M A;  2XGW A;  3GVY A;  4IWK A;  4TOD A;  3AK9 A;  1TJO A;  2ZA6 A;  1LB3 A;  1HRS A;  2C6R A;  3UNO A;  4TOA A;  3QB9 A;  2CLB A;  1JIG A;  3BT5 A;  4Z5S A;  1JTS A;  3IQ1 A;  3E6R A;  3Q4Q A;  3KX9 A;  4CVS A;  4MJY A;  1QYB A;  4TOB A;  4CYA A;  4CMY A;  5GOU A;  2HTN A;  4XKS A;  2BJY A;  4DYY A;  4EVB A;  2YW7 A;  3F34 A;  1S30 A;  1L8H A;  4EVC A;  3KWO A;  1JKU A;  4TOE A;  3WVU A;  2WLU A;  3F37 A;  3ISE A;  3SID A;  2FKZ A;  2RBD A;  1JYB A;  1VEL A;  3BVE A;  4DYX A;  3ISF A;  1S2Z A;  3F35 A;  2Z6M A;  3AJP A;  3FVB A;  1MFR A;  4EVD A;  1L8I A;  3PVT A;  4ZTT A;  3OJ5 A;  3PVR A;  1R03 A;  2PYB A;  4XKU A;  2HR5 A;  1RCG A;  3H7G A;  4IXK A;  3SH6 A;  5IX6 A;  5LG8 A;  2ZG9 X;  1SOF A;  3T9J A;  3WVW A;  3BVF A;  3Q4O A;  2V2R A;  2FJC A;  1O9R A;  3FSE A;  4ZL5 A;  4TOH A;  2VXI A;  4RC7 A;  1VEI A;  3F38 A;  2CHI A;  4RC5 B;  5K53 A;  4OYN A;  1AEW A;  3R2S A;  5LG2 A;  1JKV A;  5FFD A;  4ZKX A;  4II4 B;  3ES3 A;  4MY7 A;  4TO9 A;  3RGD A;  3E1L A;  4ISP A;  3AK8 A;  3KXU A;  4U3G A;  2CLU A;  4LPN A;  5GN8 B;  5D8S A;  3EZU A;  4EVE A;  2V2P A;  2G4H A;  4AM5 A;  1F30 A;  1TKP A;  4CYB A;  2FFX J;  4TOC A;  3R2H A;  3F32 A;  5D8R A;  5J9V A;  3KA3 A;  4CMY V;  5K52 A;  4KVR A;  2CEI A;  1JGC A;  5GU0 X;  1EUM A;  1FHA A;  3SE1 A;  1Z4A A;  1XZ3 A;  5FFE A;  4YKH A;  1OTK A;  4LQJ A;  4XGS A;  2V15 A;  4REU A;  1LKM A;  4DYU A;  3QHC A;  3R2K A;  4ZL6 A;  3AF7 X;  2VXX A;  1JI4 A;  3WVV A;  4LPJ A;  2ZA7 A;  3PVY B;  2V2N A;  4RC6 A;  4ERU A;  1MOJ A;  5JKM G;  4DAS A;  1BG7 A;  3U90 A;  4XKT A;  4PGK A;  2C41 A;  3A9Q A;  3UOI A;  3RBC A;  1RCC A;  3IS8 A;  3AF9 X;  1NFV A;  3GHQ A;  1RCI A;  5E2D A;  2BKC A;  3OGH A;  4ZKH A;  4CVP A;  1VJX A;  5J93 A;  4CY9 A;  4LQH A;  3E1J A;  4LPM A;  3HIU A;  4TOF A;  1H96 A;  4PG0 A;  2OC5 A;  3R2O A;  3RD0 A;  4M32 A;  2C2U A;  3AJQ A;  2W0O A;  2JD8 0;  3R2L A;  1VLG A;  2VZB A;  1F33 A;  4Z3B A;  3E1Q A;  2FG8 A;  5J8W A;  3AJO A;  3E1P A;  3BVI A;  2XKQ A;  3QD8 A;  5GN8 A;  4DE6 A;  2Z90 A;  2ZA8 A;  1NF6 A;  1J30 A;  2V2S A;  5AXS A;  3EGM A;  1LKO A;  1TK6 A;  2D5K A;  3E1O A;  3AF8 X;  3E1M A;  2X17 0;  4LYX A;  4CVR A;  2Y3Q A;  3A68 A;  4PG1 A;  1UMN A;  5D8P A;  5HQO A;  3VNX A;  1SQ3 A;  4M34 A;  1NNQ A;  4LQN A;  3PVT B;  2QF9 A;  2CN6 A;  5LBH A;  2GS4 A;  4LYU A;  4LQV A;  3R2M A;  3IS7 A;  4DI0 A;  2V2O A;  3NP0 X;  3NP2 X;  1RCE A;  3NOZ X;  2XJM A;  2JD6 0;  3F33 A;  5GU3 X;  2FZF A;  3PW8 A;  3QZ3 A;  4ITW A;  3BVK A;  1BCF A;  2GYD A;  5JKL G;  4RC8 A;  4DYZ A;  4AM4 A;  5FFA A;  4RC7 B;  4TW3 A;  5I4J A;  3O7R A;  1DVB A;  3BVL A;  5CMQ A;  1B71 A;  3MPS A;  4R42 A;  2IB0 A;  5JKM A;  4ETR A;  3R2R A;  1DPS A;  1YUX A;  4M33 A;  2C2J A;  5GU2 X;  3BKN A;  2JD7 0;  3WNW A;  2WLA A;  4A25 A;  1QGH A;  4CVT A;  4TOG A;  4KVQ A;  3TA8 A;  3Q4N A;  1Z6O A;  5D8O A;  3PW1 B;  3Q4R A;  5D8Q A;  2YJJ A;  3PWQ C;  1ZUJ A;  3RE7 A;  1NF4 A;  2CHP A;  3QHB A;  1VEQ A;  3KA8 A;  1GWG A; 
#chains in the Genus database with same CATH topology
 1LKP A;  5CZU A;  3PW8 C;  2OH3 A;  4ZLW A;  2UX1 A;  3KA9 A;  4E6K A;  2CN7 A;  5C6F A;  4DZ0 A;  2V2I A;  2FG4 A;  4P18 A;  2FHA A;  1Z6O M;  1RCD A;  2Z5Q A;  3E1N A;  4RC5 A;  3GE4 A;  3M6J A;  3N6O A;  2V2L A;  5FFC A;  1O9I A;  5HJF A;  4MN9 A;  5JAC A;  4II4 A;  5LS9 A;  4RC6 B;  2BK6 A;  1YV1 A;  2CIH A;  4PGI A;  3VV9 A;  2C2F A;  3E6S A;  2BW1 A;  4ITT A;  5E1U A;  4ISM A;  2IY4 A;  4ZKW A;  2ZG8 X;  2V2J A;  4ML5 A;  4Y08 A;  2OKC A;  2YW6 A;  3JZA B;  4KVS A;  2FL0 A;  5D8Y A;  2CWL A;  3UOF A;  1N1Q A;  1DAT A;  2QQY A;  1IER A;  2XJO A;  5D8X A;  3PZA A;  2V8T A;  1ZS3 A;  4ZMC A;  1JRE A;  3PVR B;  1RYT A;  1YUZ A;  5ERK A;  3RAV A;  3KHK A;  1TKO A;  3PWQ A;  2AR0 A;  1S3Q A;  4MKU A;  1UVH A;  2IU2 A;  3FI6 A;  3KA4 A;  5JKL A;  3O7S A;  1KRQ A;  5HJH A;  1JI5 A;  2Y44 A;  4QUW A;  3F36 A;  5J8S A;  1IES A;  5FFB A;  3PVY A;  2XJN A;  2WTL A;  4AM2 A;  3HL1 A;  3E2C A;  3C1Z A;  4M35 A;  3PWF A;  2ITB A;  3QVD A;  3SHX A;  5FEJ A;  2CF7 A;  2GYQ A;  4IWJ A;  3PW1 A;  3F39 A;  5CMR A;  2YJK A;  2ZG7 X;  4MUD A;  3EZ0 A;  4ZJK A;  3KA6 A;  5ERJ A;  5GU1 X;  2ZUR X;  2Z5P A;  1XZ1 A;  2Z5R A;  2F7N A;  3ERZ A;  1BFR A;  2V2M A;  2XGW A;  3GVY A;  4IWK A;  4TOD A;  3AK9 A;  1TJO A;  2ZA6 A;  1LB3 A;  1HRS A;  2C6R A;  3UNO A;  4TOA A;  3QB9 A;  2CLB A;  1JIG A;  3BT5 A;  4Z5S A;  3DBY A;  1JTS A;  5JDO B;  3IQ1 A;  3E6R A;  3KDQ A;  3Q4Q A;  3KX9 A;  3LKD A;  4CVS A;  4MJY A;  1QYB A;  4TOB A;  4CYA A;  4CMY A;  5GOU A;  2HTN A;  4XKS A;  2BJY A;  4DYY A;  4EVB A;  2YW7 A;  3F34 A;  1S30 A;  1L8H A;  3FRS A;  4WJG 4;  4EVC A;  3KWO A;  1JKU A;  4TOE A;  3WVU A;  2WLU A;  3F37 A;  3ISE A;  3SID A;  2FKZ A;  2RBD A;  1JYB A;  1VEL A;  3BVE A;  4DYX A;  3ISF A;  1S2Z A;  3F35 A;  2Z6M A;  3AJP A;  3FVB A;  1MFR A;  4EVD A;  1L8I A;  3PVT A;  4ZTT A;  3OJ5 A;  3PVR A;  1R03 A;  2PYB A;  4XKU A;  3L0M A;  2HR5 A;  1RCG A;  3H7G A;  4IXK A;  3SH6 A;  5IX6 A;  5LG8 A;  2ZG9 X;  1SOF A;  3T9J A;  3WVW A;  3BVF A;  3Q4O A;  2V2R A;  2FJC A;  1O9R A;  3FSE A;  3VVA A;  4ZL5 A;  4TOH A;  2VXI A;  4RC7 A;  1VEI A;  3F38 A;  3C23 A;  2G38 B;  2CHI A;  4RC5 B;  5K53 A;  4OYN A;  1AEW A;  3FRR A;  3R2S A;  5LG2 A;  1JKV A;  5FFD A;  4ZKX A;  4II4 B;  3ES3 A;  4MY7 A;  4TO9 A;  3RGD A;  3E1L A;  4ISP A;  3AK8 A;  3KXU A;  4U3G A;  2CLU A;  4LPN A;  5GN8 B;  5D8S A;  3EZU A;  4EVE A;  2V2P A;  2G4H A;  3W54 A;  1F30 A;  4AM5 A;  1TKP A;  4CYB A;  2FFX J;  4TOC A;  3R2H A;  3D19 A;  3F32 A;  5JDO A;  5D8R A;  5J9V A;  3KA3 A;  4CMY V;  5K52 A;  4KVR A;  2CEI A;  1JGC A;  5GU0 X;  1EUM A;  1FHA A;  3SE1 A;  1Z4A A;  1XZ3 A;  5FFE A;  4YKH A;  1OTK A;  4LQJ A;  4XGS A;  2V15 A;  4REU A;  4W4L B;  1LKM A;  4DYU A;  3QHC A;  3R2K A;  4ZL6 A;  3AF7 X;  2VXX A;  1JI4 A;  3WVV A;  4LPJ A;  2ZA7 A;  3PVY B;  2V2N A;  4RC6 A;  4ERU A;  1MOJ A;  3V3K B;  5JKM G;  4DAS A;  1BG7 A;  3U90 A;  4XKT A;  4PGK A;  2C41 A;  3A9Q A;  3UOI A;  3RBC A;  2N02 A;  1RCC A;  3IS8 A;  3AF9 X;  1NFV A;  3GHQ A;  1RCI A;  5E2D A;  2BKC A;  3OGH A;  4ZKH A;  4CVP A;  1VJX A;  5HU6 D;  5J93 A;  2WWX B;  4CY9 A;  4LQH A;  3E1J A;  2MGY A;  4YXJ A;  4LPM A;  3HIU A;  2V8U A;  4TOF A;  4YVZ A;  1H96 A;  4PG0 A;  2OC5 A;  3R2O A;  3RD0 A;  4M32 A;  2C2U A;  3AJQ A;  2W0O A;  2JD8 0;  3R2L A;  1VLG A;  2VZB A;  1F33 A;  4Z3B A;  3E1Q A;  2FG8 A;  4MXP A;  5J8W A;  3AJO A;  3E1P A;  3BVI A;  2XKQ A;  3QD8 A;  5GN8 A;  4DE6 A;  2Z90 A;  4X0J A;  2ZA8 A;  1NF6 A;  1J30 A;  2V2S A;  5AXS A;  3EGM A;  1LKO A;  4E40 A;  1TK6 A;  2D5K A;  3E1O A;  3AF8 X;  3E1M A;  2X17 0;  4LYX A;  4CVR A;  2Y3Q A;  3A68 A;  4KXR B;  4PG1 A;  1UMN A;  5D8P A;  5HQO A;  3JZ9 A;  3VNX A;  1SQ3 A;  4M34 A;  1NNQ A;  4LQN A;  3PVT B;  2QF9 A;  2CN6 A;  5LBH A;  2GS4 A;  4LYU A;  4LQV A;  3R2M A;  3C21 A;  3IS7 A;  4DI0 A;  2V2O A;  3NP0 X;  3NP2 X;  1RCE A;  3NOZ X;  2XJM A;  2JD6 0;  3F33 A;  5GU3 X;  2FZF A;  3PW8 A;  3QZ3 A;  4ITW A;  3BVK A;  1BCF A;  2GYD A;  5JKL G;  4RC8 A;  4DYZ A;  4AM4 A;  5FFA A;  4RC7 B;  4TW3 A;  5I4J A;  3O7R A;  1DVB A;  3BVL A;  5CMQ A;  1B71 A;  3GGZ A;  3MPS A;  3UFB A;  3GGY A;  4R42 A;  2IB0 A;  5JKM A;  4ETR A;  3R2R A;  1DPS A;  1YUX A;  4M33 A;  2C2J A;  5GU2 X;  3BKN A;  4W4K B;  2JD7 0;  3WNW A;  3C1Y A;  2WLA A;  4A25 A;  1QGH A;  4CVT A;  4TOG A;  4KVQ A;  3TA8 A;  3Q4N A;  1Z6O A;  5D8O A;  4YXM A;  3PW1 B;  3Q4R A;  5D8Q A;  2YJJ A;  3PWQ C;  1ZUJ A;  3RE7 A;  1NF4 A;  2CHP A;  3QHB A;  1VEQ A;  3KA8 A;  1GWG A; 
#chains in the Genus database with same CATH homology
 1LKP A;  5CZU A;  3PW8 C;  2OH3 A;  4ZLW A;  2UX1 A;  3KA9 A;  4E6K A;  2CN7 A;  5C6F A;  4DZ0 A;  2V2I A;  2FG4 A;  4P18 A;  2FHA A;  1Z6O M;  1RCD A;  2Z5Q A;  3E1N A;  4RC5 A;  3GE4 A;  3M6J A;  3N6O A;  2V2L A;  5FFC A;  1O9I A;  5HJF A;  4MN9 A;  5JAC A;  4II4 A;  5LS9 A;  4RC6 B;  2BK6 A;  1YV1 A;  2CIH A;  4PGI A;  3VV9 A;  2C2F A;  3E6S A;  2BW1 A;  4ITT A;  5E1U A;  4ISM A;  2IY4 A;  4ZKW A;  2ZG8 X;  2V2J A;  4ML5 A;  4Y08 A;  2OKC A;  2YW6 A;  3JZA B;  4KVS A;  2FL0 A;  5D8Y A;  2CWL A;  3UOF A;  1N1Q A;  1DAT A;  2QQY A;  1IER A;  2XJO A;  5D8X A;  3PZA A;  2V8T A;  1ZS3 A;  4ZMC A;  1JRE A;  3PVR B;  1RYT A;  1YUZ A;  5ERK A;  3RAV A;  3KHK A;  1TKO A;  3PWQ A;  2AR0 A;  1S3Q A;  4MKU A;  1UVH A;  2IU2 A;  3FI6 A;  3KA4 A;  5JKL A;  3O7S A;  1KRQ A;  5HJH A;  1JI5 A;  2Y44 A;  4QUW A;  3F36 A;  5J8S A;  1IES A;  5FFB A;  3PVY A;  2XJN A;  2WTL A;  4AM2 A;  3HL1 A;  3E2C A;  3C1Z A;  4M35 A;  3PWF A;  2ITB A;  3QVD A;  3SHX A;  5FEJ A;  2CF7 A;  2GYQ A;  4IWJ A;  3PW1 A;  3F39 A;  5CMR A;  2YJK A;  2ZG7 X;  4MUD A;  3EZ0 A;  4ZJK A;  3KA6 A;  5ERJ A;  5GU1 X;  2ZUR X;  2Z5P A;  1XZ1 A;  2Z5R A;  2F7N A;  3ERZ A;  1BFR A;  2V2M A;  2XGW A;  3GVY A;  4IWK A;  4TOD A;  3AK9 A;  1TJO A;  2ZA6 A;  1LB3 A;  1HRS A;  2C6R A;  3UNO A;  4TOA A;  3QB9 A;  2CLB A;  1JIG A;  3BT5 A;  4Z5S A;  3DBY A;  1JTS A;  5JDO B;  3IQ1 A;  3E6R A;  3KDQ A;  3Q4Q A;  3KX9 A;  3LKD A;  4CVS A;  4MJY A;  1QYB A;  4TOB A;  4CYA A;  4CMY A;  5GOU A;  2HTN A;  4XKS A;  2BJY A;  4DYY A;  4EVB A;  2YW7 A;  3F34 A;  1S30 A;  1L8H A;  3FRS A;  4WJG 4;  4EVC A;  3KWO A;  1JKU A;  4TOE A;  3WVU A;  2WLU A;  3F37 A;  3ISE A;  3SID A;  2FKZ A;  2RBD A;  1JYB A;  1VEL A;  3BVE A;  4DYX A;  3ISF A;  1S2Z A;  3F35 A;  2Z6M A;  3AJP A;  3FVB A;  1MFR A;  4EVD A;  1L8I A;  3PVT A;  4ZTT A;  3OJ5 A;  3PVR A;  1R03 A;  2PYB A;  4XKU A;  3L0M A;  2HR5 A;  1RCG A;  3H7G A;  4IXK A;  3SH6 A;  5IX6 A;  5LG8 A;  2ZG9 X;  1SOF A;  3T9J A;  3WVW A;  3BVF A;  3Q4O A;  2V2R A;  2FJC A;  1O9R A;  3FSE A;  3VVA A;  4ZL5 A;  4TOH A;  2VXI A;  4RC7 A;  1VEI A;  3F38 A;  3C23 A;  2G38 B;  2CHI A;  4RC5 B;  5K53 A;  4OYN A;  1AEW A;  3FRR A;  3R2S A;  5LG2 A;  1JKV A;  5FFD A;  4ZKX A;  4II4 B;  3ES3 A;  4MY7 A;  4TO9 A;  3RGD A;  3E1L A;  4ISP A;  3AK8 A;  3KXU A;  4U3G A;  2CLU A;  4LPN A;  5GN8 B;  5D8S A;  3EZU A;  4EVE A;  2V2P A;  2G4H A;  3W54 A;  1F30 A;  4AM5 A;  1TKP A;  4CYB A;  2FFX J;  4TOC A;  3R2H A;  3D19 A;  3F32 A;  5JDO A;  5D8R A;  5J9V A;  3KA3 A;  4CMY V;  5K52 A;  4KVR A;  2CEI A;  1JGC A;  5GU0 X;  1EUM A;  1FHA A;  3SE1 A;  1Z4A A;  1XZ3 A;  5FFE A;  4YKH A;  1OTK A;  4LQJ A;  4XGS A;  2V15 A;  4REU A;  4W4L B;  1LKM A;  4DYU A;  3QHC A;  3R2K A;  4ZL6 A;  3AF7 X;  2VXX A;  1JI4 A;  3WVV A;  4LPJ A;  2ZA7 A;  3PVY B;  2V2N A;  4RC6 A;  4ERU A;  1MOJ A;  3V3K B;  5JKM G;  4DAS A;  1BG7 A;  3U90 A;  4XKT A;  4PGK A;  2C41 A;  3A9Q A;  3UOI A;  3RBC A;  2N02 A;  1RCC A;  3IS8 A;  3AF9 X;  1NFV A;  3GHQ A;  1RCI A;  5E2D A;  2BKC A;  3OGH A;  4ZKH A;  4CVP A;  1VJX A;  5HU6 D;  5J93 A;  2WWX B;  4CY9 A;  4LQH A;  3E1J A;  2MGY A;  4YXJ A;  4LPM A;  3HIU A;  2V8U A;  4TOF A;  4YVZ A;  1H96 A;  4PG0 A;  2OC5 A;  3R2O A;  3RD0 A;  4M32 A;  2C2U A;  3AJQ A;  2W0O A;  2JD8 0;  3R2L A;  1VLG A;  2VZB A;  1F33 A;  4Z3B A;  3E1Q A;  2FG8 A;  4MXP A;  5J8W A;  3AJO A;  3E1P A;  3BVI A;  2XKQ A;  3QD8 A;  5GN8 A;  4DE6 A;  2Z90 A;  4X0J A;  2ZA8 A;  1NF6 A;  1J30 A;  2V2S A;  5AXS A;  3EGM A;  1LKO A;  4E40 A;  1TK6 A;  2D5K A;  3E1O A;  3AF8 X;  3E1M A;  2X17 0;  4LYX A;  4CVR A;  2Y3Q A;  3A68 A;  4KXR B;  4PG1 A;  1UMN A;  5D8P A;  5HQO A;  3JZ9 A;  3VNX A;  1SQ3 A;  4M34 A;  1NNQ A;  4LQN A;  3PVT B;  2QF9 A;  2CN6 A;  5LBH A;  2GS4 A;  4LYU A;  4LQV A;  3R2M A;  3C21 A;  3IS7 A;  4DI0 A;  2V2O A;  3NP0 X;  3NP2 X;  1RCE A;  3NOZ X;  2XJM A;  2JD6 0;  3F33 A;  5GU3 X;  2FZF A;  3PW8 A;  3QZ3 A;  4ITW A;  3BVK A;  1BCF A;  2GYD A;  5JKL G;  4RC8 A;  4DYZ A;  4AM4 A;  5FFA A;  4RC7 B;  4TW3 A;  5I4J A;  3O7R A;  1DVB A;  3BVL A;  5CMQ A;  1B71 A;  3GGZ A;  3MPS A;  3UFB A;  3GGY A;  4R42 A;  2IB0 A;  5JKM A;  4ETR A;  3R2R A;  1DPS A;  1YUX A;  4M33 A;  2C2J A;  5GU2 X;  3BKN A;  4W4K B;  2JD7 0;  3WNW A;  3C1Y A;  2WLA A;  4A25 A;  1QGH A;  4CVT A;  4TOG A;  4KVQ A;  3TA8 A;  3Q4N A;  1Z6O A;  5D8O A;  4YXM A;  3PW1 B;  3Q4R A;  5D8Q A;  2YJJ A;  3PWQ C;  1ZUJ A;  3RE7 A;  1NF4 A;  2CHP A;  3QHB A;  1VEQ A;  3KA8 A;  1GWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...