3EGMA

Structural basis of iron transport gating in helicobacter pylori ferritin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
172
structure length
172
Chain Sequence
HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin
publication title The crystal structure of ferritin from Helicobacter pylori reveals unusual conformational changes for iron uptake.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 79
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3egmA00
3QZ3A 4TOEA 1JREA 5JKMA 1NF4A 3RBCA 2BKCA 1VEQA 3E1OA 3QHBA 3WNWA 3NP0X 4M35A 2ZA7A 4DE6A 2V15A 4A25A 1KRQA 2FKZA 4ETRA 4TO9A 2X170 1Z6OM 5FFDA 4OYNA 2BJYA 4Y08A 4M33A 3F32A 4CVSA 4LQNA 3SE1A 3QD8A 5IX6A 5GU1X 1SQ3A 1LB3A 3E1LA 2FJCA 1MOJA 2HTNA 3IS8A 1YUXA 1LKPA 2V2JA 2FHAA 5J93A 3AJOA 1HRSA 1RCDA 3A9QA 1RCIA 2Z90A 4RC5A 5HJHA 1F30A 1SOFA 2VXXA 3Q4QA 2Y3QA 4TOFA 2VZBA 1LKOA 3UNOA 2V2PA 2XKQA 2GYDA 4CVPA 5GU0X 3BT5A 3GE4A 2JD60 3R2SA 3ES3A 1RCCA 1ZS3A 2V2SA 2FZFA 2IU2A 3AK8A 5D8RA 3PWQC 4MN9A 2C2JA 3GVYA 5D8OA 2V2RA 5GN8A 3PWFA 2G4HA 3R2HA 5E2DA 4II4A 2XJNA 2CN7A 4TOAA 4EVCA 1VEIA 3ISFA 4RC5B 1NF6A 4ZL6A 4MJYA 1JI4A 1UVHA 3R2KA 4TOGA 2FG8A 1QGHA 4DYXA 4DYUA 1DVBA 4ITTA 1S30A 3A68A 1S2ZA 5D8PA 1BFRA 3F38A 4KVQA 4PGKA 2W0OA 3AF7X 2IB0A 4IXKA 4RC7A 3Q4OA 1B71A 5GN8B 1JI5A 3FVBA 1XZ1A 1L8HA 4TOHA 2V2MA 1XZ3A 3SHXA 1TKOA 3ERZA 3PW8A 2C41A 5K52A 4DZ0A 4U3GA 2GYQA 1BG7A 2C2UA 2V2LA 4ML5A 4LPMA 1NNQA 2GS4A 3R2LA 3PW1B 3SIDA 1QYBA 2V2OA 3RE7A 4IWJA 3KA9A 5CMQA 4ZKXA 2CN6A 5LBHA 4TW3A 1GWGA 4DYZA 1TJOA 1JIGA 3WVWA 1L8IA 3QVDA 3KA6A 4EVEA 2ZG7X 3QB9A 4ZJKA 1S3QA 5D8XA 2WLAA 1YV1A 4ZKWA 3AJPA 4ZL5A 3KX9A 3O7RA 3RD0A 4CVRA 1Z4AA 3HL1A 4XKSA 3Q4NA 1TKPA 5J8WA 1VELA 1JTSA 1AEWA 4P18A 3EZ0A 3RAVA 4REUA 4RC6A 4ZKHA 4LYXA 3OGHA 4Z3BA 5CMRA 5I4JA 2XJMA 5GU2X 3KA4A 4KVRA 3PVRA 1YUZA 1VLGA 2CEIA 5E1UA 3KWOA 3Q4RA 4DASA 3BVEA 3F33A 4Z5SA 4TODA 3AF8X 3E1PA 1BCFA 2HR5A 3RGDA 3HIUA 3NP2X 3PVYA 4IWKA 1JKUA 4ZMCA 2JD70 4ISMA 2OH3A 2YJJA 4LQJA 2CIHA 2XJOA 1IESA 4CYBA 2ZA6A 1H96A 5LS9A 3BVLA 3E2CA 2CHPA 4CYAA 3IQ1A 4ISPA 3OJ5A 4RC6B 2ITBA 4EVBA 1JKVA 3E6RA 5AXSA 5J8SA 5HJFA 1RYTA 2ZURX 4PGIA 3E6SA 3PWQA 3EZUA 4MKUA 2OC5A 2Z6MA 3IS7A 3PVRB 3E1NA 4M34A 3H7GA 5LG2A 3F35A 2QF9A 3AF9X 4EVDA 3WVVA 4RC8A 3UOFA 3KXUA 2JD80 4YKHA 2IY4A 4II4B 3PVYB 3TA8A 1R03A 4PG1A 5JKLA 2QQYA 4DYYA 2Z5PA 2FL0A 4XKTA 5C6FA 4M32A 4MUDA 3NOZX 3KA8A 1F33A 5FEJA 5JKLG 4TOCA 1LKMA 1RCEA 2ZA8A 2UX1A 5GOUA 3MPSA 1RCGA 4ITWA 5HQOA 5JKMG 1DPSA 4TOBA 5K53A 2FG4A 4CMYV 5J9VA 3BKNA 4CY9A 4MY7A 4AM5A 1IERA 2CLBA 2YW7A 3GHQA 5ERJA 3F37A 3AJQA 2WTLA 2CF7A 3E1JA 4RC7B 2CLUA 3EGMA 3F36A 3R2MA 1FHAA 3WVUA 1JGCA 3SH6A 2ZG8X 1O9RA 3VNXA 5D8QA 2WLUA 4ZLWA 2PYBA 4DI0A 5D8SA 3QHCA 4ERUA 2BW1A 4LQVA 5ERKA 2C2FA 1Z6OA 1JYBA 4XGSA 3F39A 4AM4A 3PVTA 1TK6A 3O7SA 3FI6A 5JACA 3BVIA 3E1QA 4LQHA 4LYUA 3BVFA 1N1QA 5FFEA 1ZUJA 5D8YA 3E1MA 1UMNA 2CHIA 4CVTA 5FFCA 5GU3X 3R2OA 2FFXJ 3U90A 3T9JA 1OTKA 3ISEA 2C6RA 1J30A 1MFRA 2Z5RA 1DATA 1O9IA 2XGWA 2YJKA 2V2IA 1EUMA 4AM2A 2Z5QA 5FFAA 2D5KA 4ZTTA 5CZUA 3PW8C 4LPNA 3UOIA 2VXIA 2RBDA 2YW6A 3PW1A 4E6KA 4LPJA 2BK6A 3F34A 2F7NA 3PVTB 4QUWA 3PZAA 3BVKA 3FSEA 2ZG9X 4CMYA 3R2RA 1VJXA 4XKUA 5LG8A 2V2NA 3KA3A 5FFBA 1NFVA 4KVSA 4PG0A 3AK9A 4R42A
chains in the Genus database with same CATH superfamily
3QZ3A 4TOEA 1JREA 5JKMA 1NF4A 3RBCA 2BKCA 1VEQA 3E1OA 3QHBA 3WNWA 3NP0X 4M35A 2ZA7A 4DE6A 2V15A 4A25A 1KRQA 2FKZA 4ETRA 4TO9A 2AR0A 2X170 1Z6OM 5FFDA 4OYNA 2BJYA 5JDOB 4Y08A 4M33A 3F32A 4CVSA 3FRSA 4LQNA 2G38B 3SE1A 3QD8A 5IX6A 5GU1X 1SQ3A 1LB3A 3E1LA 2FJCA 4YVZA 1MOJA 2HTNA 3IS8A 1YUXA 1LKPA 2V2JA 2FHAA 5J93A 3AJOA 3KHKA 1HRSA 1RCDA 3A9QA 1RCIA 2Z90A 4RC5A 5HJHA 1F30A 1SOFA 2VXXA 3Q4QA 2Y3QA 4TOFA 2VZBA 1LKOA 3UNOA 2V2PA 2XKQA 2GYDA 4CVPA 5GU0X 3BT5A 3GE4A 2JD60 3R2SA 3ES3A 1RCCA 1ZS3A 2V2SA 2FZFA 2IU2A 3AK8A 5D8RA 3PWQC 4MN9A 4X0JA 2C2JA 3GVYA 5D8OA 2V2RA 5GN8A 3PWFA 2G4HA 3VVAA 3R2HA 5E2DA 4II4A 2XJNA 2CN7A 4TOAA 4WJG4 4EVCA 1VEIA 3ISFA 4RC5B 1NF6A 4ZL6A 4MJYA 1JI4A 1UVHA 3R2KA 4TOGA 2FG8A 1QGHA 4DYXA 4DYUA 1DVBA 4ITTA 2MGYA 1S30A 3A68A 1S2ZA 2V8UA 5D8PA 1BFRA 4E40A 3F38A 4KVQA 4PGKA 2W0OA 3AF7X 3C1YA 2IB0A 2WWXB 4IXKA 4RC7A 2CWLA 3Q4OA 1B71A 5GN8B 1JI5A 3FVBA 1XZ1A 1L8HA 4TOHA 2V2MA 1XZ3A 3SHXA 1TKOA 3ERZA 3PW8A 2C41A 5K52A 4DZ0A 3C1ZA 3M6JA 4U3GA 2GYQA 1BG7A 2C2UA 2V2LA 3V3KB 3GGZA 4ML5A 4LPMA 1NNQA 2GS4A 3R2LA 3PW1B 3SIDA 1QYBA 2N02A 2V2OA 3RE7A 4IWJA 3KA9A 5CMQA 4ZKXA 2CN6A 5LBHA 4TW3A 2OKCA 1GWGA 4DYZA 1TJOA 4YXMA 1JIGA 3WVWA 1L8IA 3QVDA 3KA6A 4EVEA 2ZG7X 3QB9A 4ZJKA 1S3QA 5D8XA 2WLAA 1YV1A 4ZKWA 4KXRB 3AJPA 4ZL5A 3KX9A 3O7RA 3RD0A 4CVRA 1Z4AA 3HL1A 4XKSA 3Q4NA 1TKPA 5J8WA 1VELA 1JTSA 1AEWA 4P18A 3EZ0A 3RAVA 4REUA 4RC6A 4ZKHA 4LYXA 3OGHA 4Z3BA 5CMRA 5I4JA 2XJMA 5GU2X 3KA4A 4KVRA 3PVRA 1YUZA 1VLGA 2CEIA 5E1UA 3KWOA 3W54A 3Q4RA 3JZ9A 4DASA 3JZAB 3BVEA 3F33A 4Z5SA 4TODA 3AF8X 3E1PA 3N6OA 1BCFA 2HR5A 3C23A 3KDQA 3RGDA 3HIUA 3NP2X 3FRRA 3PVYA 4IWKA 1JKUA 4ZMCA 2JD70 4ISMA 2OH3A 2YJJA 4LQJA 2CIHA 2XJOA 1IESA 4CYBA 2ZA6A 1H96A 5LS9A 3BVLA 3E2CA 2CHPA 4CYAA 3IQ1A 4ISPA 3OJ5A 4RC6B 2ITBA 4EVBA 1JKVA 3E6RA 5AXSA 5J8SA 5HJFA 1RYTA 2ZURX 4PGIA 3E6SA 3PWQA 5JDOA 3EZUA 4MKUA 2OC5A 2Z6MA 3IS7A 3PVRB 3E1NA 4M34A 3GGYA 3H7GA 5LG2A 3F35A 2QF9A 3AF9X 4EVDA 3WVVA 4RC8A 3UOFA 3KXUA 2JD80 4YKHA 2IY4A 4II4B 3PVYB 3TA8A 1R03A 4PG1A 5JKLA 2QQYA 4DYYA 2Z5PA 2FL0A 4XKTA 5C6FA 4M32A 4MUDA 3NOZX 3KA8A 1F33A 5FEJA 5JKLG 4TOCA 1LKMA 1RCEA 2ZA8A 2UX1A 5GOUA 3MPSA 1RCGA 4ITWA 5HQOA 5JKMG 1DPSA 4TOBA 5K53A 2FG4A 4CMYV 5J9VA 3BKNA 4CY9A 4MY7A 4AM5A 1IERA 2CLBA 2YW7A 3GHQA 5ERJA 3F37A 3AJQA 2WTLA 2CF7A 3E1JA 4RC7B 2CLUA 3EGMA 3F36A 3R2MA 1FHAA 3WVUA 1JGCA 3SH6A 2ZG8X 1O9RA 3VNXA 5D8QA 2WLUA 3UFBA 4ZLWA 2PYBA 5HU6D 4DI0A 5D8SA 3QHCA 4ERUA 2BW1A 4W4KB 2V8TA 4LQVA 5ERKA 2C2FA 1Z6OA 1JYBA 4XGSA 3F39A 4AM4A 3PVTA 1TK6A 3DBYA 3O7SA 3FI6A 5JACA 3BVIA 3E1QA 4LQHA 4LYUA 3BVFA 1N1QA 5FFEA 1ZUJA 3VV9A 5D8YA 3E1MA 1UMNA 2CHIA 4CVTA 5FFCA 5GU3X 3R2OA 2FFXJ 4MXPA 3D19A 3U90A 3T9JA 1OTKA 3ISEA 2C6RA 1J30A 1MFRA 2Z5RA 1DATA 1O9IA 2XGWA 2Y44A 2YJKA 2V2IA 1EUMA 4W4LB 4AM2A 2Z5QA 5FFAA 2D5KA 4ZTTA 5CZUA 3PW8C 4LPNA 3UOIA 2VXIA 2RBDA 2YW6A 3PW1A 4E6KA 4LPJA 2BK6A 3F34A 2F7NA 3PVTB 4QUWA 3PZAA 3BVKA 3C21A 3FSEA 2ZG9X 4CMYA 3R2RA 4YXJA 1VJXA 4XKUA 5LG8A 3L0MA 2V2NA 3KA3A 5FFBA 1NFVA 4KVSA 4PG0A 3LKDA 3AK9A 4R42A
chains in the Genus database with same CATH topology
3QZ3A 4TOEA 1JREA 5JKMA 1NF4A 3RBCA 2BKCA 1VEQA 3E1OA 3QHBA 3WNWA 3NP0X 4M35A 2ZA7A 4DE6A 2V15A 4A25A 1KRQA 2FKZA 4ETRA 4TO9A 2AR0A 2X170 1Z6OM 5FFDA 4OYNA 2BJYA 5JDOB 4Y08A 4M33A 3F32A 4CVSA 3FRSA 4LQNA 2G38B 3SE1A 3QD8A 5IX6A 5GU1X 1SQ3A 1LB3A 3E1LA 2FJCA 4YVZA 1MOJA 2HTNA 3IS8A 1YUXA 1LKPA 2V2JA 2FHAA 5J93A 3AJOA 3KHKA 1HRSA 1RCDA 3A9QA 1RCIA 2Z90A 4RC5A 5HJHA 1F30A 1SOFA 2VXXA 3Q4QA 2Y3QA 4TOFA 2VZBA 1LKOA 3UNOA 2V2PA 2XKQA 2GYDA 4CVPA 5GU0X 3BT5A 3GE4A 2JD60 3R2SA 3ES3A 1RCCA 1ZS3A 2V2SA 2FZFA 2IU2A 3AK8A 5D8RA 3PWQC 4MN9A 4X0JA 2C2JA 3GVYA 5D8OA 2V2RA 5GN8A 3PWFA 2G4HA 3VVAA 3R2HA 5E2DA 4II4A 2XJNA 2CN7A 4TOAA 4WJG4 4EVCA 1VEIA 3ISFA 4RC5B 1NF6A 4ZL6A 4MJYA 1JI4A 1UVHA 3R2KA 4TOGA 2FG8A 1QGHA 4DYXA 4DYUA 1DVBA 4ITTA 2MGYA 1S30A 3A68A 1S2ZA 2V8UA 5D8PA 1BFRA 4E40A 3F38A 4KVQA 4PGKA 2W0OA 3AF7X 3C1YA 2IB0A 2WWXB 4IXKA 4RC7A 2CWLA 3Q4OA 1B71A 5GN8B 1JI5A 3FVBA 1XZ1A 1L8HA 4TOHA 2V2MA 1XZ3A 3SHXA 1TKOA 3ERZA 3PW8A 2C41A 5K52A 4DZ0A 3C1ZA 3M6JA 4U3GA 2GYQA 1BG7A 2C2UA 2V2LA 3V3KB 3GGZA 4ML5A 4LPMA 1NNQA 2GS4A 3R2LA 3PW1B 3SIDA 1QYBA 2N02A 2V2OA 3RE7A 4IWJA 3KA9A 5CMQA 4ZKXA 2CN6A 5LBHA 4TW3A 2OKCA 1GWGA 4DYZA 1TJOA 4YXMA 1JIGA 3WVWA 1L8IA 3QVDA 3KA6A 4EVEA 2ZG7X 3QB9A 4ZJKA 1S3QA 5D8XA 2WLAA 1YV1A 4ZKWA 4KXRB 3AJPA 4ZL5A 3KX9A 3O7RA 3RD0A 4CVRA 1Z4AA 3HL1A 4XKSA 3Q4NA 1TKPA 5J8WA 1VELA 1JTSA 1AEWA 4P18A 3EZ0A 3RAVA 4REUA 4RC6A 4ZKHA 4LYXA 3OGHA 4Z3BA 5CMRA 5I4JA 2XJMA 5GU2X 3KA4A 4KVRA 3PVRA 1YUZA 1VLGA 2CEIA 5E1UA 3KWOA 3W54A 3Q4RA 3JZ9A 4DASA 3JZAB 3BVEA 3F33A 4Z5SA 4TODA 3AF8X 3E1PA 3N6OA 1BCFA 2HR5A 3C23A 3KDQA 3RGDA 3HIUA 3NP2X 3FRRA 3PVYA 4IWKA 1JKUA 4ZMCA 2JD70 4ISMA 2OH3A 2YJJA 4LQJA 2CIHA 2XJOA 1IESA 4CYBA 2ZA6A 1H96A 5LS9A 3BVLA 3E2CA 2CHPA 4CYAA 3IQ1A 4ISPA 3OJ5A 4RC6B 2ITBA 4EVBA 1JKVA 3E6RA 5AXSA 5J8SA 5HJFA 1RYTA 2ZURX 4PGIA 3E6SA 3PWQA 5JDOA 3EZUA 4MKUA 2OC5A 2Z6MA 3IS7A 3PVRB 3E1NA 4M34A 3GGYA 3H7GA 5LG2A 3F35A 2QF9A 3AF9X 4EVDA 3WVVA 4RC8A 3UOFA 3KXUA 2JD80 4YKHA 2IY4A 4II4B 3PVYB 3TA8A 1R03A 4PG1A 5JKLA 2QQYA 4DYYA 2Z5PA 2FL0A 4XKTA 5C6FA 4M32A 4MUDA 3NOZX 3KA8A 1F33A 5FEJA 5JKLG 4TOCA 1LKMA 1RCEA 2ZA8A 2UX1A 5GOUA 3MPSA 1RCGA 4ITWA 5HQOA 5JKMG 1DPSA 4TOBA 5K53A 2FG4A 4CMYV 5J9VA 3BKNA 4CY9A 4MY7A 4AM5A 1IERA 2CLBA 2YW7A 3GHQA 5ERJA 3F37A 3AJQA 2WTLA 2CF7A 3E1JA 4RC7B 2CLUA 3EGMA 3F36A 3R2MA 1FHAA 3WVUA 1JGCA 3SH6A 2ZG8X 1O9RA 3VNXA 5D8QA 2WLUA 3UFBA 4ZLWA 2PYBA 5HU6D 4DI0A 5D8SA 3QHCA 4ERUA 2BW1A 4W4KB 2V8TA 4LQVA 5ERKA 2C2FA 1Z6OA 1JYBA 4XGSA 3F39A 4AM4A 3PVTA 1TK6A 3DBYA 3O7SA 3FI6A 5JACA 3BVIA 3E1QA 4LQHA 4LYUA 3BVFA 1N1QA 5FFEA 1ZUJA 3VV9A 5D8YA 3E1MA 1UMNA 2CHIA 4CVTA 5FFCA 5GU3X 3R2OA 2FFXJ 4MXPA 3D19A 3U90A 3T9JA 1OTKA 3ISEA 2C6RA 1J30A 1MFRA 2Z5RA 1DATA 1O9IA 2XGWA 2Y44A 2YJKA 2V2IA 1EUMA 4W4LB 4AM2A 2Z5QA 5FFAA 2D5KA 4ZTTA 5CZUA 3PW8C 4LPNA 3UOIA 2VXIA 2RBDA 2YW6A 3PW1A 4E6KA 4LPJA 2BK6A 3F34A 2F7NA 3PVTB 4QUWA 3PZAA 3BVKA 3C21A 3FSEA 2ZG9X 4CMYA 3R2RA 4YXJA 1VJXA 4XKUA 5LG8A 3L0MA 2V2NA 3KA3A 5FFBA 1NFVA 4KVSA 4PG0A 3LKDA 3AK9A 4R42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ3 A;  4TOE A;  1JRE A;  5JKM A;  1NF4 A;  3RBC A;  2BKC A;  1VEQ A;  3E1O A;  3QHB A;  3WNW A;  3NP0 X;  4M35 A;  2ZA7 A;  4DE6 A;  2V15 A;  4A25 A;  1KRQ A;  2FKZ A;  4ETR A;  4TO9 A;  2X17 0;  1Z6O M;  5FFD A;  4OYN A;  2BJY A;  4Y08 A;  4M33 A;  3F32 A;  4CVS A;  4LQN A;  3SE1 A;  3QD8 A;  5IX6 A;  5GU1 X;  1SQ3 A;  1LB3 A;  3E1L A;  2FJC A;  1MOJ A;  2HTN A;  3IS8 A;  1YUX A;  1LKP A;  2V2J A;  2FHA A;  5J93 A;  3AJO A;  1HRS A;  1RCD A;  3A9Q A;  1RCI A;  2Z90 A;  4RC5 A;  5HJH A;  1F30 A;  1SOF A;  2VXX A;  3Q4Q A;  2Y3Q A;  4TOF A;  2VZB A;  1LKO A;  3UNO A;  2V2P A;  2XKQ A;  2GYD A;  4CVP A;  5GU0 X;  3BT5 A;  3GE4 A;  2JD6 0;  3R2S A;  3ES3 A;  1RCC A;  1ZS3 A;  2V2S A;  2FZF A;  2IU2 A;  3AK8 A;  5D8R A;  3PWQ C;  4MN9 A;  2C2J A;  3GVY A;  5D8O A;  2V2R A;  5GN8 A;  3PWF A;  2G4H A;  3R2H A;  5E2D A;  4II4 A;  2XJN A;  2CN7 A;  4TOA A;  4EVC A;  1VEI A;  3ISF A;  4RC5 B;  1NF6 A;  4ZL6 A;  4MJY A;  1JI4 A;  1UVH A;  3R2K A;  4TOG A;  2FG8 A;  1QGH A;  4DYX A;  4DYU A;  1DVB A;  4ITT A;  1S30 A;  3A68 A;  1S2Z A;  5D8P A;  1BFR A;  3F38 A;  4KVQ A;  4PGK A;  2W0O A;  3AF7 X;  2IB0 A;  4IXK A;  4RC7 A;  3Q4O A;  1B71 A;  5GN8 B;  1JI5 A;  3FVB A;  1XZ1 A;  1L8H A;  4TOH A;  2V2M A;  1XZ3 A;  3SHX A;  1TKO A;  3ERZ A;  3PW8 A;  2C41 A;  5K52 A;  4DZ0 A;  4U3G A;  2GYQ A;  1BG7 A;  2C2U A;  2V2L A;  4ML5 A;  4LPM A;  1NNQ A;  2GS4 A;  3R2L A;  3PW1 B;  3SID A;  1QYB A;  2V2O A;  3RE7 A;  4IWJ A;  3KA9 A;  5CMQ A;  4ZKX A;  2CN6 A;  5LBH A;  4TW3 A;  1GWG A;  4DYZ A;  1TJO A;  1JIG A;  3WVW A;  1L8I A;  3QVD A;  3KA6 A;  4EVE A;  2ZG7 X;  3QB9 A;  4ZJK A;  1S3Q A;  5D8X A;  2WLA A;  1YV1 A;  4ZKW A;  3AJP A;  4ZL5 A;  3KX9 A;  3O7R A;  3RD0 A;  4CVR A;  1Z4A A;  3HL1 A;  4XKS A;  3Q4N A;  1TKP A;  5J8W A;  1VEL A;  1JTS A;  1AEW A;  4P18 A;  3EZ0 A;  3RAV A;  4REU A;  4RC6 A;  4ZKH A;  4LYX A;  3OGH A;  4Z3B A;  5CMR A;  5I4J A;  2XJM A;  5GU2 X;  3KA4 A;  4KVR A;  3PVR A;  1YUZ A;  1VLG A;  2CEI A;  5E1U A;  3KWO A;  3Q4R A;  4DAS A;  3BVE A;  3F33 A;  4Z5S A;  4TOD A;  3AF8 X;  3E1P A;  1BCF A;  2HR5 A;  3RGD A;  3HIU A;  3NP2 X;  3PVY A;  4IWK A;  1JKU A;  4ZMC A;  2JD7 0;  4ISM A;  2OH3 A;  2YJJ A;  4LQJ A;  2CIH A;  2XJO A;  1IES A;  4CYB A;  2ZA6 A;  1H96 A;  5LS9 A;  3BVL A;  3E2C A;  2CHP A;  4CYA A;  3IQ1 A;  4ISP A;  3OJ5 A;  4RC6 B;  2ITB A;  4EVB A;  1JKV A;  3E6R A;  5AXS A;  5J8S A;  5HJF A;  1RYT A;  2ZUR X;  4PGI A;  3E6S A;  3PWQ A;  3EZU A;  4MKU A;  2OC5 A;  2Z6M A;  3IS7 A;  3PVR B;  3E1N A;  4M34 A;  3H7G A;  5LG2 A;  3F35 A;  2QF9 A;  3AF9 X;  4EVD A;  3WVV A;  4RC8 A;  3UOF A;  3KXU A;  2JD8 0;  4YKH A;  2IY4 A;  4II4 B;  3PVY B;  3TA8 A;  1R03 A;  4PG1 A;  5JKL A;  2QQY A;  4DYY A;  2Z5P A;  2FL0 A;  4XKT A;  5C6F A;  4M32 A;  4MUD A;  3NOZ X;  3KA8 A;  1F33 A;  5FEJ A;  5JKL G;  4TOC A;  1LKM A;  1RCE A;  2ZA8 A;  2UX1 A;  5GOU A;  3MPS A;  1RCG A;  4ITW A;  5HQO A;  5JKM G;  1DPS A;  4TOB A;  5K53 A;  2FG4 A;  4CMY V;  5J9V A;  3BKN A;  4CY9 A;  4MY7 A;  4AM5 A;  1IER A;  2CLB A;  2YW7 A;  3GHQ A;  5ERJ A;  3F37 A;  3AJQ A;  2WTL A;  2CF7 A;  3E1J A;  4RC7 B;  2CLU A;  3EGM A;  3F36 A;  3R2M A;  1FHA A;  3WVU A;  1JGC A;  3SH6 A;  2ZG8 X;  1O9R A;  3VNX A;  5D8Q A;  2WLU A;  4ZLW A;  2PYB A;  4DI0 A;  5D8S A;  3QHC A;  4ERU A;  2BW1 A;  4LQV A;  5ERK A;  2C2F A;  1Z6O A;  1JYB A;  4XGS A;  3F39 A;  4AM4 A;  3PVT A;  1TK6 A;  3O7S A;  3FI6 A;  5JAC A;  3BVI A;  3E1Q A;  4LQH A;  4LYU A;  3BVF A;  1N1Q A;  5FFE A;  1ZUJ A;  5D8Y A;  3E1M A;  1UMN A;  2CHI A;  4CVT A;  5FFC A;  5GU3 X;  3R2O A;  2FFX J;  3U90 A;  3T9J A;  1OTK A;  3ISE A;  2C6R A;  1J30 A;  1MFR A;  2Z5R A;  1DAT A;  1O9I A;  2XGW A;  2YJK A;  2V2I A;  1EUM A;  4AM2 A;  2Z5Q A;  5FFA A;  2D5K A;  4ZTT A;  5CZU A;  3PW8 C;  4LPN A;  3UOI A;  2VXI A;  2RBD A;  2YW6 A;  3PW1 A;  4E6K A;  4LPJ A;  2BK6 A;  3F34 A;  2F7N A;  3PVT B;  4QUW A;  3PZA A;  3BVK A;  3FSE A;  2ZG9 X;  4CMY A;  3R2R A;  1VJX A;  4XKU A;  5LG8 A;  2V2N A;  3KA3 A;  5FFB A;  1NFV A;  4KVS A;  4PG0 A;  3AK9 A;  4R42 A; 
#chains in the Genus database with same CATH topology
 3QZ3 A;  4TOE A;  1JRE A;  5JKM A;  1NF4 A;  3RBC A;  2BKC A;  1VEQ A;  3E1O A;  3QHB A;  3WNW A;  3NP0 X;  4M35 A;  2ZA7 A;  4DE6 A;  2V15 A;  4A25 A;  1KRQ A;  2FKZ A;  4ETR A;  4TO9 A;  2AR0 A;  2X17 0;  1Z6O M;  5FFD A;  4OYN A;  2BJY A;  5JDO B;  4Y08 A;  4M33 A;  3F32 A;  4CVS A;  3FRS A;  4LQN A;  2G38 B;  3SE1 A;  3QD8 A;  5IX6 A;  5GU1 X;  1SQ3 A;  1LB3 A;  3E1L A;  2FJC A;  4YVZ A;  1MOJ A;  2HTN A;  3IS8 A;  1YUX A;  1LKP A;  2V2J A;  2FHA A;  5J93 A;  3AJO A;  3KHK A;  1HRS A;  1RCD A;  3A9Q A;  1RCI A;  2Z90 A;  4RC5 A;  5HJH A;  1F30 A;  1SOF A;  2VXX A;  3Q4Q A;  2Y3Q A;  4TOF A;  2VZB A;  1LKO A;  3UNO A;  2V2P A;  2XKQ A;  2GYD A;  4CVP A;  5GU0 X;  3BT5 A;  3GE4 A;  2JD6 0;  3R2S A;  3ES3 A;  1RCC A;  1ZS3 A;  2V2S A;  2FZF A;  2IU2 A;  3AK8 A;  5D8R A;  3PWQ C;  4MN9 A;  4X0J A;  2C2J A;  3GVY A;  5D8O A;  2V2R A;  5GN8 A;  3PWF A;  2G4H A;  3VVA A;  3R2H A;  5E2D A;  4II4 A;  2XJN A;  2CN7 A;  4TOA A;  4WJG 4;  4EVC A;  1VEI A;  3ISF A;  4RC5 B;  1NF6 A;  4ZL6 A;  4MJY A;  1JI4 A;  1UVH A;  3R2K A;  4TOG A;  2FG8 A;  1QGH A;  4DYX A;  4DYU A;  1DVB A;  4ITT A;  2MGY A;  1S30 A;  3A68 A;  1S2Z A;  2V8U A;  5D8P A;  1BFR A;  4E40 A;  3F38 A;  4KVQ A;  4PGK A;  2W0O A;  3AF7 X;  3C1Y A;  2IB0 A;  2WWX B;  4IXK A;  4RC7 A;  2CWL A;  3Q4O A;  1B71 A;  5GN8 B;  1JI5 A;  3FVB A;  1XZ1 A;  1L8H A;  4TOH A;  2V2M A;  1XZ3 A;  3SHX A;  1TKO A;  3ERZ A;  3PW8 A;  2C41 A;  5K52 A;  4DZ0 A;  3C1Z A;  3M6J A;  4U3G A;  2GYQ A;  1BG7 A;  2C2U A;  2V2L A;  3V3K B;  3GGZ A;  4ML5 A;  4LPM A;  1NNQ A;  2GS4 A;  3R2L A;  3PW1 B;  3SID A;  1QYB A;  2N02 A;  2V2O A;  3RE7 A;  4IWJ A;  3KA9 A;  5CMQ A;  4ZKX A;  2CN6 A;  5LBH A;  4TW3 A;  2OKC A;  1GWG A;  4DYZ A;  1TJO A;  4YXM A;  1JIG A;  3WVW A;  1L8I A;  3QVD A;  3KA6 A;  4EVE A;  2ZG7 X;  3QB9 A;  4ZJK A;  1S3Q A;  5D8X A;  2WLA A;  1YV1 A;  4ZKW A;  4KXR B;  3AJP A;  4ZL5 A;  3KX9 A;  3O7R A;  3RD0 A;  4CVR A;  1Z4A A;  3HL1 A;  4XKS A;  3Q4N A;  1TKP A;  5J8W A;  1VEL A;  1JTS A;  1AEW A;  4P18 A;  3EZ0 A;  3RAV A;  4REU A;  4RC6 A;  4ZKH A;  4LYX A;  3OGH A;  4Z3B A;  5CMR A;  5I4J A;  2XJM A;  5GU2 X;  3KA4 A;  4KVR A;  3PVR A;  1YUZ A;  1VLG A;  2CEI A;  5E1U A;  3KWO A;  3W54 A;  3Q4R A;  3JZ9 A;  4DAS A;  3JZA B;  3BVE A;  3F33 A;  4Z5S A;  4TOD A;  3AF8 X;  3E1P A;  3N6O A;  1BCF A;  2HR5 A;  3C23 A;  3KDQ A;  3RGD A;  3HIU A;  3NP2 X;  3FRR A;  3PVY A;  4IWK A;  1JKU A;  4ZMC A;  2JD7 0;  4ISM A;  2OH3 A;  2YJJ A;  4LQJ A;  2CIH A;  2XJO A;  1IES A;  4CYB A;  2ZA6 A;  1H96 A;  5LS9 A;  3BVL A;  3E2C A;  2CHP A;  4CYA A;  3IQ1 A;  4ISP A;  3OJ5 A;  4RC6 B;  2ITB A;  4EVB A;  1JKV A;  3E6R A;  5AXS A;  5J8S A;  5HJF A;  1RYT A;  2ZUR X;  4PGI A;  3E6S A;  3PWQ A;  5JDO A;  3EZU A;  4MKU A;  2OC5 A;  2Z6M A;  3IS7 A;  3PVR B;  3E1N A;  4M34 A;  3GGY A;  3H7G A;  5LG2 A;  3F35 A;  2QF9 A;  3AF9 X;  4EVD A;  3WVV A;  4RC8 A;  3UOF A;  3KXU A;  2JD8 0;  4YKH A;  2IY4 A;  4II4 B;  3PVY B;  3TA8 A;  1R03 A;  4PG1 A;  5JKL A;  2QQY A;  4DYY A;  2Z5P A;  2FL0 A;  4XKT A;  5C6F A;  4M32 A;  4MUD A;  3NOZ X;  3KA8 A;  1F33 A;  5FEJ A;  5JKL G;  4TOC A;  1LKM A;  1RCE A;  2ZA8 A;  2UX1 A;  5GOU A;  3MPS A;  1RCG A;  4ITW A;  5HQO A;  5JKM G;  1DPS A;  4TOB A;  5K53 A;  2FG4 A;  4CMY V;  5J9V A;  3BKN A;  4CY9 A;  4MY7 A;  4AM5 A;  1IER A;  2CLB A;  2YW7 A;  3GHQ A;  5ERJ A;  3F37 A;  3AJQ A;  2WTL A;  2CF7 A;  3E1J A;  4RC7 B;  2CLU A;  3EGM A;  3F36 A;  3R2M A;  1FHA A;  3WVU A;  1JGC A;  3SH6 A;  2ZG8 X;  1O9R A;  3VNX A;  5D8Q A;  2WLU A;  3UFB A;  4ZLW A;  2PYB A;  5HU6 D;  4DI0 A;  5D8S A;  3QHC A;  4ERU A;  2BW1 A;  4W4K B;  2V8T A;  4LQV A;  5ERK A;  2C2F A;  1Z6O A;  1JYB A;  4XGS A;  3F39 A;  4AM4 A;  3PVT A;  1TK6 A;  3DBY A;  3O7S A;  3FI6 A;  5JAC A;  3BVI A;  3E1Q A;  4LQH A;  4LYU A;  3BVF A;  1N1Q A;  5FFE A;  1ZUJ A;  3VV9 A;  5D8Y A;  3E1M A;  1UMN A;  2CHI A;  4CVT A;  5FFC A;  5GU3 X;  3R2O A;  2FFX J;  4MXP A;  3D19 A;  3U90 A;  3T9J A;  1OTK A;  3ISE A;  2C6R A;  1J30 A;  1MFR A;  2Z5R A;  1DAT A;  1O9I A;  2XGW A;  2Y44 A;  2YJK A;  2V2I A;  1EUM A;  4W4L B;  4AM2 A;  2Z5Q A;  5FFA A;  2D5K A;  4ZTT A;  5CZU A;  3PW8 C;  4LPN A;  3UOI A;  2VXI A;  2RBD A;  2YW6 A;  3PW1 A;  4E6K A;  4LPJ A;  2BK6 A;  3F34 A;  2F7N A;  3PVT B;  4QUW A;  3PZA A;  3BVK A;  3C21 A;  3FSE A;  2ZG9 X;  4CMY A;  3R2R A;  4YXJ A;  1VJX A;  4XKU A;  5LG8 A;  3L0M A;  2V2N A;  3KA3 A;  5FFB A;  1NFV A;  4KVS A;  4PG0 A;  3LKD A;  3AK9 A;  4R42 A; 
#chains in the Genus database with same CATH homology
 3QZ3 A;  4TOE A;  1JRE A;  5JKM A;  1NF4 A;  3RBC A;  2BKC A;  1VEQ A;  3E1O A;  3QHB A;  3WNW A;  3NP0 X;  4M35 A;  2ZA7 A;  4DE6 A;  2V15 A;  4A25 A;  1KRQ A;  2FKZ A;  4ETR A;  4TO9 A;  2AR0 A;  2X17 0;  1Z6O M;  5FFD A;  4OYN A;  2BJY A;  5JDO B;  4Y08 A;  4M33 A;  3F32 A;  4CVS A;  3FRS A;  4LQN A;  2G38 B;  3SE1 A;  3QD8 A;  5IX6 A;  5GU1 X;  1SQ3 A;  1LB3 A;  3E1L A;  2FJC A;  4YVZ A;  1MOJ A;  2HTN A;  3IS8 A;  1YUX A;  1LKP A;  2V2J A;  2FHA A;  5J93 A;  3AJO A;  3KHK A;  1HRS A;  1RCD A;  3A9Q A;  1RCI A;  2Z90 A;  4RC5 A;  5HJH A;  1F30 A;  1SOF A;  2VXX A;  3Q4Q A;  2Y3Q A;  4TOF A;  2VZB A;  1LKO A;  3UNO A;  2V2P A;  2XKQ A;  2GYD A;  4CVP A;  5GU0 X;  3BT5 A;  3GE4 A;  2JD6 0;  3R2S A;  3ES3 A;  1RCC A;  1ZS3 A;  2V2S A;  2FZF A;  2IU2 A;  3AK8 A;  5D8R A;  3PWQ C;  4MN9 A;  4X0J A;  2C2J A;  3GVY A;  5D8O A;  2V2R A;  5GN8 A;  3PWF A;  2G4H A;  3VVA A;  3R2H A;  5E2D A;  4II4 A;  2XJN A;  2CN7 A;  4TOA A;  4WJG 4;  4EVC A;  1VEI A;  3ISF A;  4RC5 B;  1NF6 A;  4ZL6 A;  4MJY A;  1JI4 A;  1UVH A;  3R2K A;  4TOG A;  2FG8 A;  1QGH A;  4DYX A;  4DYU A;  1DVB A;  4ITT A;  2MGY A;  1S30 A;  3A68 A;  1S2Z A;  2V8U A;  5D8P A;  1BFR A;  4E40 A;  3F38 A;  4KVQ A;  4PGK A;  2W0O A;  3AF7 X;  3C1Y A;  2IB0 A;  2WWX B;  4IXK A;  4RC7 A;  2CWL A;  3Q4O A;  1B71 A;  5GN8 B;  1JI5 A;  3FVB A;  1XZ1 A;  1L8H A;  4TOH A;  2V2M A;  1XZ3 A;  3SHX A;  1TKO A;  3ERZ A;  3PW8 A;  2C41 A;  5K52 A;  4DZ0 A;  3C1Z A;  3M6J A;  4U3G A;  2GYQ A;  1BG7 A;  2C2U A;  2V2L A;  3V3K B;  3GGZ A;  4ML5 A;  4LPM A;  1NNQ A;  2GS4 A;  3R2L A;  3PW1 B;  3SID A;  1QYB A;  2N02 A;  2V2O A;  3RE7 A;  4IWJ A;  3KA9 A;  5CMQ A;  4ZKX A;  2CN6 A;  5LBH A;  4TW3 A;  2OKC A;  1GWG A;  4DYZ A;  1TJO A;  4YXM A;  1JIG A;  3WVW A;  1L8I A;  3QVD A;  3KA6 A;  4EVE A;  2ZG7 X;  3QB9 A;  4ZJK A;  1S3Q A;  5D8X A;  2WLA A;  1YV1 A;  4ZKW A;  4KXR B;  3AJP A;  4ZL5 A;  3KX9 A;  3O7R A;  3RD0 A;  4CVR A;  1Z4A A;  3HL1 A;  4XKS A;  3Q4N A;  1TKP A;  5J8W A;  1VEL A;  1JTS A;  1AEW A;  4P18 A;  3EZ0 A;  3RAV A;  4REU A;  4RC6 A;  4ZKH A;  4LYX A;  3OGH A;  4Z3B A;  5CMR A;  5I4J A;  2XJM A;  5GU2 X;  3KA4 A;  4KVR A;  3PVR A;  1YUZ A;  1VLG A;  2CEI A;  5E1U A;  3KWO A;  3W54 A;  3Q4R A;  3JZ9 A;  4DAS A;  3JZA B;  3BVE A;  3F33 A;  4Z5S A;  4TOD A;  3AF8 X;  3E1P A;  3N6O A;  1BCF A;  2HR5 A;  3C23 A;  3KDQ A;  3RGD A;  3HIU A;  3NP2 X;  3FRR A;  3PVY A;  4IWK A;  1JKU A;  4ZMC A;  2JD7 0;  4ISM A;  2OH3 A;  2YJJ A;  4LQJ A;  2CIH A;  2XJO A;  1IES A;  4CYB A;  2ZA6 A;  1H96 A;  5LS9 A;  3BVL A;  3E2C A;  2CHP A;  4CYA A;  3IQ1 A;  4ISP A;  3OJ5 A;  4RC6 B;  2ITB A;  4EVB A;  1JKV A;  3E6R A;  5AXS A;  5J8S A;  5HJF A;  1RYT A;  2ZUR X;  4PGI A;  3E6S A;  3PWQ A;  5JDO A;  3EZU A;  4MKU A;  2OC5 A;  2Z6M A;  3IS7 A;  3PVR B;  3E1N A;  4M34 A;  3GGY A;  3H7G A;  5LG2 A;  3F35 A;  2QF9 A;  3AF9 X;  4EVD A;  3WVV A;  4RC8 A;  3UOF A;  3KXU A;  2JD8 0;  4YKH A;  2IY4 A;  4II4 B;  3PVY B;  3TA8 A;  1R03 A;  4PG1 A;  5JKL A;  2QQY A;  4DYY A;  2Z5P A;  2FL0 A;  4XKT A;  5C6F A;  4M32 A;  4MUD A;  3NOZ X;  3KA8 A;  1F33 A;  5FEJ A;  5JKL G;  4TOC A;  1LKM A;  1RCE A;  2ZA8 A;  2UX1 A;  5GOU A;  3MPS A;  1RCG A;  4ITW A;  5HQO A;  5JKM G;  1DPS A;  4TOB A;  5K53 A;  2FG4 A;  4CMY V;  5J9V A;  3BKN A;  4CY9 A;  4MY7 A;  4AM5 A;  1IER A;  2CLB A;  2YW7 A;  3GHQ A;  5ERJ A;  3F37 A;  3AJQ A;  2WTL A;  2CF7 A;  3E1J A;  4RC7 B;  2CLU A;  3EGM A;  3F36 A;  3R2M A;  1FHA A;  3WVU A;  1JGC A;  3SH6 A;  2ZG8 X;  1O9R A;  3VNX A;  5D8Q A;  2WLU A;  3UFB A;  4ZLW A;  2PYB A;  5HU6 D;  4DI0 A;  5D8S A;  3QHC A;  4ERU A;  2BW1 A;  4W4K B;  2V8T A;  4LQV A;  5ERK A;  2C2F A;  1Z6O A;  1JYB A;  4XGS A;  3F39 A;  4AM4 A;  3PVT A;  1TK6 A;  3DBY A;  3O7S A;  3FI6 A;  5JAC A;  3BVI A;  3E1Q A;  4LQH A;  4LYU A;  3BVF A;  1N1Q A;  5FFE A;  1ZUJ A;  3VV9 A;  5D8Y A;  3E1M A;  1UMN A;  2CHI A;  4CVT A;  5FFC A;  5GU3 X;  3R2O A;  2FFX J;  4MXP A;  3D19 A;  3U90 A;  3T9J A;  1OTK A;  3ISE A;  2C6R A;  1J30 A;  1MFR A;  2Z5R A;  1DAT A;  1O9I A;  2XGW A;  2Y44 A;  2YJK A;  2V2I A;  1EUM A;  4W4L B;  4AM2 A;  2Z5Q A;  5FFA A;  2D5K A;  4ZTT A;  5CZU A;  3PW8 C;  4LPN A;  3UOI A;  2VXI A;  2RBD A;  2YW6 A;  3PW1 A;  4E6K A;  4LPJ A;  2BK6 A;  3F34 A;  2F7N A;  3PVT B;  4QUW A;  3PZA A;  3BVK A;  3C21 A;  3FSE A;  2ZG9 X;  4CMY A;  3R2R A;  4YXJ A;  1VJX A;  4XKU A;  5LG8 A;  3L0M A;  2V2N A;  3KA3 A;  5FFB A;  1NFV A;  4KVS A;  4PG0 A;  3LKD A;  3AK9 A;  4R42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...