3EGMA

Structural basis of iron transport gating in helicobacter pylori ferritin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
172
structure length
172
Chain Sequence
HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin
publication title The crystal structure of ferritin from Helicobacter pylori reveals unusual conformational changes for iron uptake.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 79
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3egmA00
5CMRA 4P18A 3ES3A 4ETRA 5LG2A 1ZS3A 3NP0X 4R42A 2ZG7X 3RGDA 4PGIA 1LKMA 1VEIA 3HIUA 3WNWA 1BG7A 4ISMA 2XJOA 2V2RA 4DYXA 1QGHA 3PVTB 3F38A 4DASA 4M34A 3FVBA 5I4JA 3WVUA 1NF4A 1VJXA 3BVIA 5D8SA 2JD60 2YW6A 2W0OA 3H7GA 3E2CA 2ZG9X 3PW8A 1RCCA 5K53A 2ITBA 3UOFA 3BVLA 4LQHA 4RC5A 2V15A 4ISPA 5HJHA 3PW8C 1JI5A 2Z5RA 3QHCA 5CMQA 3KX9A 3R2MA 4MJYA 5IX6A 1DPSA 4TOBA 4ZKHA 4CYBA 2G4HA 2V2NA 4EVCA 2QQYA 4MN9A 5HQOA 1DATA 1S2ZA 2CN7A 2V2SA 4REUA 4RC5B 1O9IA 5D8QA 4RC6A 3F39A 3RBCA 4IWKA 4TO9A 4ML5A 1HRSA 2ZA7A 1TK6A 4EVEA 2CHIA 3IQ1A 4AM4A 4Z5SA 4ZKXA 3KXUA 3SIDA 3PWQA 3GVYA 3F36A 4TOAA 3F35A 2V2OA 4DYZA 4RC6B 4AM2A 1F30A 1KRQA 3PWQC 2WLAA 2IU2A 4QUWA 2GS4A 2HTNA 2X170 4MY7A 4DE6A 1XZ1A 2BJYA 1LB3A 3A9QA 1LKPA 2XJMA 5FFEA 4DYUA 4U3GA 5GN8A 3QVDA 4LQVA 4TOHA 2IY4A 4ZTTA 2V2IA 1IESA 2CN6A 1RCGA 2CHPA 1F33A 2ZG8X 5GU0X 1MFRA 2BK6A 1AEWA 1LKOA 4ITWA 1Z6OM 1SQ3A 3UOIA 1JIGA 3SE1A 5ERJA 1ZUJA 3RD0A 5GN8B 3AJOA 4TOGA 2CEIA 3AJQA 1UMNA 1MOJA 3E1NA 3FSEA 5K52A 2VXXA 2Z5PA 3IS7A 3RE7A 4CVTA 4CYAA 2VXIA 5JKLG 3KA6A 3KA3A 4LPJA 2YJJA 1JYBA 2CIHA 1R03A 2VZBA 3QB9A 2Z90A 3Q4QA 1RYTA 1XZ3A 3BVEA 5FFBA 1TJOA 5J8WA 3OGHA 5J8SA 1N1QA 5AXSA 4E6KA 1QYBA 5JKLA 5LG8A 3O7RA 4PG1A 1TKOA 1JREA 3PWFA 3E1QA 1JI4A 3E6SA 1RCIA 4OYNA 3ERZA 1L8HA 3SHXA 2V2LA 2ZA6A 1RCEA 3QD8A 5J93A 2PYBA 2FKZA 5FFAA 3E1PA 1RCDA 1VEQA 4CVRA 3RAVA 3Q4OA 5D8YA 3E1LA 3R2HA 2C2FA 4IXKA 2QF9A 3AJPA 1B71A 4M35A 3TA8A 1YUZA 3PVYA 3A68A 4A25A 3R2RA 5D8OA 4XKUA 2UX1A 2YW7A 2BKCA 4LYUA 3F32A 5GU3X 3ISEA 4CVSA 1Z4AA 2JD80 4DI0A 1J30A 1YUXA 3MPSA 2FG8A 5E2DA 2CLUA 2FHAA 1FHAA 3F34A 2FG4A 3Q4NA 4XKTA 4YKHA 4DYYA 4M33A 2BW1A 3PVYB 4RC8A 4LQJA 4XGSA 1YV1A 3E1OA 3R2SA 2CF7A 3AK9A 3PZAA 1S30A 2FZFA 3Q4RA 2F7NA 1S3QA 4ZL6A 1VLGA 2WTLA 2OH3A 3R2LA 4TOEA 1JTSA 4TOCA 3HL1A 3PW1A 4EVBA 5ERKA 1O9RA 2FFXJ 3O7SA 1JKVA 3EGMA 3F37A 3VNXA 2Z6MA 1NFVA 1DVBA 5JACA 4Z3BA 5CZUA 2V2JA 4Y08A 2RBDA 2ZURX 5FFCA 4PG0A 4AM5A 3NOZX 3PW1B 3WVWA 4ZL5A 2D5KA 4KVSA 1EUMA 1IERA 3KWOA 4DZ0A 5HJFA 4ZMCA 4CMYV 3QZ3A 1L8IA 4IWJA 3PVRA 3AF9X 3U90A 2GYDA 4II4A 2V2PA 2HR5A 4MKUA 4ZLWA 2C2JA 1OTKA 3IS8A 1JKUA 4EVDA 3ISFA 3T9JA 1VELA 4ZKWA 2C41A 3KA8A 4LQNA 4LPMA 5LBHA 3BVKA 3E6RA 4KVQA 4TOFA 4KVRA 3OJ5A 5D8RA 3PVRB 4MUDA 4ZJKA 4CY9A 3KA9A 2FL0A 4II4B 5D8XA 2C2UA 3AF7X 3AK8A 5FFDA 3AF8X 4RC7A 3KA4A 2XKQA 2YJKA 1Z6OA 4XKSA 2Z5QA 2Y3QA 3UNOA 4CMYA 4ITTA 4TODA 5FEJA 2V2MA 5C6FA 2JD70 5J9VA 3QHBA 1UVHA 3GE4A 1BCFA 5GOUA 2CLBA 2XGWA 1TKPA 1JGCA 5LS9A 3SH6A 5GU2X 3F33A 2OC5A 4RC7B 4CVPA 5JKMG 3E1JA 4M32A 5GU1X 1H96A 3NP2X 3GHQA 3BKNA 3E1MA 3R2OA 3FI6A 3EZ0A 3R2KA 3BVFA 4ERUA 1NF6A 4PGKA 2GYQA 5E1UA 3EZUA 4LPNA 2ZA8A 5D8PA 2FJCA 2IB0A 2C6RA 3WVVA 1BFRA 1NNQA 5JKMA 1SOFA 4LYXA 3PVTA 2WLUA 2XJNA 1GWGA 4TW3A 3BT5A
chains in the Genus database with same CATH superfamily
2G38B 5CMRA 4P18A 3ES3A 4ETRA 5LG2A 1ZS3A 3NP0X 4R42A 2ZG7X 3RGDA 4PGIA 1LKMA 1VEIA 3HIUA 4W4LB 3WNWA 1BG7A 4ISMA 2XJOA 2V2RA 4DYXA 1QGHA 3PVTB 3L0MA 3F38A 4DASA 4M34A 3FVBA 5I4JA 3WVUA 1NF4A 1VJXA 3BVIA 5D8SA 2JD60 2YW6A 2W0OA 3H7GA 3E2CA 2ZG9X 3PW8A 1RCCA 5K53A 3D19A 2ITBA 3UOFA 3DBYA 3BVLA 4LQHA 4RC5A 2V15A 4ISPA 5HJHA 3PW8C 1JI5A 2Z5RA 3QHCA 2N02A 5CMQA 3KX9A 3R2MA 4MJYA 5IX6A 1DPSA 3GGZA 4TOBA 4ZKHA 4CYBA 2G4HA 2V2NA 4EVCA 2QQYA 2OKCA 4MN9A 5HQOA 1DATA 1S2ZA 2CN7A 2V2SA 4REUA 4RC5B 1O9IA 3C1ZA 5D8QA 4RC6A 3F39A 3RBCA 4IWKA 4TO9A 4ML5A 1HRSA 2ZA7A 1TK6A 4EVEA 2CHIA 3IQ1A 4AM4A 4Z5SA 4ZKXA 3KXUA 3SIDA 3PWQA 3GVYA 3F36A 4TOAA 3F35A 2V2OA 4DYZA 4RC6B 4AM2A 1F30A 1KRQA 3PWQC 2WLAA 2IU2A 4QUWA 2GS4A 2HTNA 2X170 4E40A 4MY7A 3FRRA 4DE6A 1XZ1A 2BJYA 3GGYA 1LB3A 3A9QA 1LKPA 2XJMA 5FFEA 2V8UA 4DYUA 4U3GA 5GN8A 3QVDA 4LQVA 4TOHA 2IY4A 4ZTTA 2V2IA 1IESA 2CN6A 1RCGA 2CHPA 1F33A 2ZG8X 5GU0X 1MFRA 2BK6A 1AEWA 1LKOA 4ITWA 1Z6OM 1SQ3A 3UOIA 1JIGA 3SE1A 5ERJA 1ZUJA 3RD0A 5GN8B 3AJOA 3KHKA 4TOGA 3JZAB 2CEIA 3AJQA 4MXPA 1UMNA 1MOJA 3E1NA 3FSEA 5K52A 2VXXA 2Z5PA 3IS7A 3RE7A 4CVTA 4CYAA 2VXIA 5JKLG 3KA6A 3KA3A 4LPJA 5JDOA 2YJJA 1JYBA 2CIHA 1R03A 2VZBA 3QB9A 4W4KB 2Z90A 3Q4QA 1RYTA 1XZ3A 3BVEA 2AR0A 5FFBA 1TJOA 5J8WA 3OGHA 5J8SA 1N1QA 5AXSA 4E6KA 1QYBA 5JKLA 5LG8A 3O7RA 4PG1A 1TKOA 1JREA 3PWFA 3E1QA 1JI4A 3E6SA 1RCIA 4OYNA 3ERZA 5JDOB 1L8HA 3SHXA 2V2LA 2ZA6A 1RCEA 4X0JA 3QD8A 5J93A 2PYBA 2FKZA 5FFAA 3E1PA 1RCDA 3N6OA 1VEQA 4CVRA 5HU6D 2WWXB 3RAVA 3Q4OA 5D8YA 3E1LA 4YXJA 3LKDA 3R2HA 2C2FA 4IXKA 2QF9A 3AJPA 1B71A 4M35A 3TA8A 1YUZA 3PVYA 3A68A 4A25A 3R2RA 5D8OA 4XKUA 2UX1A 2YW7A 2BKCA 4LYUA 3F32A 5GU3X 3ISEA 4CVSA 3W54A 1Z4AA 2JD80 4DI0A 1J30A 1YUXA 3MPSA 2FG8A 5E2DA 2CLUA 2FHAA 1FHAA 3F34A 2FG4A 3Q4NA 4XKTA 4YKHA 4DYYA 4M33A 2BW1A 3PVYB 4RC8A 4LQJA 4XGSA 1YV1A 3E1OA 3R2SA 2CF7A 3AK9A 3PZAA 1S30A 2FZFA 2MGYA 3Q4RA 2F7NA 1S3QA 4ZL6A 1VLGA 3JZ9A 2WTLA 2OH3A 3R2LA 4TOEA 1JTSA 4TOCA 3HL1A 3PW1A 4YVZA 4EVBA 2V8TA 5ERKA 1O9RA 2FFXJ 3O7SA 1JKVA 3EGMA 3F37A 3VNXA 2Z6MA 1NFVA 1DVBA 5JACA 4Z3BA 5CZUA 3FRSA 2V2JA 3V3KB 4Y08A 2RBDA 2Y44A 2ZURX 5FFCA 4PG0A 4AM5A 3NOZX 3PW1B 3C21A 3WVWA 4ZL5A 2D5KA 4KVSA 1EUMA 4YXMA 1IERA 4WJG4 3KWOA 4DZ0A 5HJFA 4ZMCA 4CMYV 3QZ3A 1L8IA 4IWJA 3PVRA 3AF9X 3U90A 2GYDA 4II4A 2V2PA 2HR5A 4MKUA 4ZLWA 2C2JA 1OTKA 3IS8A 1JKUA 4EVDA 3ISFA 3T9JA 1VELA 4ZKWA 2C41A 3KA8A 4LQNA 4LPMA 5LBHA 3BVKA 3E6RA 4KVQA 4KXRB 4TOFA 4KVRA 3KDQA 3OJ5A 3C23A 3PVRB 5D8RA 4MUDA 4ZJKA 4CY9A 3KA9A 2FL0A 4II4B 5D8XA 2C2UA 3AF7X 3AK8A 3M6JA 3AF8X 4RC7A 5FFDA 3KA4A 2XKQA 3C1YA 2YJKA 1Z6OA 4XKSA 2Z5QA 2Y3QA 3UNOA 4CMYA 4ITTA 4TODA 5FEJA 2V2MA 5C6FA 2JD70 5J9VA 3QHBA 1UVHA 3GE4A 1BCFA 5GOUA 2CLBA 2XGWA 1TKPA 1JGCA 5LS9A 3SH6A 5GU2X 3F33A 2OC5A 4RC7B 4CVPA 3UFBA 5JKMG 3E1JA 4M32A 5GU1X 1H96A 3NP2X 3GHQA 3BKNA 3VV9A 3E1MA 3R2OA 3FI6A 3EZ0A 3R2KA 3BVFA 4ERUA 1NF6A 4PGKA 2GYQA 5E1UA 3EZUA 4LPNA 2ZA8A 5D8PA 2FJCA 2IB0A 2C6RA 3WVVA 3VVAA 1BFRA 1NNQA 5JKMA 1SOFA 4LYXA 2CWLA 3PVTA 2WLUA 2XJNA 1GWGA 4TW3A 3BT5A
chains in the Genus database with same CATH topology
2G38B 5CMRA 4P18A 3ES3A 4ETRA 5LG2A 1ZS3A 3NP0X 4R42A 2ZG7X 3RGDA 4PGIA 1LKMA 1VEIA 3HIUA 4W4LB 3WNWA 1BG7A 4ISMA 2XJOA 2V2RA 4DYXA 1QGHA 3PVTB 3L0MA 3F38A 4DASA 4M34A 3FVBA 5I4JA 3WVUA 1NF4A 1VJXA 3BVIA 5D8SA 2JD60 2YW6A 2W0OA 3H7GA 3E2CA 2ZG9X 3PW8A 1RCCA 5K53A 3D19A 2ITBA 3UOFA 3DBYA 3BVLA 4LQHA 4RC5A 2V15A 4ISPA 5HJHA 3PW8C 1JI5A 2Z5RA 3QHCA 2N02A 5CMQA 3KX9A 3R2MA 4MJYA 5IX6A 1DPSA 3GGZA 4TOBA 4ZKHA 4CYBA 2G4HA 2V2NA 4EVCA 2QQYA 2OKCA 4MN9A 5HQOA 1DATA 1S2ZA 2CN7A 2V2SA 4REUA 4RC5B 1O9IA 3C1ZA 5D8QA 4RC6A 3F39A 3RBCA 4IWKA 4TO9A 4ML5A 1HRSA 2ZA7A 1TK6A 4EVEA 2CHIA 3IQ1A 4AM4A 4Z5SA 4ZKXA 3KXUA 3SIDA 3PWQA 3GVYA 3F36A 4TOAA 3F35A 2V2OA 4DYZA 4RC6B 4AM2A 1F30A 1KRQA 3PWQC 2WLAA 2IU2A 4QUWA 2GS4A 2HTNA 2X170 4E40A 4MY7A 3FRRA 4DE6A 1XZ1A 2BJYA 3GGYA 1LB3A 3A9QA 1LKPA 2XJMA 5FFEA 2V8UA 4DYUA 4U3GA 5GN8A 3QVDA 4LQVA 4TOHA 2IY4A 4ZTTA 2V2IA 1IESA 2CN6A 1RCGA 2CHPA 1F33A 2ZG8X 5GU0X 1MFRA 2BK6A 1AEWA 1LKOA 4ITWA 1Z6OM 1SQ3A 3UOIA 1JIGA 3SE1A 5ERJA 1ZUJA 3RD0A 5GN8B 3AJOA 3KHKA 4TOGA 3JZAB 2CEIA 3AJQA 4MXPA 1UMNA 1MOJA 3E1NA 3FSEA 5K52A 2VXXA 2Z5PA 3IS7A 3RE7A 4CVTA 4CYAA 2VXIA 5JKLG 3KA6A 3KA3A 4LPJA 5JDOA 2YJJA 1JYBA 2CIHA 1R03A 2VZBA 3QB9A 4W4KB 2Z90A 3Q4QA 1RYTA 1XZ3A 3BVEA 2AR0A 5FFBA 1TJOA 5J8WA 3OGHA 5J8SA 1N1QA 5AXSA 4E6KA 1QYBA 5JKLA 5LG8A 3O7RA 4PG1A 1TKOA 1JREA 3PWFA 3E1QA 1JI4A 3E6SA 1RCIA 4OYNA 3ERZA 5JDOB 1L8HA 3SHXA 2V2LA 2ZA6A 1RCEA 4X0JA 3QD8A 5J93A 2PYBA 2FKZA 5FFAA 3E1PA 1RCDA 3N6OA 1VEQA 4CVRA 5HU6D 2WWXB 3RAVA 3Q4OA 5D8YA 3E1LA 4YXJA 3LKDA 3R2HA 2C2FA 4IXKA 2QF9A 3AJPA 1B71A 4M35A 3TA8A 1YUZA 3PVYA 3A68A 4A25A 3R2RA 5D8OA 4XKUA 2UX1A 2YW7A 2BKCA 4LYUA 3F32A 5GU3X 3ISEA 4CVSA 3W54A 1Z4AA 2JD80 4DI0A 1J30A 1YUXA 3MPSA 2FG8A 5E2DA 2CLUA 2FHAA 1FHAA 3F34A 2FG4A 3Q4NA 4XKTA 4YKHA 4DYYA 4M33A 2BW1A 3PVYB 4RC8A 4LQJA 4XGSA 1YV1A 3E1OA 3R2SA 2CF7A 3AK9A 3PZAA 1S30A 2FZFA 2MGYA 3Q4RA 2F7NA 1S3QA 4ZL6A 1VLGA 3JZ9A 2WTLA 2OH3A 3R2LA 4TOEA 1JTSA 4TOCA 3HL1A 3PW1A 4YVZA 4EVBA 2V8TA 5ERKA 1O9RA 2FFXJ 3O7SA 1JKVA 3EGMA 3F37A 3VNXA 2Z6MA 1NFVA 1DVBA 5JACA 4Z3BA 5CZUA 3FRSA 2V2JA 3V3KB 4Y08A 2RBDA 2Y44A 2ZURX 5FFCA 4PG0A 4AM5A 3NOZX 3PW1B 3C21A 3WVWA 4ZL5A 2D5KA 4KVSA 1EUMA 4YXMA 1IERA 4WJG4 3KWOA 4DZ0A 5HJFA 4ZMCA 4CMYV 3QZ3A 1L8IA 4IWJA 3PVRA 3AF9X 3U90A 2GYDA 4II4A 2V2PA 2HR5A 4MKUA 4ZLWA 2C2JA 1OTKA 3IS8A 1JKUA 4EVDA 3ISFA 3T9JA 1VELA 4ZKWA 2C41A 3KA8A 4LQNA 4LPMA 5LBHA 3BVKA 3E6RA 4KVQA 4KXRB 4TOFA 4KVRA 3KDQA 3OJ5A 3C23A 3PVRB 5D8RA 4MUDA 4ZJKA 4CY9A 3KA9A 2FL0A 4II4B 5D8XA 2C2UA 3AF7X 3AK8A 3M6JA 3AF8X 4RC7A 5FFDA 3KA4A 2XKQA 3C1YA 2YJKA 1Z6OA 4XKSA 2Z5QA 2Y3QA 3UNOA 4CMYA 4ITTA 4TODA 5FEJA 2V2MA 5C6FA 2JD70 5J9VA 3QHBA 1UVHA 3GE4A 1BCFA 5GOUA 2CLBA 2XGWA 1TKPA 1JGCA 5LS9A 3SH6A 5GU2X 3F33A 2OC5A 4RC7B 4CVPA 3UFBA 5JKMG 3E1JA 4M32A 5GU1X 1H96A 3NP2X 3GHQA 3BKNA 3VV9A 3E1MA 3R2OA 3FI6A 3EZ0A 3R2KA 3BVFA 4ERUA 1NF6A 4PGKA 2GYQA 5E1UA 3EZUA 4LPNA 2ZA8A 5D8PA 2FJCA 2IB0A 2C6RA 3WVVA 3VVAA 1BFRA 1NNQA 5JKMA 1SOFA 4LYXA 2CWLA 3PVTA 2WLUA 2XJNA 1GWGA 4TW3A 3BT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMR A;  4P18 A;  3ES3 A;  4ETR A;  5LG2 A;  1ZS3 A;  3NP0 X;  4R42 A;  2ZG7 X;  3RGD A;  4PGI A;  1LKM A;  1VEI A;  3HIU A;  3WNW A;  1BG7 A;  4ISM A;  2XJO A;  2V2R A;  4DYX A;  1QGH A;  3PVT B;  3F38 A;  4DAS A;  4M34 A;  3FVB A;  5I4J A;  3WVU A;  1NF4 A;  1VJX A;  3BVI A;  5D8S A;  2JD6 0;  2YW6 A;  2W0O A;  3H7G A;  3E2C A;  2ZG9 X;  3PW8 A;  1RCC A;  5K53 A;  2ITB A;  3UOF A;  3BVL A;  4LQH A;  4RC5 A;  2V15 A;  4ISP A;  5HJH A;  3PW8 C;  1JI5 A;  2Z5R A;  3QHC A;  5CMQ A;  3KX9 A;  3R2M A;  4MJY A;  5IX6 A;  1DPS A;  4TOB A;  4ZKH A;  4CYB A;  2G4H A;  2V2N A;  4EVC A;  2QQY A;  4MN9 A;  5HQO A;  1DAT A;  1S2Z A;  2CN7 A;  2V2S A;  4REU A;  4RC5 B;  1O9I A;  5D8Q A;  4RC6 A;  3F39 A;  3RBC A;  4IWK A;  4TO9 A;  4ML5 A;  1HRS A;  2ZA7 A;  1TK6 A;  4EVE A;  2CHI A;  3IQ1 A;  4AM4 A;  4Z5S A;  4ZKX A;  3KXU A;  3SID A;  3PWQ A;  3GVY A;  3F36 A;  4TOA A;  3F35 A;  2V2O A;  4DYZ A;  4RC6 B;  4AM2 A;  1F30 A;  1KRQ A;  3PWQ C;  2WLA A;  2IU2 A;  4QUW A;  2GS4 A;  2HTN A;  2X17 0;  4MY7 A;  4DE6 A;  1XZ1 A;  2BJY A;  1LB3 A;  3A9Q A;  1LKP A;  2XJM A;  5FFE A;  4DYU A;  4U3G A;  5GN8 A;  3QVD A;  4LQV A;  4TOH A;  2IY4 A;  4ZTT A;  2V2I A;  1IES A;  2CN6 A;  1RCG A;  2CHP A;  1F33 A;  2ZG8 X;  5GU0 X;  1MFR A;  2BK6 A;  1AEW A;  1LKO A;  4ITW A;  1Z6O M;  1SQ3 A;  3UOI A;  1JIG A;  3SE1 A;  5ERJ A;  1ZUJ A;  3RD0 A;  5GN8 B;  3AJO A;  4TOG A;  2CEI A;  3AJQ A;  1UMN A;  1MOJ A;  3E1N A;  3FSE A;  5K52 A;  2VXX A;  2Z5P A;  3IS7 A;  3RE7 A;  4CVT A;  4CYA A;  2VXI A;  5JKL G;  3KA6 A;  3KA3 A;  4LPJ A;  2YJJ A;  1JYB A;  2CIH A;  1R03 A;  2VZB A;  3QB9 A;  2Z90 A;  3Q4Q A;  1RYT A;  1XZ3 A;  3BVE A;  5FFB A;  1TJO A;  5J8W A;  3OGH A;  5J8S A;  1N1Q A;  5AXS A;  4E6K A;  1QYB A;  5JKL A;  5LG8 A;  3O7R A;  4PG1 A;  1TKO A;  1JRE A;  3PWF A;  3E1Q A;  1JI4 A;  3E6S A;  1RCI A;  4OYN A;  3ERZ A;  1L8H A;  3SHX A;  2V2L A;  2ZA6 A;  1RCE A;  3QD8 A;  5J93 A;  2PYB A;  2FKZ A;  5FFA A;  3E1P A;  1RCD A;  1VEQ A;  4CVR A;  3RAV A;  3Q4O A;  5D8Y A;  3E1L A;  3R2H A;  2C2F A;  4IXK A;  2QF9 A;  3AJP A;  1B71 A;  4M35 A;  3TA8 A;  1YUZ A;  3PVY A;  3A68 A;  4A25 A;  3R2R A;  5D8O A;  4XKU A;  2UX1 A;  2YW7 A;  2BKC A;  4LYU A;  3F32 A;  5GU3 X;  3ISE A;  4CVS A;  1Z4A A;  2JD8 0;  4DI0 A;  1J30 A;  1YUX A;  3MPS A;  2FG8 A;  5E2D A;  2CLU A;  2FHA A;  1FHA A;  3F34 A;  2FG4 A;  3Q4N A;  4XKT A;  4YKH A;  4DYY A;  4M33 A;  2BW1 A;  3PVY B;  4RC8 A;  4LQJ A;  4XGS A;  1YV1 A;  3E1O A;  3R2S A;  2CF7 A;  3AK9 A;  3PZA A;  1S30 A;  2FZF A;  3Q4R A;  2F7N A;  1S3Q A;  4ZL6 A;  1VLG A;  2WTL A;  2OH3 A;  3R2L A;  4TOE A;  1JTS A;  4TOC A;  3HL1 A;  3PW1 A;  4EVB A;  5ERK A;  1O9R A;  2FFX J;  3O7S A;  1JKV A;  3EGM A;  3F37 A;  3VNX A;  2Z6M A;  1NFV A;  1DVB A;  5JAC A;  4Z3B A;  5CZU A;  2V2J A;  4Y08 A;  2RBD A;  2ZUR X;  5FFC A;  4PG0 A;  4AM5 A;  3NOZ X;  3PW1 B;  3WVW A;  4ZL5 A;  2D5K A;  4KVS A;  1EUM A;  1IER A;  3KWO A;  4DZ0 A;  5HJF A;  4ZMC A;  4CMY V;  3QZ3 A;  1L8I A;  4IWJ A;  3PVR A;  3AF9 X;  3U90 A;  2GYD A;  4II4 A;  2V2P A;  2HR5 A;  4MKU A;  4ZLW A;  2C2J A;  1OTK A;  3IS8 A;  1JKU A;  4EVD A;  3ISF A;  3T9J A;  1VEL A;  4ZKW A;  2C41 A;  3KA8 A;  4LQN A;  4LPM A;  5LBH A;  3BVK A;  3E6R A;  4KVQ A;  4TOF A;  4KVR A;  3OJ5 A;  5D8R A;  3PVR B;  4MUD A;  4ZJK A;  4CY9 A;  3KA9 A;  2FL0 A;  4II4 B;  5D8X A;  2C2U A;  3AF7 X;  3AK8 A;  5FFD A;  3AF8 X;  4RC7 A;  3KA4 A;  2XKQ A;  2YJK A;  1Z6O A;  4XKS A;  2Z5Q A;  2Y3Q A;  3UNO A;  4CMY A;  4ITT A;  4TOD A;  5FEJ A;  2V2M A;  5C6F A;  2JD7 0;  5J9V A;  3QHB A;  1UVH A;  3GE4 A;  1BCF A;  5GOU A;  2CLB A;  2XGW A;  1TKP A;  1JGC A;  5LS9 A;  3SH6 A;  5GU2 X;  3F33 A;  2OC5 A;  4RC7 B;  4CVP A;  5JKM G;  3E1J A;  4M32 A;  5GU1 X;  1H96 A;  3NP2 X;  3GHQ A;  3BKN A;  3E1M A;  3R2O A;  3FI6 A;  3EZ0 A;  3R2K A;  3BVF A;  4ERU A;  1NF6 A;  4PGK A;  2GYQ A;  5E1U A;  3EZU A;  4LPN A;  2ZA8 A;  5D8P A;  2FJC A;  2IB0 A;  2C6R A;  3WVV A;  1BFR A;  1NNQ A;  5JKM A;  1SOF A;  4LYX A;  3PVT A;  2WLU A;  2XJN A;  1GWG A;  4TW3 A;  3BT5 A; 
#chains in the Genus database with same CATH topology
 2G38 B;  5CMR A;  4P18 A;  3ES3 A;  4ETR A;  5LG2 A;  1ZS3 A;  3NP0 X;  4R42 A;  2ZG7 X;  3RGD A;  4PGI A;  1LKM A;  1VEI A;  3HIU A;  4W4L B;  3WNW A;  1BG7 A;  4ISM A;  2XJO A;  2V2R A;  4DYX A;  1QGH A;  3PVT B;  3L0M A;  3F38 A;  4DAS A;  4M34 A;  3FVB A;  5I4J A;  3WVU A;  1NF4 A;  1VJX A;  3BVI A;  5D8S A;  2JD6 0;  2YW6 A;  2W0O A;  3H7G A;  3E2C A;  2ZG9 X;  3PW8 A;  1RCC A;  5K53 A;  3D19 A;  2ITB A;  3UOF A;  3DBY A;  3BVL A;  4LQH A;  4RC5 A;  2V15 A;  4ISP A;  5HJH A;  3PW8 C;  1JI5 A;  2Z5R A;  3QHC A;  2N02 A;  5CMQ A;  3KX9 A;  3R2M A;  4MJY A;  5IX6 A;  1DPS A;  3GGZ A;  4TOB A;  4ZKH A;  4CYB A;  2G4H A;  2V2N A;  4EVC A;  2QQY A;  2OKC A;  4MN9 A;  5HQO A;  1DAT A;  1S2Z A;  2CN7 A;  2V2S A;  4REU A;  4RC5 B;  1O9I A;  3C1Z A;  5D8Q A;  4RC6 A;  3F39 A;  3RBC A;  4IWK A;  4TO9 A;  4ML5 A;  1HRS A;  2ZA7 A;  1TK6 A;  4EVE A;  2CHI A;  3IQ1 A;  4AM4 A;  4Z5S A;  4ZKX A;  3KXU A;  3SID A;  3PWQ A;  3GVY A;  3F36 A;  4TOA A;  3F35 A;  2V2O A;  4DYZ A;  4RC6 B;  4AM2 A;  1F30 A;  1KRQ A;  3PWQ C;  2WLA A;  2IU2 A;  4QUW A;  2GS4 A;  2HTN A;  2X17 0;  4E40 A;  4MY7 A;  3FRR A;  4DE6 A;  1XZ1 A;  2BJY A;  3GGY A;  1LB3 A;  3A9Q A;  1LKP A;  2XJM A;  5FFE A;  2V8U A;  4DYU A;  4U3G A;  5GN8 A;  3QVD A;  4LQV A;  4TOH A;  2IY4 A;  4ZTT A;  2V2I A;  1IES A;  2CN6 A;  1RCG A;  2CHP A;  1F33 A;  2ZG8 X;  5GU0 X;  1MFR A;  2BK6 A;  1AEW A;  1LKO A;  4ITW A;  1Z6O M;  1SQ3 A;  3UOI A;  1JIG A;  3SE1 A;  5ERJ A;  1ZUJ A;  3RD0 A;  5GN8 B;  3AJO A;  3KHK A;  4TOG A;  3JZA B;  2CEI A;  3AJQ A;  4MXP A;  1UMN A;  1MOJ A;  3E1N A;  3FSE A;  5K52 A;  2VXX A;  2Z5P A;  3IS7 A;  3RE7 A;  4CVT A;  4CYA A;  2VXI A;  5JKL G;  3KA6 A;  3KA3 A;  4LPJ A;  5JDO A;  2YJJ A;  1JYB A;  2CIH A;  1R03 A;  2VZB A;  3QB9 A;  4W4K B;  2Z90 A;  3Q4Q A;  1RYT A;  1XZ3 A;  3BVE A;  2AR0 A;  5FFB A;  1TJO A;  5J8W A;  3OGH A;  5J8S A;  1N1Q A;  5AXS A;  4E6K A;  1QYB A;  5JKL A;  5LG8 A;  3O7R A;  4PG1 A;  1TKO A;  1JRE A;  3PWF A;  3E1Q A;  1JI4 A;  3E6S A;  1RCI A;  4OYN A;  3ERZ A;  5JDO B;  1L8H A;  3SHX A;  2V2L A;  2ZA6 A;  1RCE A;  4X0J A;  3QD8 A;  5J93 A;  2PYB A;  2FKZ A;  5FFA A;  3E1P A;  1RCD A;  3N6O A;  1VEQ A;  4CVR A;  5HU6 D;  2WWX B;  3RAV A;  3Q4O A;  5D8Y A;  3E1L A;  4YXJ A;  3LKD A;  3R2H A;  2C2F A;  4IXK A;  2QF9 A;  3AJP A;  1B71 A;  4M35 A;  3TA8 A;  1YUZ A;  3PVY A;  3A68 A;  4A25 A;  3R2R A;  5D8O A;  4XKU A;  2UX1 A;  2YW7 A;  2BKC A;  4LYU A;  3F32 A;  5GU3 X;  3ISE A;  4CVS A;  3W54 A;  1Z4A A;  2JD8 0;  4DI0 A;  1J30 A;  1YUX A;  3MPS A;  2FG8 A;  5E2D A;  2CLU A;  2FHA A;  1FHA A;  3F34 A;  2FG4 A;  3Q4N A;  4XKT A;  4YKH A;  4DYY A;  4M33 A;  2BW1 A;  3PVY B;  4RC8 A;  4LQJ A;  4XGS A;  1YV1 A;  3E1O A;  3R2S A;  2CF7 A;  3AK9 A;  3PZA A;  1S30 A;  2FZF A;  2MGY A;  3Q4R A;  2F7N A;  1S3Q A;  4ZL6 A;  1VLG A;  3JZ9 A;  2WTL A;  2OH3 A;  3R2L A;  4TOE A;  1JTS A;  4TOC A;  3HL1 A;  3PW1 A;  4YVZ A;  4EVB A;  2V8T A;  5ERK A;  1O9R A;  2FFX J;  3O7S A;  1JKV A;  3EGM A;  3F37 A;  3VNX A;  2Z6M A;  1NFV A;  1DVB A;  5JAC A;  4Z3B A;  5CZU A;  3FRS A;  2V2J A;  3V3K B;  4Y08 A;  2RBD A;  2Y44 A;  2ZUR X;  5FFC A;  4PG0 A;  4AM5 A;  3NOZ X;  3PW1 B;  3C21 A;  3WVW A;  4ZL5 A;  2D5K A;  4KVS A;  1EUM A;  4YXM A;  1IER A;  4WJG 4;  3KWO A;  4DZ0 A;  5HJF A;  4ZMC A;  4CMY V;  3QZ3 A;  1L8I A;  4IWJ A;  3PVR A;  3AF9 X;  3U90 A;  2GYD A;  4II4 A;  2V2P A;  2HR5 A;  4MKU A;  4ZLW A;  2C2J A;  1OTK A;  3IS8 A;  1JKU A;  4EVD A;  3ISF A;  3T9J A;  1VEL A;  4ZKW A;  2C41 A;  3KA8 A;  4LQN A;  4LPM A;  5LBH A;  3BVK A;  3E6R A;  4KVQ A;  4KXR B;  4TOF A;  4KVR A;  3KDQ A;  3OJ5 A;  3C23 A;  3PVR B;  5D8R A;  4MUD A;  4ZJK A;  4CY9 A;  3KA9 A;  2FL0 A;  4II4 B;  5D8X A;  2C2U A;  3AF7 X;  3AK8 A;  3M6J A;  3AF8 X;  4RC7 A;  5FFD A;  3KA4 A;  2XKQ A;  3C1Y A;  2YJK A;  1Z6O A;  4XKS A;  2Z5Q A;  2Y3Q A;  3UNO A;  4CMY A;  4ITT A;  4TOD A;  5FEJ A;  2V2M A;  5C6F A;  2JD7 0;  5J9V A;  3QHB A;  1UVH A;  3GE4 A;  1BCF A;  5GOU A;  2CLB A;  2XGW A;  1TKP A;  1JGC A;  5LS9 A;  3SH6 A;  5GU2 X;  3F33 A;  2OC5 A;  4RC7 B;  4CVP A;  3UFB A;  5JKM G;  3E1J A;  4M32 A;  5GU1 X;  1H96 A;  3NP2 X;  3GHQ A;  3BKN A;  3VV9 A;  3E1M A;  3R2O A;  3FI6 A;  3EZ0 A;  3R2K A;  3BVF A;  4ERU A;  1NF6 A;  4PGK A;  2GYQ A;  5E1U A;  3EZU A;  4LPN A;  2ZA8 A;  5D8P A;  2FJC A;  2IB0 A;  2C6R A;  3WVV A;  3VVA A;  1BFR A;  1NNQ A;  5JKM A;  1SOF A;  4LYX A;  2CWL A;  3PVT A;  2WLU A;  2XJN A;  1GWG A;  4TW3 A;  3BT5 A; 
#chains in the Genus database with same CATH homology
 2G38 B;  5CMR A;  4P18 A;  3ES3 A;  4ETR A;  5LG2 A;  1ZS3 A;  3NP0 X;  4R42 A;  2ZG7 X;  3RGD A;  4PGI A;  1LKM A;  1VEI A;  3HIU A;  4W4L B;  3WNW A;  1BG7 A;  4ISM A;  2XJO A;  2V2R A;  4DYX A;  1QGH A;  3PVT B;  3L0M A;  3F38 A;  4DAS A;  4M34 A;  3FVB A;  5I4J A;  3WVU A;  1NF4 A;  1VJX A;  3BVI A;  5D8S A;  2JD6 0;  2YW6 A;  2W0O A;  3H7G A;  3E2C A;  2ZG9 X;  3PW8 A;  1RCC A;  5K53 A;  3D19 A;  2ITB A;  3UOF A;  3DBY A;  3BVL A;  4LQH A;  4RC5 A;  2V15 A;  4ISP A;  5HJH A;  3PW8 C;  1JI5 A;  2Z5R A;  3QHC A;  2N02 A;  5CMQ A;  3KX9 A;  3R2M A;  4MJY A;  5IX6 A;  1DPS A;  3GGZ A;  4TOB A;  4ZKH A;  4CYB A;  2G4H A;  2V2N A;  4EVC A;  2QQY A;  2OKC A;  4MN9 A;  5HQO A;  1DAT A;  1S2Z A;  2CN7 A;  2V2S A;  4REU A;  4RC5 B;  1O9I A;  3C1Z A;  5D8Q A;  4RC6 A;  3F39 A;  3RBC A;  4IWK A;  4TO9 A;  4ML5 A;  1HRS A;  2ZA7 A;  1TK6 A;  4EVE A;  2CHI A;  3IQ1 A;  4AM4 A;  4Z5S A;  4ZKX A;  3KXU A;  3SID A;  3PWQ A;  3GVY A;  3F36 A;  4TOA A;  3F35 A;  2V2O A;  4DYZ A;  4RC6 B;  4AM2 A;  1F30 A;  1KRQ A;  3PWQ C;  2WLA A;  2IU2 A;  4QUW A;  2GS4 A;  2HTN A;  2X17 0;  4E40 A;  4MY7 A;  3FRR A;  4DE6 A;  1XZ1 A;  2BJY A;  3GGY A;  1LB3 A;  3A9Q A;  1LKP A;  2XJM A;  5FFE A;  2V8U A;  4DYU A;  4U3G A;  5GN8 A;  3QVD A;  4LQV A;  4TOH A;  2IY4 A;  4ZTT A;  2V2I A;  1IES A;  2CN6 A;  1RCG A;  2CHP A;  1F33 A;  2ZG8 X;  5GU0 X;  1MFR A;  2BK6 A;  1AEW A;  1LKO A;  4ITW A;  1Z6O M;  1SQ3 A;  3UOI A;  1JIG A;  3SE1 A;  5ERJ A;  1ZUJ A;  3RD0 A;  5GN8 B;  3AJO A;  3KHK A;  4TOG A;  3JZA B;  2CEI A;  3AJQ A;  4MXP A;  1UMN A;  1MOJ A;  3E1N A;  3FSE A;  5K52 A;  2VXX A;  2Z5P A;  3IS7 A;  3RE7 A;  4CVT A;  4CYA A;  2VXI A;  5JKL G;  3KA6 A;  3KA3 A;  4LPJ A;  5JDO A;  2YJJ A;  1JYB A;  2CIH A;  1R03 A;  2VZB A;  3QB9 A;  4W4K B;  2Z90 A;  3Q4Q A;  1RYT A;  1XZ3 A;  3BVE A;  2AR0 A;  5FFB A;  1TJO A;  5J8W A;  3OGH A;  5J8S A;  1N1Q A;  5AXS A;  4E6K A;  1QYB A;  5JKL A;  5LG8 A;  3O7R A;  4PG1 A;  1TKO A;  1JRE A;  3PWF A;  3E1Q A;  1JI4 A;  3E6S A;  1RCI A;  4OYN A;  3ERZ A;  5JDO B;  1L8H A;  3SHX A;  2V2L A;  2ZA6 A;  1RCE A;  4X0J A;  3QD8 A;  5J93 A;  2PYB A;  2FKZ A;  5FFA A;  3E1P A;  1RCD A;  3N6O A;  1VEQ A;  4CVR A;  5HU6 D;  2WWX B;  3RAV A;  3Q4O A;  5D8Y A;  3E1L A;  4YXJ A;  3LKD A;  3R2H A;  2C2F A;  4IXK A;  2QF9 A;  3AJP A;  1B71 A;  4M35 A;  3TA8 A;  1YUZ A;  3PVY A;  3A68 A;  4A25 A;  3R2R A;  5D8O A;  4XKU A;  2UX1 A;  2YW7 A;  2BKC A;  4LYU A;  3F32 A;  5GU3 X;  3ISE A;  4CVS A;  3W54 A;  1Z4A A;  2JD8 0;  4DI0 A;  1J30 A;  1YUX A;  3MPS A;  2FG8 A;  5E2D A;  2CLU A;  2FHA A;  1FHA A;  3F34 A;  2FG4 A;  3Q4N A;  4XKT A;  4YKH A;  4DYY A;  4M33 A;  2BW1 A;  3PVY B;  4RC8 A;  4LQJ A;  4XGS A;  1YV1 A;  3E1O A;  3R2S A;  2CF7 A;  3AK9 A;  3PZA A;  1S30 A;  2FZF A;  2MGY A;  3Q4R A;  2F7N A;  1S3Q A;  4ZL6 A;  1VLG A;  3JZ9 A;  2WTL A;  2OH3 A;  3R2L A;  4TOE A;  1JTS A;  4TOC A;  3HL1 A;  3PW1 A;  4YVZ A;  4EVB A;  2V8T A;  5ERK A;  1O9R A;  2FFX J;  3O7S A;  1JKV A;  3EGM A;  3F37 A;  3VNX A;  2Z6M A;  1NFV A;  1DVB A;  5JAC A;  4Z3B A;  5CZU A;  3FRS A;  2V2J A;  3V3K B;  4Y08 A;  2RBD A;  2Y44 A;  2ZUR X;  5FFC A;  4PG0 A;  4AM5 A;  3NOZ X;  3PW1 B;  3C21 A;  3WVW A;  4ZL5 A;  2D5K A;  4KVS A;  1EUM A;  4YXM A;  1IER A;  4WJG 4;  3KWO A;  4DZ0 A;  5HJF A;  4ZMC A;  4CMY V;  3QZ3 A;  1L8I A;  4IWJ A;  3PVR A;  3AF9 X;  3U90 A;  2GYD A;  4II4 A;  2V2P A;  2HR5 A;  4MKU A;  4ZLW A;  2C2J A;  1OTK A;  3IS8 A;  1JKU A;  4EVD A;  3ISF A;  3T9J A;  1VEL A;  4ZKW A;  2C41 A;  3KA8 A;  4LQN A;  4LPM A;  5LBH A;  3BVK A;  3E6R A;  4KVQ A;  4KXR B;  4TOF A;  4KVR A;  3KDQ A;  3OJ5 A;  3C23 A;  3PVR B;  5D8R A;  4MUD A;  4ZJK A;  4CY9 A;  3KA9 A;  2FL0 A;  4II4 B;  5D8X A;  2C2U A;  3AF7 X;  3AK8 A;  3M6J A;  3AF8 X;  4RC7 A;  5FFD A;  3KA4 A;  2XKQ A;  3C1Y A;  2YJK A;  1Z6O A;  4XKS A;  2Z5Q A;  2Y3Q A;  3UNO A;  4CMY A;  4ITT A;  4TOD A;  5FEJ A;  2V2M A;  5C6F A;  2JD7 0;  5J9V A;  3QHB A;  1UVH A;  3GE4 A;  1BCF A;  5GOU A;  2CLB A;  2XGW A;  1TKP A;  1JGC A;  5LS9 A;  3SH6 A;  5GU2 X;  3F33 A;  2OC5 A;  4RC7 B;  4CVP A;  3UFB A;  5JKM G;  3E1J A;  4M32 A;  5GU1 X;  1H96 A;  3NP2 X;  3GHQ A;  3BKN A;  3VV9 A;  3E1M A;  3R2O A;  3FI6 A;  3EZ0 A;  3R2K A;  3BVF A;  4ERU A;  1NF6 A;  4PGK A;  2GYQ A;  5E1U A;  3EZU A;  4LPN A;  2ZA8 A;  5D8P A;  2FJC A;  2IB0 A;  2C6R A;  3WVV A;  3VVA A;  1BFR A;  1NNQ A;  5JKM A;  1SOF A;  4LYX A;  2CWL A;  3PVT A;  2WLU A;  2XJN A;  1GWG A;  4TW3 A;  3BT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...