2HR5A

Pf1283- rubrerythrin from pyrococcus furiosus iron bound form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title Crystal structure of iron bound Rubrerythrin from Pyrococcus Furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Metal binding protein
total genus 62
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2hr5A01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2hr5A02
3R2MA 3F35A 3KA4A 1YUZA 2OH3A 4OYNA 5K52A 4RXNA 4PGIA 2C6RA 1T9PA 3Q4RA 3BKNA 3GE4A 4R42A 2X170 4POFA 2V2LA 4LQHA 1VEIA 4RC5A 4TOCA 2WLAA 2YJJA 4TOBA 4II4B 3GHQA 3KYVA 3AF7X 4TOGA 4ISPA 3KX9A 2V2RA 3E1LA 3PVRA 4CVSA 1DATA 1LKOA 2VXXA 3F37A 4DYXA 4KVQA 4TOEA 2YJKA 2ZG8X 2PYAA 4XKUA 4TOHA 2V2PA 1QGHA 5JKMA 1XZ3A 2HR5A 2FJCA 5K53A 3ISFA 4MY7A 3UNOA 4LQJA 3KWOA 4CYAA 3RZ6A 1T9OA 5AI2A 1R0FA 4ISMA 5D8YA 3AK9A 3R2RA 1QCVA 1BQ9A 3QZ3A 2XJNA 1MFRA 3PVTA 1F33A 1JGCA 2CLBA 5RXNA 4ZKHA 4M35A 4ZKWA 1JREA 5AXSA 4ZJKA 1RYTA 3A68A 4YWMA 2V3BB 1TKPA 2CIHA 2VXIA 4ML5A 4M32A 1Z6OA 4DASA 2JD70 5LG2A 1YV1A 2CLUA 5FFCA 4MKUA 1RDGA 1TK6A 3PWQC 3IS7A 1RCGA 3PWQA 2FZFA 5AI3A 3KXUA 1JYBA 1UMNA 1LB3A 1SMWA 3UOIA 4LPNA 1FHAA 4RC7B 4MJYA 4AR5A 6RXNA 1IROA 3T9JA 4IWJA 3E6RA 4RC6A 2RBDA 5JKLG 5LG8A 2C2JA 3E1NA 2V2MA 2BKCA 3KA6A 3PWFA 3ES3A 5GU1X 3E1JA 5GU2X 3PVYA 3E2CA 3NP0X 3WNWA 2ZA6A 3SE1A 3SIDA 5GOUA 7RXNA 4ZTTA 3E1MA 4Z5SA 5FEJA 5CMRA 1VEQA 2JD80 1JKUA 4XKSA 4ZKXA 2IB0A 5ERJA 2GS4A 3R2HA 2FFXJ 2V2JA 4KVSA 1FHHA 2IY4A 4K9FA 1SOFA 2XGWA 1HRSA 3PW8C 3PW8A 4ITTA 1OTKA 5FFDA 2Z5PA 2HTNA 3HL1A 3QD8A 1LTLA 3F32A 3E6SA 3KYXA 3SS2A 4LQVA 5IY0A 1O9RA 1BFYA 3O7RA 1R0HA 3PVTB 2QL0A 5D8OA 1IU5A 1Z6OM 4ITWA 4ZL5A 4U3GA 1RCDA 5LBHA 1S30A 1S2ZA 3ISEA 1MOJA 1QYBA 1VJXA 1RB9A 3O7SA 3E1QA 1CAAA 3TA8A 4PG1A 5J8WA 1BQ8A 4TO9A 3IS8A 1YUXA 5IX6A 4LQNA 1RCCA 2M4YA 3FVBA 3QB9A 3E1OA 3Q4QA 4EVEA 1YK4A 2GYQA 3RE7A 2ITBA 4ME3A 1JIGA 5D8RA 3SHXA 4TODA 4EVBA 3F34A 1BRFA 1VCXA 4MN9A 5CZUA 3KYWA 1LKMA 2OC5A 1TJOA 4DZ0A 3OJ5A 1RCIA 5J9VA 3PZAA 3E1PA 2WTLA 2CEIA 2PVXA 1DX8A 1R0IA 4LPJA 2GYDA 1B71A 4XKTA 2PYBA 3FSEA 1TKOA 3RYGA 4M34A 2ZG7X 1VLGA 3AF9X 2V2IA 2RDVA 4ZMCA 3OGHA 5JKLA 2FG8A 2YW6A 1DVBA 3UOFA 5GN8A 1CADA 2CHPA 1B13A 1LKPA 1UVHA 4MUDA 2GMGA 1SMUA 1IU6A 1F30A 1GWGA 1NNQA 4REUA 3BT5A 1R0JA 1DPSA 2Z5RA 1O9IA 2D5KA 4RC5B 3RZTA 4Z3BA 4LYUA 4AM2A 5GU3X 3Q4NA 4IXKA 1IESA 4M33A 3NOZX 4QUWA 4DI0A 2CN6A 4CVRA 2YW7A 5FFAA 1NF4A 4CYBA 2FKZA 3PVRB 2CF7A 3KYUA 5GU0X 4Y08A 3BVIA 1S24A 2PVEA 3AK8A 2FHAA 1RWDA 3WVWA 3BVLA 4ERUA 4ZL6A 4IWKA 4YWLA 1BFRA 4DYUA 1SMMA 3PW1A 1Z4AA 1R03A 5FFBA 3U90A 1BE7A 2ZA8A 4KVRA 5J93A 5D8PA 1ZUJA 5J8SA 1H96A 1EUMA 2G4HA 4P18A 4PG0A 3F36A 2C41A 2XKQA 3A9QA 3AF8X 3R2OA 4RC7A 4ETRA 5FFEA 2W0OA 2V15A 3SH6A 3WVUA 2V2SA 4AR4A 3EZ0A 4LPMA 3KYYA 1NF6A 2UX1A 4TPUA 2VZBA 5CMQA 5D8XA 1B2OA 5D8QA 1KRQA 3KA8A 5I4JA 1C09A 3AJQA 3BVFA 5HQOA 4CVPA 1S3QA 3AJPA 2V2NA 4AR6A 2F7NA 3VNXA 4AR3A 3F39A 4PGKA 3Q4OA 2MS3A 2FL0A 1R0GA 3WVVA 2XJMA 1SQ3A 2VL6A 2KKDA 2Z90A 1N1QA 5E1UA 1J30A 3F33A 5GN8B 2CN7A 1JKVA 2QF9A 3RAVA 2DSXA 4LYXA 2WLUA 1RDVA 1YK5A 1XZ1A 4DYYA 4II4A 4ZLWA 3H7GA 4AM4A 5JACA 1H7VA 4TOFA 4RC6B 1FHMA 3KA9A 3HIUA 5E2DA 1IERA 2LCQA 3R2KA 4CMYV 3PVYB 4AM5A 4DYZA 5JKMG 1VELA 1JI5A 3ERZA 3QVDA 2ZG9X 2IU2A 1E8JA 2QQYA 1T9QA 4TW3A 3RGDA 4EVCA 2Z6MA 1L8IA 2C2FA 3R2SA 5LS9A 2ZURX 2Y3QA 5ERKA 4EVDA 2KN9A 5HJFA 1BCFA 1ZS3A 1RCEA 4CMYA 3KA3A 3BVEA 3EGMA 1L8HA 3PW1B 8RXNA 4XGSA 4CVTA 3F38A 1AEWA 1JI4A 2CHIA 3QHBA 1ZRPA 1NFVA 1B2JA 3BVKA 3QHCA 5D8SA 3MPSA 2ZA7A 3IQ1A 2C2UA 1BG7A 3AJOA 4DE6A 3EZUA 2JD60 2BK6A 2K2DA 3RBCA 5C6FA 3GVYA 2FG4A 4E6KA 3RD0A 3FI6A 3R2LA 1IRNA 2Z5QA 4YKHA 2BJYA 3A44A 2BW1A 4TOAA 5HJHA 4CY9A 2XJOA 4RC8A 4POGA 2V2OA 4A25A 3NP2X 1JTSA
chains in the Genus database with same CATH superfamily
3R2MA 3J7Y1 3F35A 3KA4A 2Y0SP 1YUZA 1PFYA 3M6JA 3FRRA 2M6PA 2OH3A 4OYNA 5K52A 1PFUA 2APOB 5IP9L 4RXNA 4PGIA 2C6RA 5HU6D 1T9PA 3S2DL 2R93L 3Q4RA 4JAGA 3BKNA 2Z3QB 5IYBL 3GE4A 4R42A 2C6AA 2X170 4POFA 2V2LA 4LQHA 1VEIA 4RC5A 4TOCA 5C4XL 2WLAA 4JAFA 2YJJA 4TOBA 4II4B 4X6AL 1NXGA 3GHQA 3KYVA 3AF7X 4TOGA 3HOYL 4ISPA 3KX9A 2V2RA 3E1LA 3PVRA 4CVSA 1DATA 1LKOA 2VXXA 3F37A 4DYXA 4AYBP 2XJQA 4KVQA 4TOEA 2YJKA 2ZG8X 2PYAA 4XKUA 4TOHA 2V2PA 1QGHA 5JKMA 1XZ3A 3LWVB 3KHKA 3C23A 2HR5A 2FJCA 5K53A 3ISFA 4MY7A 5M3FL 3UNOA 4LQJA 3KWOA 3LWQB 4CYAA 3RZ6A 5AN9H 1T9OA 5AI2A 3LKDA 1R0FA 4ISMA 5D8YA 2E2HL 3AK9A 1Z92B 3R2RA 3GGZA 1BQ9A 1QCVA 3QZ3A 2XJNA 1MFRA 3PVTA 2V0FA 1F33A 2PMZP 4AI0A 1JGCA 2CLBA 3C1ZA 4ZKHA 5RXNA 4M35A 4ZKWA 4A3KL 4YVZA 2XJPA 1JREA 5AXSA 3S1RL 4ZJKA 4C2M1 4BY7L 2M4VA 4A3DL 2H12A 1F4LA 2NVYL 4LHNA 3UFBA 1RYTA 4TVMA 3A68A 4YWMA 2V3BB 1TKPA 2YU9L 2NVQL 2CIHA 3W54A 2R92L 4A3IL 4LHLA 2VXIA 4ML5A 4M32A 1Z6OA 4DASA 2JD70 5LG2A 1YV1A 2CLUA 5FFCA 4MKUA 4C3HL 1RDGA 1TK6A 3PWQC 3H9BA 3IS7A 1RCGA 3PWQA 4JAEA 3GTJL 2FZFA 1PZXA 5AI3A 3KXUA 5C3EL 2ERJA 1JYBA 1UMNA 1LB3A 1SMWA 3UOIA 3JZAB 3RZOL 4LPNA 2PSMC 3C1YA 2O5JD 1FHAA 4RC7B 4MJYA 4AR5A 6RXNA 3NFPI 2AUSB 2A69D 1IROA 3LNLA 3T9JA 4IWJA 3K7AL 3HOUL 1VZIA 3E6RA 4RC6A 2RBDA 5JKLG 5LG8A 2C2JA 3E1NA 3GTLL 4W4LB 5EIOC 2V2MA 2BKCA 3KA6A 3PWFA 3ES3A 5GU1X 2A6HD 3E1JA 5GU2X 3PVYA 3E2CA 3NP0X 3WNWA 2ZA6A 3SE1A 3SIDA 1QQTA 5GOUA 2AQCA 2Z3RB 7RXNA 4ZTTA 3E1MA 4Z5SA 2R7ZL 5FEJA 1SFOL 5JVG1 5CMRA 1VEQA 2JD80 1JKUA 4XKSA 4ZKXA 1P7PA 2IB0A 2JI1A 2XJSA 5ERJA 2JI2A 3LWPB 2GS4A 3R2HA 4XGHA 2FFXJ 2V2JA 4KVSA 1FHHA 2IY4A 3KDQA 3S1NL 4K9FA 4A3ML 3GTPL 1SOFA 2XGWA 1VZHA 1HRSA 2WB1P 3PW8C 4AHXA 3PW8A 5IYCL 4ITTA 1OTKA 5FFDA 5MFPA 5M5YL 3VV9A 2Z5PA 4WFN1 3WWLA 2HTNA 1NXEA 3P8BA 3HL1A 3QD8A 1LTLA 3F32A 3E6SA 3KYXA 3HJYB 3SS2A 4LQVA 5IY0A 5M3ML 1O9RA 1BFYA 3O7RA 2AR0A 1R0HA 3PVTB 4A3LL 2QL0A 4U671 2V8TA 3HOXL 5D8OA 1IU5A 1Z6OM 4ITWA 4ZL5A 2L0ZA 3DBYA 2E2IL 4A3EL 5JDOA 4U3GA 1RCDA 5LBHA 1S30A 1S2ZA 2CKCA 3ISEA 1MOJA 1QYBA 1VJXA 1RB9A 3HOZL 5GADc 3O7SA 3E1QA 1CAAA 3TA8A 4PG1A 3M3YL 5J8WA 1BQ8A 4TO9A 1Y1VL 2B5ID 3IS8A 5K2ME 1YUXA 5IX6A 1I6HL 2HVYC 4LQNA 1RCCA 2M4YA 1OWCA 3FVBA 3QB9A 3E1OA 2JI3A 3HJWB 3Q4QA 4EVEA 1YK4A 2GYQA 4QIWP 3RE7A 3QQCE 2ITBA 2JA8L 4ME3A 1JIGA 2Y44A 5D8RA 3SHXA 4TODA 4EVBA 3F34A 1BRFA 4BXXL 1VCXA 4MN9A 5CZUA 3GGYA 3KYWA 3P2AA 1LKMA 3N6OA 4AHWA 2M6OA 2OC5A 3RZDL 1Y1WL 2V8UA 1TJOA 4DZ0A 4AI1A 3OJ5A 1RCIA 5J9VA 4C3JL 4V196 5GAHc 3PZAA 3E1PA 3GTGL 2WTLA 2CEIA 2PVXA 3S1QL 1DX8A 1R0IA 4LPJA 3CQZL 2GYDA 1B71A 4XKTA 2PYBA 3FSEA 1TKOA 3RYGA 4M34A 4C3IL 2ZG7X 1VLGA 3AF9X 2NYDA 3HAXC 5JVH1 5H1Sc 2V2IA 2RDVA 3I4NL 4ZMCA 3OGHA 5JKLA 2FG8A 2YW6A 1DVBA 3UOFA 2NVXL 5GN8A 1CADA 2CHPA 1B13A 3PKJA 1LKPA 1UVHA 3D19A 2XJVA 4MUDA 2GMGA 1SMUA 4B8CD 3PIO1 1IU6A 1F30A 4GS7D 1GWGA 1NNQA 4W4KB 1WCML 4REUA 3BT5A 3ZG6A 5C44L 3JZ9A 1WJVA 1R0JA 1DPSA 2Z5RA 4JADA 3GTOL 1O9IA 2D5KA 4RC5B 3RZTA 4Z3BA 4LYUA 4AM2A 5GU3X 3Q4NA 4IXKA 1K83L 3H0GL 1IESA 4M33A 3LWRB 3NOZX 4QUWA 4DI0A 2CN6A 2EY4E 2N02A 4CVRA 2YW7A 5FFAA 1NF4A 4CYBA 2FKZA 1I3QL 3I4ML 3PVRB 2BE5D 2CF7A 3KYUA 5GU0X 4Y08A 5DM71 3BVIA 1S24A 4ZN1B 5JDOB 4ZN3B 2PVEA 3AK8A 3JR7A 4AI2A 3S16L 2FHAA 1RWDA 3PIP1 3WVWA 3FRSA 3BVLA 4ERUA 4ZL6A 4IWKA 5EINC 2VUML 4YWLA 1BFRA 4DYUA 4A3FL 1SMMA 1TWCL 3PW1A 1Z4AA 1R03A 5FFBA 5MLC3 3U90A 1BE7A 2ZA8A 4KVRA 3H99A 5J93A 3M4OL 3V3KB 1RYQA 1TWFL 1I50L 5D8PA 3S17L 3LPEB 1ZUJA 5J8SA 1H96A 1EUMA 2G4HA 4P18A 4PG0A 4G6BA 3F36A 4Y7NL 2C41A 2XKQA 3A9QA 3AF8X 4E40A 3R2OA 4RC7A 5FLML 4ETRA 5FFEA 3WWNB 2W0OA 2A6ED 4AHYA 2V15A 3SH6A 4AI3A 5GAEc 3WVUA 3HOVL 2V2SA 4AR4A 3EZ0A 4LPMA 3KYYA 1NF6A 2UX1A 4TPUA 2VZBA 5CMQA 2V0EA 5MGNA 5D8XA 2XJRA 1B2OA 5D8QA 2B63L 3S14L 1KRQA 3KA8A 2JA7L 4WJG4 5I4JA 5IYDL 1C09A 2CR8A 2J9UB 3S2HL 3AJQA 3BVFA 5HQOA 3J7Z1 4CVPA 1S3QA 4YXMA 4XXBB 1TWAL 3AJPA 3K35A 4UY81 2C6BA 4X0JA 4A3JL 3MQKB 2V2NA 4AR6A 2F7NA 3VNXA 4AR3A 3F39A 4PGKA 3LWOB 3Q4OA 2MS3A 5MFZA 2FL0A 2CKAA 1R0GA 3WVVA 2XJMA 4KXRB 1SQ3A 2VL6A 2KKDA 1R9TL 2Z90A 3FDJA 5FJ8L 1N1QA 5E1UA 3IU3I 3L0MA 2ERSA 1J30A 2AYJA 2WWXB 3F33A 5GN8B 4BBSL 2CN7A 5M5WL 1IW7D 1JKVA 2QF9A 3RAVA 2DSXA 3B08B 5M5XL 4LYXA 2WLUA 1RDVA 1YK5A 1XZ1A 3PL5A 5DM61 2MGYA 4DYYA 5IP7L 4AHZA 4II4A 4ZLWA 2PPTA 4BY1L 3H7GA 4AM4A 1VZGA 2OKCA 5JACA 2XJTA 4TOFA 4RC6B 1H7VA 3B0AB 3HOWL 1FHMA 3KA9A 4A3BL 3HIUA 1PFWA 5E2DA 1IERA 4A3GL 2LCQA 3R2KA 3C21A 3PVYB 4AM5A 4CMYV 4DYZA 5JKMG 1VELA 1JI5A 3ERZA 3QVDA 2ZG9X 2WAQP 3PO2L 2IU2A 2G38B 5GAGc 4A3CL 2XJUA 4MXPA 2RFKB 1E8JA 1OWBA 2QQYA 3H97A 2E2JL 3HKZP 1T9QA 4TW3A 3RGDA 3GTKL 4EVCA 3GTQL 2Z6MA 3GTML 1L8IA 2C2FA 3R2SA 1PFVA 3PKIA 3S15L 5LS9A 2ZURX 2JA5L 2Y3QA 5ERKA 4EVDA 2KN9A 5HJFA 1BCFA 1ZS3A 1RCEA 1TWGL 4CMYA 3KA3A 3BVEA 3MSUA 3EGMA 1L8HA 3PW1B 8RXNA 4XGSA 4CVTA 3F38A 3S1ML 1AEWA 1TWHL 1JI4A 1ODHA 2ZIXA 2CHIA 4YXJA 3QHBA 1ZRPA 1NFVA 3VVAA 1B2JA 3BVKA 3QHCA 5D8SA 3MPSA 3PO3L 3VPBE 2ZA7A 3IQ1A 2C2UA 1BG7A 3AJOA 4BBRL 4DE6A 3EZUA 2JD60 4Y52L 3H9CA 2BK6A 5MF6A 4A93L 2K2DA 2CWLA 3RBCA 5C6FA 3GVYA 2FG4A 5C4JL 4E6KA 3RD0A 3FI6A 3R2LA 4E6YA 2NVTL 2A68D 1IRNA 2Z5QA 4YKHA 2BJYA 3A44A 2BW1A 4TOAA 5HJHA 4CY9A 3H3VM 2XJOA 4RC8A 4POGA 2JA6L 3FKIL 2V2OA 4A25A 3NP2X 1JTSA
chains in the Genus database with same CATH topology
3R2MA 3J7Y1 3F35A 3KA4A 1YUZA 3M6JA 3FRRA 2M6PA 2OH3A 4OYNA 5K52A 4RXNA 4PGIA 2C6RA 5HU6D 1T9PA 3Q4RA 4JAGA 3BKNA 2Z3QB 3GE4A 4R42A 2C6AA 2X170 4POFA 2V2LA 4LQHA 1VEIA 4RC5A 4TOCA 2WLAA 4JAFA 2YJJA 4TOBA 4II4B 1NXGA 3GHQA 3KYVA 3AF7X 4TOGA 4ISPA 3KX9A 2V2RA 3E1LA 3PVRA 4CVSA 1DATA 1LKOA 2VXXA 3F37A 4DYXA 2XJQA 4KVQA 4TOEA 2YJKA 2ZG8X 2PYAA 4XKUA 4TOHA 2V2PA 1QGHA 5JKMA 1XZ3A 3KHKA 3C23A 2HR5A 2FJCA 5K53A 3ISFA 4MY7A 3UNOA 4LQJA 3KWOA 4CYAA 3RZ6A 5AN9H 1T9OA 5AI2A 3LKDA 1R0FA 4ISMA 5D8YA 3AK9A 1Z92B 3R2RA 3GGZA 1BQ9A 1QCVA 3QZ3A 2XJNA 1MFRA 3PVTA 2V0FA 1F33A 4AI0A 1JGCA 2CLBA 3C1ZA 4ZKHA 5RXNA 4M35A 4ZKWA 4YVZA 2XJPA 1JREA 5AXSA 4ZJKA 2M4VA 2H12A 4LHNA 3UFBA 1RYTA 4TVMA 3A68A 4YWMA 2V3BB 1TKPA 2CIHA 3W54A 4LHLA 2VXIA 4ML5A 4M32A 1Z6OA 4DASA 2JD70 5LG2A 1YV1A 2CLUA 5FFCA 4MKUA 1RDGA 1TK6A 3PWQC 4JAEA 3IS7A 1RCGA 3PWQA 2FZFA 5AI3A 3KXUA 2ERJA 1JYBA 1UMNA 1LB3A 1SMWA 3UOIA 3JZAB 4LPNA 2PSMC 3C1YA 2O5JD 1FHAA 4RC7B 4MJYA 4AR5A 6RXNA 3NFPI 2A69D 1IROA 3LNLA 3T9JA 4IWJA 1VZIA 3E6RA 4RC6A 2RBDA 5JKLG 5LG8A 2C2JA 3E1NA 4W4LB 5EIOC 2V2MA 2BKCA 3KA6A 3PWFA 3ES3A 5GU1X 2A6HD 3E1JA 5GU2X 3PVYA 3E2CA 3NP0X 3WNWA 2ZA6A 3SE1A 3SIDA 5GOUA 2Z3RB 7RXNA 4ZTTA 3E1MA 4Z5SA 5FEJA 5JVG1 5CMRA 1VEQA 2JD80 1JKUA 4XKSA 4ZKXA 2IB0A 2JI1A 2XJSA 5ERJA 2JI2A 2GS4A 3R2HA 4XGHA 2FFXJ 2V2JA 4KVSA 1FHHA 2IY4A 3KDQA 4K9FA 1SOFA 2XGWA 1VZHA 1HRSA 3PW8C 4AHXA 3PW8A 4ITTA 1OTKA 5FFDA 5MFPA 3VV9A 2Z5PA 4WFN1 3WWLA 2HTNA 1NXEA 3P8BA 3HL1A 3QD8A 1LTLA 3F32A 3E6SA 3KYXA 3SS2A 4LQVA 5IY0A 1O9RA 1BFYA 3O7RA 2AR0A 1R0HA 3PVTB 2QL0A 4U671 2V8TA 5D8OA 1IU5A 1Z6OM 4ITWA 4ZL5A 2L0ZA 3DBYA 5JDOA 4U3GA 1RCDA 5LBHA 1S30A 1S2ZA 2CKCA 3ISEA 1MOJA 1QYBA 1VJXA 1RB9A 5GADc 3O7SA 3E1QA 1CAAA 3TA8A 4PG1A 5J8WA 1BQ8A 4TO9A 2B5ID 3IS8A 5K2ME 1YUXA 5IX6A 4LQNA 1RCCA 2M4YA 1OWCA 3FVBA 3QB9A 3E1OA 2JI3A 3Q4QA 4EVEA 1YK4A 2GYQA 3RE7A 3QQCE 2ITBA 4ME3A 1JIGA 2Y44A 5D8RA 3SHXA 4TODA 4EVBA 3F34A 1BRFA 1VCXA 4MN9A 5CZUA 3GGYA 3KYWA 3P2AA 1LKMA 3N6OA 4AHWA 2M6OA 2OC5A 2V8UA 1TJOA 4DZ0A 4AI1A 3OJ5A 1RCIA 5J9VA 4V196 5GAHc 3PZAA 3E1PA 2WTLA 2CEIA 2PVXA 1DX8A 1R0IA 4LPJA 2GYDA 1B71A 4XKTA 2PYBA 3FSEA 1TKOA 3RYGA 4M34A 2ZG7X 1VLGA 3AF9X 2NYDA 5JVH1 5H1Sc 2V2IA 2RDVA 4ZMCA 3OGHA 5JKLA 2FG8A 2YW6A 1DVBA 3UOFA 5GN8A 1CADA 2CHPA 1B13A 3PKJA 1LKPA 1UVHA 3D19A 2XJVA 4MUDA 2GMGA 1SMUA 4B8CD 3PIO1 1IU6A 1F30A 4GS7D 1GWGA 1NNQA 4W4KB 4REUA 3BT5A 3ZG6A 3JZ9A 1WJVA 1R0JA 1DPSA 2Z5RA 4JADA 1O9IA 2D5KA 4RC5B 3RZTA 4Z3BA 4LYUA 4AM2A 5GU3X 3Q4NA 4IXKA 1IESA 4M33A 3NOZX 4QUWA 4DI0A 2CN6A 2N02A 4CVRA 2YW7A 5FFAA 1NF4A 4CYBA 2FKZA 3PVRB 2BE5D 2CF7A 3KYUA 5GU0X 4Y08A 5DM71 3BVIA 1S24A 4ZN1B 5JDOB 4ZN3B 2PVEA 3AK8A 4AI2A 2FHAA 1RWDA 3PIP1 3WVWA 3FRSA 3BVLA 4ERUA 4ZL6A 4IWKA 5EINC 4YWLA 1BFRA 4DYUA 1SMMA 3PW1A 1Z4AA 1R03A 5FFBA 5MLC3 3U90A 1BE7A 2ZA8A 4KVRA 5J93A 3V3KB 1RYQA 5D8PA 3LPEB 1ZUJA 5J8SA 1H96A 1EUMA 2G4HA 4P18A 4PG0A 4G6BA 3F36A 2C41A 2XKQA 3A9QA 3AF8X 4E40A 3R2OA 4RC7A 4ETRA 5FFEA 3WWNB 2W0OA 2A6ED 4AHYA 2V15A 3SH6A 4AI3A 5GAEc 3WVUA 2V2SA 4AR4A 3EZ0A 4LPMA 3KYYA 1NF6A 2UX1A 4TPUA 2VZBA 5CMQA 2V0EA 5MGNA 5D8XA 2XJRA 1B2OA 5D8QA 1KRQA 3KA8A 4WJG4 5I4JA 1C09A 2CR8A 2J9UB 3AJQA 3BVFA 5HQOA 3J7Z1 4CVPA 1S3QA 4YXMA 4XXBB 3AJPA 3K35A 4UY81 2C6BA 4X0JA 2V2NA 4AR6A 2F7NA 3VNXA 4AR3A 3F39A 4PGKA 3Q4OA 2MS3A 5MFZA 2FL0A 2CKAA 1R0GA 3WVVA 2XJMA 4KXRB 1SQ3A 2VL6A 2KKDA 2Z90A 1N1QA 5E1UA 3IU3I 3L0MA 2ERSA 1J30A 2AYJA 2WWXB 3F33A 5GN8B 2CN7A 1IW7D 1JKVA 2QF9A 3RAVA 2DSXA 3B08B 4LYXA 2WLUA 1RDVA 1YK5A 1XZ1A 5DM61 2MGYA 4DYYA 4AHZA 4II4A 4ZLWA 2PPTA 3H7GA 4AM4A 1VZGA 2OKCA 5JACA 2XJTA 4TOFA 4RC6B 1H7VA 3B0AB 1FHMA 3KA9A 3HIUA 5E2DA 1IERA 2LCQA 3R2KA 3C21A 3PVYB 4AM5A 4CMYV 4DYZA 5JKMG 1VELA 1JI5A 3ERZA 3QVDA 2ZG9X 2IU2A 2G38B 5GAGc 2XJUA 4MXPA 1E8JA 1OWBA 2QQYA 1T9QA 4TW3A 3RGDA 4EVCA 2Z6MA 1L8IA 2C2FA 3R2SA 3PKIA 5LS9A 2ZURX 2Y3QA 5ERKA 4EVDA 2KN9A 5HJFA 1BCFA 1ZS3A 1RCEA 4CMYA 3KA3A 3BVEA 3MSUA 3EGMA 1L8HA 3PW1B 8RXNA 4XGSA 4CVTA 3F38A 1AEWA 1JI4A 1ODHA 2ZIXA 2CHIA 4YXJA 3QHBA 1ZRPA 1NFVA 3VVAA 1B2JA 3BVKA 3QHCA 5D8SA 3MPSA 3VPBE 2ZA7A 3IQ1A 2C2UA 1BG7A 3AJOA 4DE6A 3EZUA 2JD60 2BK6A 5MF6A 2K2DA 2CWLA 3RBCA 5C6FA 3GVYA 2FG4A 4E6KA 3RD0A 3FI6A 3R2LA 4E6YA 2A68D 1IRNA 2Z5QA 4YKHA 2BJYA 3A44A 2BW1A 4TOAA 5HJHA 4CY9A 2XJOA 4RC8A 4POGA 2V2OA 4A25A 3NP2X 1JTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2M A;  3F35 A;  3KA4 A;  1YUZ A;  2OH3 A;  4OYN A;  5K52 A;  4RXN A;  4PGI A;  2C6R A;  1T9P A;  3Q4R A;  3BKN A;  3GE4 A;  4R42 A;  2X17 0;  4POF A;  2V2L A;  4LQH A;  1VEI A;  4RC5 A;  4TOC A;  2WLA A;  2YJJ A;  4TOB A;  4II4 B;  3GHQ A;  3KYV A;  3AF7 X;  4TOG A;  4ISP A;  3KX9 A;  2V2R A;  3E1L A;  3PVR A;  4CVS A;  1DAT A;  1LKO A;  2VXX A;  3F37 A;  4DYX A;  4KVQ A;  4TOE A;  2YJK A;  2ZG8 X;  2PYA A;  4XKU A;  4TOH A;  2V2P A;  1QGH A;  5JKM A;  1XZ3 A;  2HR5 A;  2FJC A;  5K53 A;  3ISF A;  4MY7 A;  3UNO A;  4LQJ A;  3KWO A;  4CYA A;  3RZ6 A;  1T9O A;  5AI2 A;  1R0F A;  4ISM A;  5D8Y A;  3AK9 A;  3R2R A;  1QCV A;  1BQ9 A;  3QZ3 A;  2XJN A;  1MFR A;  3PVT A;  1F33 A;  1JGC A;  2CLB A;  5RXN A;  4ZKH A;  4M35 A;  4ZKW A;  1JRE A;  5AXS A;  4ZJK A;  1RYT A;  3A68 A;  4YWM A;  2V3B B;  1TKP A;  2CIH A;  2VXI A;  4ML5 A;  4M32 A;  1Z6O A;  4DAS A;  2JD7 0;  5LG2 A;  1YV1 A;  2CLU A;  5FFC A;  4MKU A;  1RDG A;  1TK6 A;  3PWQ C;  3IS7 A;  1RCG A;  3PWQ A;  2FZF A;  5AI3 A;  3KXU A;  1JYB A;  1UMN A;  1LB3 A;  1SMW A;  3UOI A;  4LPN A;  1FHA A;  4RC7 B;  4MJY A;  4AR5 A;  6RXN A;  1IRO A;  3T9J A;  4IWJ A;  3E6R A;  4RC6 A;  2RBD A;  5JKL G;  5LG8 A;  2C2J A;  3E1N A;  2V2M A;  2BKC A;  3KA6 A;  3PWF A;  3ES3 A;  5GU1 X;  3E1J A;  5GU2 X;  3PVY A;  3E2C A;  3NP0 X;  3WNW A;  2ZA6 A;  3SE1 A;  3SID A;  5GOU A;  7RXN A;  4ZTT A;  3E1M A;  4Z5S A;  5FEJ A;  5CMR A;  1VEQ A;  2JD8 0;  1JKU A;  4XKS A;  4ZKX A;  2IB0 A;  5ERJ A;  2GS4 A;  3R2H A;  2FFX J;  2V2J A;  4KVS A;  1FHH A;  2IY4 A;  4K9F A;  1SOF A;  2XGW A;  1HRS A;  3PW8 C;  3PW8 A;  4ITT A;  1OTK A;  5FFD A;  2Z5P A;  2HTN A;  3HL1 A;  3QD8 A;  1LTL A;  3F32 A;  3E6S A;  3KYX A;  3SS2 A;  4LQV A;  5IY0 A;  1O9R A;  1BFY A;  3O7R A;  1R0H A;  3PVT B;  2QL0 A;  5D8O A;  1IU5 A;  1Z6O M;  4ITW A;  4ZL5 A;  4U3G A;  1RCD A;  5LBH A;  1S30 A;  1S2Z A;  3ISE A;  1MOJ A;  1QYB A;  1VJX A;  1RB9 A;  3O7S A;  3E1Q A;  1CAA A;  3TA8 A;  4PG1 A;  5J8W A;  1BQ8 A;  4TO9 A;  3IS8 A;  1YUX A;  5IX6 A;  4LQN A;  1RCC A;  2M4Y A;  3FVB A;  3QB9 A;  3E1O A;  3Q4Q A;  4EVE A;  1YK4 A;  2GYQ A;  3RE7 A;  2ITB A;  4ME3 A;  1JIG A;  5D8R A;  3SHX A;  4TOD A;  4EVB A;  3F34 A;  1BRF A;  1VCX A;  4MN9 A;  5CZU A;  3KYW A;  1LKM A;  2OC5 A;  1TJO A;  4DZ0 A;  3OJ5 A;  1RCI A;  5J9V A;  3PZA A;  3E1P A;  2WTL A;  2CEI A;  2PVX A;  1DX8 A;  1R0I A;  4LPJ A;  2GYD A;  1B71 A;  4XKT A;  2PYB A;  3FSE A;  1TKO A;  3RYG A;  4M34 A;  2ZG7 X;  1VLG A;  3AF9 X;  2V2I A;  2RDV A;  4ZMC A;  3OGH A;  5JKL A;  2FG8 A;  2YW6 A;  1DVB A;  3UOF A;  5GN8 A;  1CAD A;  2CHP A;  1B13 A;  1LKP A;  1UVH A;  4MUD A;  2GMG A;  1SMU A;  1IU6 A;  1F30 A;  1GWG A;  1NNQ A;  4REU A;  3BT5 A;  1R0J A;  1DPS A;  2Z5R A;  1O9I A;  2D5K A;  4RC5 B;  3RZT A;  4Z3B A;  4LYU A;  4AM2 A;  5GU3 X;  3Q4N A;  4IXK A;  1IES A;  4M33 A;  3NOZ X;  4QUW A;  4DI0 A;  2CN6 A;  4CVR A;  2YW7 A;  5FFA A;  1NF4 A;  4CYB A;  2FKZ A;  3PVR B;  2CF7 A;  3KYU A;  5GU0 X;  4Y08 A;  3BVI A;  1S24 A;  2PVE A;  3AK8 A;  2FHA A;  1RWD A;  3WVW A;  3BVL A;  4ERU A;  4ZL6 A;  4IWK A;  4YWL A;  1BFR A;  4DYU A;  1SMM A;  3PW1 A;  1Z4A A;  1R03 A;  5FFB A;  3U90 A;  1BE7 A;  2ZA8 A;  4KVR A;  5J93 A;  5D8P A;  1ZUJ A;  5J8S A;  1H96 A;  1EUM A;  2G4H A;  4P18 A;  4PG0 A;  3F36 A;  2C41 A;  2XKQ A;  3A9Q A;  3AF8 X;  3R2O A;  4RC7 A;  4ETR A;  5FFE A;  2W0O A;  2V15 A;  3SH6 A;  3WVU A;  2V2S A;  4AR4 A;  3EZ0 A;  4LPM A;  3KYY A;  1NF6 A;  2UX1 A;  4TPU A;  2VZB A;  5CMQ A;  5D8X A;  1B2O A;  5D8Q A;  1KRQ A;  3KA8 A;  5I4J A;  1C09 A;  3AJQ A;  3BVF A;  5HQO A;  4CVP A;  1S3Q A;  3AJP A;  2V2N A;  4AR6 A;  2F7N A;  3VNX A;  4AR3 A;  3F39 A;  4PGK A;  3Q4O A;  2MS3 A;  2FL0 A;  1R0G A;  3WVV A;  2XJM A;  1SQ3 A;  2VL6 A;  2KKD A;  2Z90 A;  1N1Q A;  5E1U A;  1J30 A;  3F33 A;  5GN8 B;  2CN7 A;  1JKV A;  2QF9 A;  3RAV A;  2DSX A;  4LYX A;  2WLU A;  1RDV A;  1YK5 A;  1XZ1 A;  4DYY A;  4II4 A;  4ZLW A;  3H7G A;  4AM4 A;  5JAC A;  1H7V A;  4TOF A;  4RC6 B;  1FHM A;  3KA9 A;  3HIU A;  5E2D A;  1IER A;  2LCQ A;  3R2K A;  4CMY V;  3PVY B;  4AM5 A;  4DYZ A;  5JKM G;  1VEL A;  1JI5 A;  3ERZ A;  3QVD A;  2ZG9 X;  2IU2 A;  1E8J A;  2QQY A;  1T9Q A;  4TW3 A;  3RGD A;  4EVC A;  2Z6M A;  1L8I A;  2C2F A;  3R2S A;  5LS9 A;  2ZUR X;  2Y3Q A;  5ERK A;  4EVD A;  2KN9 A;  5HJF A;  1BCF A;  1ZS3 A;  1RCE A;  4CMY A;  3KA3 A;  3BVE A;  3EGM A;  1L8H A;  3PW1 B;  8RXN A;  4XGS A;  4CVT A;  3F38 A;  1AEW A;  1JI4 A;  2CHI A;  3QHB A;  1ZRP A;  1NFV A;  1B2J A;  3BVK A;  3QHC A;  5D8S A;  3MPS A;  2ZA7 A;  3IQ1 A;  2C2U A;  1BG7 A;  3AJO A;  4DE6 A;  3EZU A;  2JD6 0;  2BK6 A;  2K2D A;  3RBC A;  5C6F A;  3GVY A;  2FG4 A;  4E6K A;  3RD0 A;  3FI6 A;  3R2L A;  1IRN A;  2Z5Q A;  4YKH A;  2BJY A;  3A44 A;  2BW1 A;  4TOA A;  5HJH A;  4CY9 A;  2XJO A;  4RC8 A;  4POG A;  2V2O A;  4A25 A;  3NP2 X;  1JTS A; 
#chains in the Genus database with same CATH topology
 3R2M A;  3J7Y 1;  3F35 A;  3KA4 A;  2Y0S P;  1YUZ A;  1PFY A;  3M6J A;  3FRR A;  2M6P A;  2OH3 A;  4OYN A;  5K52 A;  1PFU A;  2APO B;  5IP9 L;  4RXN A;  4PGI A;  2C6R A;  5HU6 D;  1T9P A;  3S2D L;  2R93 L;  3Q4R A;  4JAG A;  3BKN A;  2Z3Q B;  5IYB L;  3GE4 A;  4R42 A;  2C6A A;  2X17 0;  4POF A;  2V2L A;  4LQH A;  1VEI A;  4RC5 A;  4TOC A;  5C4X L;  2WLA A;  4JAF A;  2YJJ A;  4TOB A;  4II4 B;  4X6A L;  1NXG A;  3GHQ A;  3KYV A;  3AF7 X;  4TOG A;  3HOY L;  4ISP A;  3KX9 A;  2V2R A;  3E1L A;  3PVR A;  4CVS A;  1DAT A;  1LKO A;  2VXX A;  3F37 A;  4DYX A;  4AYB P;  2XJQ A;  4KVQ A;  4TOE A;  2YJK A;  2ZG8 X;  2PYA A;  4XKU A;  4TOH A;  2V2P A;  1QGH A;  5JKM A;  1XZ3 A;  3LWV B;  3KHK A;  3C23 A;  2HR5 A;  2FJC A;  5K53 A;  3ISF A;  4MY7 A;  5M3F L;  3UNO A;  4LQJ A;  3KWO A;  3LWQ B;  4CYA A;  3RZ6 A;  5AN9 H;  1T9O A;  5AI2 A;  3LKD A;  1R0F A;  4ISM A;  5D8Y A;  2E2H L;  3AK9 A;  1Z92 B;  3R2R A;  3GGZ A;  1BQ9 A;  1QCV A;  3QZ3 A;  2XJN A;  1MFR A;  3PVT A;  2V0F A;  1F33 A;  2PMZ P;  4AI0 A;  1JGC A;  2CLB A;  3C1Z A;  4ZKH A;  5RXN A;  4M35 A;  4ZKW A;  4A3K L;  4YVZ A;  2XJP A;  1JRE A;  5AXS A;  3S1R L;  4ZJK A;  4C2M 1;  4BY7 L;  2M4V A;  4A3D L;  2H12 A;  1F4L A;  2NVY L;  4LHN A;  3UFB A;  1RYT A;  4TVM A;  3A68 A;  4YWM A;  2V3B B;  1TKP A;  2YU9 L;  2NVQ L;  2CIH A;  3W54 A;  2R92 L;  4A3I L;  4LHL A;  2VXI A;  4ML5 A;  4M32 A;  1Z6O A;  4DAS A;  2JD7 0;  5LG2 A;  1YV1 A;  2CLU A;  5FFC A;  4MKU A;  4C3H L;  1RDG A;  1TK6 A;  3PWQ C;  3H9B A;  3IS7 A;  1RCG A;  3PWQ A;  4JAE A;  3GTJ L;  2FZF A;  1PZX A;  5AI3 A;  3KXU A;  5C3E L;  2ERJ A;  1JYB A;  1UMN A;  1LB3 A;  1SMW A;  3UOI A;  3JZA B;  3RZO L;  4LPN A;  2PSM C;  3C1Y A;  2O5J D;  1FHA A;  4RC7 B;  4MJY A;  4AR5 A;  6RXN A;  3NFP I;  2AUS B;  2A69 D;  1IRO A;  3LNL A;  3T9J A;  4IWJ A;  3K7A L;  3HOU L;  1VZI A;  3E6R A;  4RC6 A;  2RBD A;  5JKL G;  5LG8 A;  2C2J A;  3E1N A;  3GTL L;  4W4L B;  5EIO C;  2V2M A;  2BKC A;  3KA6 A;  3PWF A;  3ES3 A;  5GU1 X;  2A6H D;  3E1J A;  5GU2 X;  3PVY A;  3E2C A;  3NP0 X;  3WNW A;  2ZA6 A;  3SE1 A;  3SID A;  1QQT A;  5GOU A;  2AQC A;  2Z3R B;  7RXN A;  4ZTT A;  3E1M A;  4Z5S A;  2R7Z L;  5FEJ A;  1SFO L;  5JVG 1;  5CMR A;  1VEQ A;  2JD8 0;  1JKU A;  4XKS A;  4ZKX A;  1P7P A;  2IB0 A;  2JI1 A;  2XJS A;  5ERJ A;  2JI2 A;  3LWP B;  2GS4 A;  3R2H A;  4XGH A;  2FFX J;  2V2J A;  4KVS A;  1FHH A;  2IY4 A;  3KDQ A;  3S1N L;  4K9F A;  4A3M L;  3GTP L;  1SOF A;  2XGW A;  1VZH A;  1HRS A;  2WB1 P;  3PW8 C;  4AHX A;  3PW8 A;  5IYC L;  4ITT A;  1OTK A;  5FFD A;  5MFP A;  5M5Y L;  3VV9 A;  2Z5P A;  4WFN 1;  3WWL A;  2HTN A;  1NXE A;  3P8B A;  3HL1 A;  3QD8 A;  1LTL A;  3F32 A;  3E6S A;  3KYX A;  3HJY B;  3SS2 A;  4LQV A;  5IY0 A;  5M3M L;  1O9R A;  1BFY A;  3O7R A;  2AR0 A;  1R0H A;  3PVT B;  4A3L L;  2QL0 A;  4U67 1;  2V8T A;  3HOX L;  5D8O A;  1IU5 A;  1Z6O M;  4ITW A;  4ZL5 A;  2L0Z A;  3DBY A;  2E2I L;  4A3E L;  5JDO A;  4U3G A;  1RCD A;  5LBH A;  1S30 A;  1S2Z A;  2CKC A;  3ISE A;  1MOJ A;  1QYB A;  1VJX A;  1RB9 A;  3HOZ L;  5GAD c;  3O7S A;  3E1Q A;  1CAA A;  3TA8 A;  4PG1 A;  3M3Y L;  5J8W A;  1BQ8 A;  4TO9 A;  1Y1V L;  2B5I D;  3IS8 A;  5K2M E;  1YUX A;  5IX6 A;  1I6H L;  2HVY C;  4LQN A;  1RCC A;  2M4Y A;  1OWC A;  3FVB A;  3QB9 A;  3E1O A;  2JI3 A;  3HJW B;  3Q4Q A;  4EVE A;  1YK4 A;  2GYQ A;  4QIW P;  3RE7 A;  3QQC E;  2ITB A;  2JA8 L;  4ME3 A;  1JIG A;  2Y44 A;  5D8R A;  3SHX A;  4TOD A;  4EVB A;  3F34 A;  1BRF A;  4BXX L;  1VCX A;  4MN9 A;  5CZU A;  3GGY A;  3KYW A;  3P2A A;  1LKM A;  3N6O A;  4AHW A;  2M6O A;  2OC5 A;  3RZD L;  1Y1W L;  2V8U A;  1TJO A;  4DZ0 A;  4AI1 A;  3OJ5 A;  1RCI A;  5J9V A;  4C3J L;  4V19 6;  5GAH c;  3PZA A;  3E1P A;  3GTG L;  2WTL A;  2CEI A;  2PVX A;  3S1Q L;  1DX8 A;  1R0I A;  4LPJ A;  3CQZ L;  2GYD A;  1B71 A;  4XKT A;  2PYB A;  3FSE A;  1TKO A;  3RYG A;  4M34 A;  4C3I L;  2ZG7 X;  1VLG A;  3AF9 X;  2NYD A;  3HAX C;  5JVH 1;  5H1S c;  2V2I A;  2RDV A;  3I4N L;  4ZMC A;  3OGH A;  5JKL A;  2FG8 A;  2YW6 A;  1DVB A;  3UOF A;  2NVX L;  5GN8 A;  1CAD A;  2CHP A;  1B13 A;  3PKJ A;  1LKP A;  1UVH A;  3D19 A;  2XJV A;  4MUD A;  2GMG A;  1SMU A;  4B8C D;  3PIO 1;  1IU6 A;  1F30 A;  4GS7 D;  1GWG A;  1NNQ A;  4W4K B;  1WCM L;  4REU A;  3BT5 A;  3ZG6 A;  5C44 L;  3JZ9 A;  1WJV A;  1R0J A;  1DPS A;  2Z5R A;  4JAD A;  3GTO L;  1O9I A;  2D5K A;  4RC5 B;  3RZT A;  4Z3B A;  4LYU A;  4AM2 A;  5GU3 X;  3Q4N A;  4IXK A;  1K83 L;  3H0G L;  1IES A;  4M33 A;  3LWR B;  3NOZ X;  4QUW A;  4DI0 A;  2CN6 A;  2EY4 E;  2N02 A;  4CVR A;  2YW7 A;  5FFA A;  1NF4 A;  4CYB A;  2FKZ A;  1I3Q L;  3I4M L;  3PVR B;  2BE5 D;  2CF7 A;  3KYU A;  5GU0 X;  4Y08 A;  5DM7 1;  3BVI A;  1S24 A;  4ZN1 B;  5JDO B;  4ZN3 B;  2PVE A;  3AK8 A;  3JR7 A;  4AI2 A;  3S16 L;  2FHA A;  1RWD A;  3PIP 1;  3WVW A;  3FRS A;  3BVL A;  4ERU A;  4ZL6 A;  4IWK A;  5EIN C;  2VUM L;  4YWL A;  1BFR A;  4DYU A;  4A3F L;  1SMM A;  1TWC L;  3PW1 A;  1Z4A A;  1R03 A;  5FFB A;  5MLC 3;  3U90 A;  1BE7 A;  2ZA8 A;  4KVR A;  3H99 A;  5J93 A;  3M4O L;  3V3K B;  1RYQ A;  1TWF L;  1I50 L;  5D8P A;  3S17 L;  3LPE B;  1ZUJ A;  5J8S A;  1H96 A;  1EUM A;  2G4H A;  4P18 A;  4PG0 A;  4G6B A;  3F36 A;  4Y7N L;  2C41 A;  2XKQ A;  3A9Q A;  3AF8 X;  4E40 A;  3R2O A;  4RC7 A;  5FLM L;  4ETR A;  5FFE A;  3WWN B;  2W0O A;  2A6E D;  4AHY A;  2V15 A;  3SH6 A;  4AI3 A;  5GAE c;  3WVU A;  3HOV L;  2V2S A;  4AR4 A;  3EZ0 A;  4LPM A;  3KYY A;  1NF6 A;  2UX1 A;  4TPU A;  2VZB A;  5CMQ A;  2V0E A;  5MGN A;  5D8X A;  2XJR A;  1B2O A;  5D8Q A;  2B63 L;  3S14 L;  1KRQ A;  3KA8 A;  2JA7 L;  4WJG 4;  5I4J A;  5IYD L;  1C09 A;  2CR8 A;  2J9U B;  3S2H L;  3AJQ A;  3BVF A;  5HQO A;  3J7Z 1;  4CVP A;  1S3Q A;  4YXM A;  4XXB B;  1TWA L;  3AJP A;  3K35 A;  4UY8 1;  2C6B A;  4X0J A;  4A3J L;  3MQK B;  2V2N A;  4AR6 A;  2F7N A;  3VNX A;  4AR3 A;  3F39 A;  4PGK A;  3LWO B;  3Q4O A;  2MS3 A;  5MFZ A;  2FL0 A;  2CKA A;  1R0G A;  3WVV A;  2XJM A;  4KXR B;  1SQ3 A;  2VL6 A;  2KKD A;  1R9T L;  2Z90 A;  3FDJ A;  5FJ8 L;  1N1Q A;  5E1U A;  3IU3 I;  3L0M A;  2ERS A;  1J30 A;  2AYJ A;  2WWX B;  3F33 A;  5GN8 B;  4BBS L;  2CN7 A;  5M5W L;  1IW7 D;  1JKV A;  2QF9 A;  3RAV A;  2DSX A;  3B08 B;  5M5X L;  4LYX A;  2WLU A;  1RDV A;  1YK5 A;  1XZ1 A;  3PL5 A;  5DM6 1;  2MGY A;  4DYY A;  5IP7 L;  4AHZ A;  4II4 A;  4ZLW A;  2PPT A;  4BY1 L;  3H7G A;  4AM4 A;  1VZG A;  2OKC A;  5JAC A;  2XJT A;  4TOF A;  4RC6 B;  1H7V A;  3B0A B;  3HOW L;  1FHM A;  3KA9 A;  4A3B L;  3HIU A;  1PFW A;  5E2D A;  1IER A;  4A3G L;  2LCQ A;  3R2K A;  3C21 A;  3PVY B;  4AM5 A;  4CMY V;  4DYZ A;  5JKM G;  1VEL A;  1JI5 A;  3ERZ A;  3QVD A;  2ZG9 X;  2WAQ P;  3PO2 L;  2IU2 A;  2G38 B;  5GAG c;  4A3C L;  2XJU A;  4MXP A;  2RFK B;  1E8J A;  1OWB A;  2QQY A;  3H97 A;  2E2J L;  3HKZ P;  1T9Q A;  4TW3 A;  3RGD A;  3GTK L;  4EVC A;  3GTQ L;  2Z6M A;  3GTM L;  1L8I A;  2C2F A;  3R2S A;  1PFV A;  3PKI A;  3S15 L;  5LS9 A;  2ZUR X;  2JA5 L;  2Y3Q A;  5ERK A;  4EVD A;  2KN9 A;  5HJF A;  1BCF A;  1ZS3 A;  1RCE A;  1TWG L;  4CMY A;  3KA3 A;  3BVE A;  3MSU A;  3EGM A;  1L8H A;  3PW1 B;  8RXN A;  4XGS A;  4CVT A;  3F38 A;  3S1M L;  1AEW A;  1TWH L;  1JI4 A;  1ODH A;  2ZIX A;  2CHI A;  4YXJ A;  3QHB A;  1ZRP A;  1NFV A;  3VVA A;  1B2J A;  3BVK A;  3QHC A;  5D8S A;  3MPS A;  3PO3 L;  3VPB E;  2ZA7 A;  3IQ1 A;  2C2U A;  1BG7 A;  3AJO A;  4BBR L;  4DE6 A;  3EZU A;  2JD6 0;  4Y52 L;  3H9C A;  2BK6 A;  5MF6 A;  4A93 L;  2K2D A;  2CWL A;  3RBC A;  5C6F A;  3GVY A;  2FG4 A;  5C4J L;  4E6K A;  3RD0 A;  3FI6 A;  3R2L A;  4E6Y A;  2NVT L;  2A68 D;  1IRN A;  2Z5Q A;  4YKH A;  2BJY A;  3A44 A;  2BW1 A;  4TOA A;  5HJH A;  4CY9 A;  3H3V M;  2XJO A;  4RC8 A;  4POG A;  2JA6 L;  3FKI L;  2V2O A;  4A25 A;  3NP2 X;  1JTS A; 
#chains in the Genus database with same CATH homology
 3R2M A;  3J7Y 1;  3F35 A;  3KA4 A;  1YUZ A;  3M6J A;  3FRR A;  2M6P A;  2OH3 A;  4OYN A;  5K52 A;  4RXN A;  4PGI A;  2C6R A;  5HU6 D;  1T9P A;  3Q4R A;  4JAG A;  3BKN A;  2Z3Q B;  3GE4 A;  4R42 A;  2C6A A;  2X17 0;  4POF A;  2V2L A;  4LQH A;  1VEI A;  4RC5 A;  4TOC A;  2WLA A;  4JAF A;  2YJJ A;  4TOB A;  4II4 B;  1NXG A;  3GHQ A;  3KYV A;  3AF7 X;  4TOG A;  4ISP A;  3KX9 A;  2V2R A;  3E1L A;  3PVR A;  4CVS A;  1DAT A;  1LKO A;  2VXX A;  3F37 A;  4DYX A;  2XJQ A;  4KVQ A;  4TOE A;  2YJK A;  2ZG8 X;  2PYA A;  4XKU A;  4TOH A;  2V2P A;  1QGH A;  5JKM A;  1XZ3 A;  3KHK A;  3C23 A;  2HR5 A;  2FJC A;  5K53 A;  3ISF A;  4MY7 A;  3UNO A;  4LQJ A;  3KWO A;  4CYA A;  3RZ6 A;  5AN9 H;  1T9O A;  5AI2 A;  3LKD A;  1R0F A;  4ISM A;  5D8Y A;  3AK9 A;  1Z92 B;  3R2R A;  3GGZ A;  1BQ9 A;  1QCV A;  3QZ3 A;  2XJN A;  1MFR A;  3PVT A;  2V0F A;  1F33 A;  4AI0 A;  1JGC A;  2CLB A;  3C1Z A;  4ZKH A;  5RXN A;  4M35 A;  4ZKW A;  4YVZ A;  2XJP A;  1JRE A;  5AXS A;  4ZJK A;  2M4V A;  2H12 A;  4LHN A;  3UFB A;  1RYT A;  4TVM A;  3A68 A;  4YWM A;  2V3B B;  1TKP A;  2CIH A;  3W54 A;  4LHL A;  2VXI A;  4ML5 A;  4M32 A;  1Z6O A;  4DAS A;  2JD7 0;  5LG2 A;  1YV1 A;  2CLU A;  5FFC A;  4MKU A;  1RDG A;  1TK6 A;  3PWQ C;  4JAE A;  3IS7 A;  1RCG A;  3PWQ A;  2FZF A;  5AI3 A;  3KXU A;  2ERJ A;  1JYB A;  1UMN A;  1LB3 A;  1SMW A;  3UOI A;  3JZA B;  4LPN A;  2PSM C;  3C1Y A;  2O5J D;  1FHA A;  4RC7 B;  4MJY A;  4AR5 A;  6RXN A;  3NFP I;  2A69 D;  1IRO A;  3LNL A;  3T9J A;  4IWJ A;  1VZI A;  3E6R A;  4RC6 A;  2RBD A;  5JKL G;  5LG8 A;  2C2J A;  3E1N A;  4W4L B;  5EIO C;  2V2M A;  2BKC A;  3KA6 A;  3PWF A;  3ES3 A;  5GU1 X;  2A6H D;  3E1J A;  5GU2 X;  3PVY A;  3E2C A;  3NP0 X;  3WNW A;  2ZA6 A;  3SE1 A;  3SID A;  5GOU A;  2Z3R B;  7RXN A;  4ZTT A;  3E1M A;  4Z5S A;  5FEJ A;  5JVG 1;  5CMR A;  1VEQ A;  2JD8 0;  1JKU A;  4XKS A;  4ZKX A;  2IB0 A;  2JI1 A;  2XJS A;  5ERJ A;  2JI2 A;  2GS4 A;  3R2H A;  4XGH A;  2FFX J;  2V2J A;  4KVS A;  1FHH A;  2IY4 A;  3KDQ A;  4K9F A;  1SOF A;  2XGW A;  1VZH A;  1HRS A;  3PW8 C;  4AHX A;  3PW8 A;  4ITT A;  1OTK A;  5FFD A;  5MFP A;  3VV9 A;  2Z5P A;  4WFN 1;  3WWL A;  2HTN A;  1NXE A;  3P8B A;  3HL1 A;  3QD8 A;  1LTL A;  3F32 A;  3E6S A;  3KYX A;  3SS2 A;  4LQV A;  5IY0 A;  1O9R A;  1BFY A;  3O7R A;  2AR0 A;  1R0H A;  3PVT B;  2QL0 A;  4U67 1;  2V8T A;  5D8O A;  1IU5 A;  1Z6O M;  4ITW A;  4ZL5 A;  2L0Z A;  3DBY A;  5JDO A;  4U3G A;  1RCD A;  5LBH A;  1S30 A;  1S2Z A;  2CKC A;  3ISE A;  1MOJ A;  1QYB A;  1VJX A;  1RB9 A;  5GAD c;  3O7S A;  3E1Q A;  1CAA A;  3TA8 A;  4PG1 A;  5J8W A;  1BQ8 A;  4TO9 A;  2B5I D;  3IS8 A;  5K2M E;  1YUX A;  5IX6 A;  4LQN A;  1RCC A;  2M4Y A;  1OWC A;  3FVB A;  3QB9 A;  3E1O A;  2JI3 A;  3Q4Q A;  4EVE A;  1YK4 A;  2GYQ A;  3RE7 A;  3QQC E;  2ITB A;  4ME3 A;  1JIG A;  2Y44 A;  5D8R A;  3SHX A;  4TOD A;  4EVB A;  3F34 A;  1BRF A;  1VCX A;  4MN9 A;  5CZU A;  3GGY A;  3KYW A;  3P2A A;  1LKM A;  3N6O A;  4AHW A;  2M6O A;  2OC5 A;  2V8U A;  1TJO A;  4DZ0 A;  4AI1 A;  3OJ5 A;  1RCI A;  5J9V A;  4V19 6;  5GAH c;  3PZA A;  3E1P A;  2WTL A;  2CEI A;  2PVX A;  1DX8 A;  1R0I A;  4LPJ A;  2GYD A;  1B71 A;  4XKT A;  2PYB A;  3FSE A;  1TKO A;  3RYG A;  4M34 A;  2ZG7 X;  1VLG A;  3AF9 X;  2NYD A;  5JVH 1;  5H1S c;  2V2I A;  2RDV A;  4ZMC A;  3OGH A;  5JKL A;  2FG8 A;  2YW6 A;  1DVB A;  3UOF A;  5GN8 A;  1CAD A;  2CHP A;  1B13 A;  3PKJ A;  1LKP A;  1UVH A;  3D19 A;  2XJV A;  4MUD A;  2GMG A;  1SMU A;  4B8C D;  3PIO 1;  1IU6 A;  1F30 A;  4GS7 D;  1GWG A;  1NNQ A;  4W4K B;  4REU A;  3BT5 A;  3ZG6 A;  3JZ9 A;  1WJV A;  1R0J A;  1DPS A;  2Z5R A;  4JAD A;  1O9I A;  2D5K A;  4RC5 B;  3RZT A;  4Z3B A;  4LYU A;  4AM2 A;  5GU3 X;  3Q4N A;  4IXK A;  1IES A;  4M33 A;  3NOZ X;  4QUW A;  4DI0 A;  2CN6 A;  2N02 A;  4CVR A;  2YW7 A;  5FFA A;  1NF4 A;  4CYB A;  2FKZ A;  3PVR B;  2BE5 D;  2CF7 A;  3KYU A;  5GU0 X;  4Y08 A;  5DM7 1;  3BVI A;  1S24 A;  4ZN1 B;  5JDO B;  4ZN3 B;  2PVE A;  3AK8 A;  4AI2 A;  2FHA A;  1RWD A;  3PIP 1;  3WVW A;  3FRS A;  3BVL A;  4ERU A;  4ZL6 A;  4IWK A;  5EIN C;  4YWL A;  1BFR A;  4DYU A;  1SMM A;  3PW1 A;  1Z4A A;  1R03 A;  5FFB A;  5MLC 3;  3U90 A;  1BE7 A;  2ZA8 A;  4KVR A;  5J93 A;  3V3K B;  1RYQ A;  5D8P A;  3LPE B;  1ZUJ A;  5J8S A;  1H96 A;  1EUM A;  2G4H A;  4P18 A;  4PG0 A;  4G6B A;  3F36 A;  2C41 A;  2XKQ A;  3A9Q A;  3AF8 X;  4E40 A;  3R2O A;  4RC7 A;  4ETR A;  5FFE A;  3WWN B;  2W0O A;  2A6E D;  4AHY A;  2V15 A;  3SH6 A;  4AI3 A;  5GAE c;  3WVU A;  2V2S A;  4AR4 A;  3EZ0 A;  4LPM A;  3KYY A;  1NF6 A;  2UX1 A;  4TPU A;  2VZB A;  5CMQ A;  2V0E A;  5MGN A;  5D8X A;  2XJR A;  1B2O A;  5D8Q A;  1KRQ A;  3KA8 A;  4WJG 4;  5I4J A;  1C09 A;  2CR8 A;  2J9U B;  3AJQ A;  3BVF A;  5HQO A;  3J7Z 1;  4CVP A;  1S3Q A;  4YXM A;  4XXB B;  3AJP A;  3K35 A;  4UY8 1;  2C6B A;  4X0J A;  2V2N A;  4AR6 A;  2F7N A;  3VNX A;  4AR3 A;  3F39 A;  4PGK A;  3Q4O A;  2MS3 A;  5MFZ A;  2FL0 A;  2CKA A;  1R0G A;  3WVV A;  2XJM A;  4KXR B;  1SQ3 A;  2VL6 A;  2KKD A;  2Z90 A;  1N1Q A;  5E1U A;  3IU3 I;  3L0M A;  2ERS A;  1J30 A;  2AYJ A;  2WWX B;  3F33 A;  5GN8 B;  2CN7 A;  1IW7 D;  1JKV A;  2QF9 A;  3RAV A;  2DSX A;  3B08 B;  4LYX A;  2WLU A;  1RDV A;  1YK5 A;  1XZ1 A;  5DM6 1;  2MGY A;  4DYY A;  4AHZ A;  4II4 A;  4ZLW A;  2PPT A;  3H7G A;  4AM4 A;  1VZG A;  2OKC A;  5JAC A;  2XJT A;  4TOF A;  4RC6 B;  1H7V A;  3B0A B;  1FHM A;  3KA9 A;  3HIU A;  5E2D A;  1IER A;  2LCQ A;  3R2K A;  3C21 A;  3PVY B;  4AM5 A;  4CMY V;  4DYZ A;  5JKM G;  1VEL A;  1JI5 A;  3ERZ A;  3QVD A;  2ZG9 X;  2IU2 A;  2G38 B;  5GAG c;  2XJU A;  4MXP A;  1E8J A;  1OWB A;  2QQY A;  1T9Q A;  4TW3 A;  3RGD A;  4EVC A;  2Z6M A;  1L8I A;  2C2F A;  3R2S A;  3PKI A;  5LS9 A;  2ZUR X;  2Y3Q A;  5ERK A;  4EVD A;  2KN9 A;  5HJF A;  1BCF A;  1ZS3 A;  1RCE A;  4CMY A;  3KA3 A;  3BVE A;  3MSU A;  3EGM A;  1L8H A;  3PW1 B;  8RXN A;  4XGS A;  4CVT A;  3F38 A;  1AEW A;  1JI4 A;  1ODH A;  2ZIX A;  2CHI A;  4YXJ A;  3QHB A;  1ZRP A;  1NFV A;  3VVA A;  1B2J A;  3BVK A;  3QHC A;  5D8S A;  3MPS A;  3VPB E;  2ZA7 A;  3IQ1 A;  2C2U A;  1BG7 A;  3AJO A;  4DE6 A;  3EZU A;  2JD6 0;  2BK6 A;  5MF6 A;  2K2D A;  2CWL A;  3RBC A;  5C6F A;  3GVY A;  2FG4 A;  4E6K A;  3RD0 A;  3FI6 A;  3R2L A;  4E6Y A;  2A68 D;  1IRN A;  2Z5Q A;  4YKH A;  2BJY A;  3A44 A;  2BW1 A;  4TOA A;  5HJH A;  4CY9 A;  2XJO A;  4RC8 A;  4POG A;  2V2O A;  4A25 A;  3NP2 X;  1JTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...