2HR5A

Pf1283- rubrerythrin from pyrococcus furiosus iron bound form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title Crystal structure of iron bound Rubrerythrin from Pyrococcus Furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Metal binding protein
total genus 62
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2hr5A01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2hr5A02
5I4JA 3E1LA 3KXUA 4ZTTA 1DATA 1SMUA 2C6RA 3R2RA 2ITBA 5ERJA 4P18A 2CHPA 4MKUA 3WNWA 3RZTA 4ME3A 4RC5A 4YWLA 3BVIA 3E6SA 5IX6A 4ZL6A 2HR5A 1JYBA 2ZURX 3SIDA 3UNOA 2Y3QA 5GN8A 3GVYA 2UX1A 2XJOA 3AF9X 2VXIA 1JI4A 3ES3A 3AF8X 2CIHA 1RCGA 4RC6B 3PW1B 4U3GA 2FFXJ 3F36A 3KA6A 2ZG9X 4CVRA 2Z6MA 1B2OA 1ZRPA 4II4B 1YK4A 2CF7A 3KYWA 2V2NA 4DZ0A 1FHHA 1YV1A 2GYQA 4ISMA 3OJ5A 5D8XA 2V2OA 2ZA8A 1BFRA 1XZ1A 1T9OA 1RDGA 2V2SA 3SE1A 2C41A 3QHCA 4Z3BA 5J8WA 1TKOA 1TJOA 3PVTB 2IY4A 3Q4QA 3PVRA 5ERKA 2Z5QA 2PYBA 3GHQA 3SHXA 2CLUA 1XZ3A 1JTSA 3FI6A 4PGIA 2V15A 2ZA6A 2XGWA 2PYAA 5J9VA 4CVSA 2Z5RA 3TA8A 3E1PA 4ZL5A 4LQVA 1BCFA 5JKMG 2FG4A 5D8YA 4MN9A 1UVHA 5CZUA 4ZKHA 1DPSA 1VCXA 1EUMA 1BFYA 4M35A 1QGHA 3AJQA 1VEQA 4DYXA 3F38A 2BW1A 2FG8A 3F35A 2C2UA 4LPMA 1VLGA 1LKOA 3FSEA 5IY0A 1L8HA 4ETRA 3EZUA 2WTLA 4TW3A 3AK9A 3KX9A 4KVSA 1L8IA 2ZG7X 5HQOA 3EGMA 1ZS3A 4LPJA 4TOCA 6RXNA 2W0OA 1IERA 2YJKA 4A25A 5FFEA 4LYUA 2C2JA 4QUWA 4R42A 2YW7A 1VJXA 3F37A 3UOIA 4MUDA 1R0FA 1MFRA 3O7SA 3RBCA 2RBDA 1LKMA 2V3BB 5K53A 4ZKXA 1YUXA 5LBHA 2V2LA 1TK6A 1JIGA 3RD0A 4ZMCA 4RC7A 3ERZA 4AR4A 2FKZA 3RZ6A 4XGSA 1B2JA 3A68A 4CVPA 1CAAA 1S2ZA 5FFDA 1IRNA 4AR3A 5FFCA 1R0HA 3QVDA 2JD60 4DYZA 1C09A 4M32A 3PWQA 1NF6A 5D8QA 2D5KA 3PW8A 4DYYA 2JD70 1R0JA 1Z6OM 4POFA 4M33A 4RC5B 3PW1A 1MOJA 5D8PA 1AEWA 4DI0A 2KN9A 1QYBA 1JGCA 4EVDA 3VNXA 5GN8B 4XKTA 3KYYA 2BKCA 2DSXA 3QD8A 3HL1A 2OH3A 2V2MA 2WLAA 3BVFA 4ML5A 1JKUA 2CHIA 2PVXA 3BKNA 1N1QA 2GYDA 1BQ8A 2CN6A 4TPUA 3SS2A 4CMYV 3RGDA 4PG0A 3IQ1A 3R2SA 4TODA 3PVTA 5JKLA 4OYNA 1Z4AA 1HRSA 2YW6A 3R2OA 3E1JA 2MS3A 1LB3A 3HIUA 4LQJA 4RXNA 2KKDA 2Z5PA 2ZG8X 5HJHA 1JKVA 3EZ0A 2XJNA 3PVRB 3PZAA 2G4HA 1RYTA 2GMGA 4LPNA 4REUA 2JD80 3WVVA 2FL0A 3KYUA 4MJYA 4E6KA 5FEJA 2IB0A 4Y08A 3O7RA 3ISEA 3KA9A 4K9FA 2CEIA 5K52A 1UMNA 2F7NA 3E1OA 3PVYA 5GU0X 3KA4A 2OC5A 4AM5A 1CADA 4YWMA 3KYVA 5FFBA 4PG1A 3A44A 5J93A 1H96A 3H7GA 4ITWA 3BVKA 4PGKA 3F34A 4CY9A 1IU6A 2QF9A 1Z6OA 1RCDA 4MY7A 4KVQA 1S3QA 3ISFA 1RCIA 2QL0A 2WLUA 4POGA 4AM4A 1ZUJA 3F33A 4DYUA 7RXNA 1B71A 5LG2A 1IROA 1IU5A 1BRFA 1F30A 2CLBA 1RDVA 1R0IA 1H7VA 5E1UA 2LCQA 4XKSA 2C2FA 1F33A 5GU1X 2YJJA 3R2HA 3R2MA 2V2RA 4RC8A 5LG8A 2FJCA 4TOEA 5GOUA 2BJYA 4TO9A 1RB9A 1NNQA 4CMYA 3Q4NA 4TOAA 1SQ3A 5GU3X 1BE7A 4CVTA 1NFVA 2BK6A 2Z90A 5LS9A 2XJMA 5D8OA 1QCVA 4AM2A 1YK5A 1R0GA 3QHBA 3IS7A 4RC7B 3A9QA 2K2DA 4RC6A 2GS4A 4ZKWA 3R2KA 4TOGA 3AJPA 3NP2X 2M4YA 3QB9A 1SMMA 3OGHA 5AI3A 4II4A 4IWKA 5JKMA 3BT5A 1JI5A 1O9IA 1R03A 4LQNA 3RYGA 5CMQA 3Q4OA 2PVEA 4TOFA 1B13A 4DE6A 5E2DA 2HTNA 3E1MA 2QQYA 1VEIA 4EVEA 3WVWA 1LTLA 1RCEA 2V2IA 1SOFA 3IS8A 1OTKA 1DVBA 1IESA 5AXSA 1GWGA 2ZA7A 5J8SA 1S30A 1RCCA 3E6RA 5HJFA 4TOHA 3E1QA 4LYXA 4Z5SA 3U90A 3MPSA 4DASA 3AJOA 3UOFA 4AR5A 1DX8A 2VL6A 1S24A 3KA8A 3PWFA 4ITTA 5RXNA 1BG7A 3RAVA 3KYXA 8RXNA 4LQHA 3E2CA 4AR6A 1KRQA 1T9PA 4M34A 5AI2A 4XKUA 3PWQC 1NF4A 1TKPA 4ERUA 3PW8C 4ISPA 5D8RA 3F39A 4TOBA 4CYAA 2XKQA 1LKPA 4ZLWA 2RDVA 1FHMA 3KWOA 3Q4RA 3F32A 3BVLA 3NOZX 3AK8A 5C6FA 3E1NA 3SH6A 4IWJA 3PVYB 4KVRA 2VZBA 2V2JA 3RE7A 3WVUA 5JKLG 1RWDA 1JREA 4YKHA 1O9RA 4EVBA 1VELA 3NP0X 3KA3A 2X170 1SMWA 2CN7A 3GE4A 1FHAA 4CYBA 2FZFA 3T9JA 3AF7X 1J30A 5CMRA 5D8SA 2V2PA 4ZJKA 5GU2X 1YUZA 2FHAA 2VXXA 3FVBA 3R2LA 1T9QA 5JACA 5FFAA 3BVEA 3QZ3A 1E8JA 4EVCA 1BQ9A 2IU2A 4IXKA
chains in the Genus database with same CATH superfamily
5I4JA 3E1LA 3KXUA 3H9CA 4ZTTA 1DATA 5MFPA 1P7PA 1SMUA 2C6RA 3R2RA 2ITBA 4A3FL 5ERJA 3S1RL 1F4LA 4P18A 2CHPA 4MKUA 3WNWA 2L0ZA 3FKIL 3RZTA 1PFYA 4YVZA 1TWHL 4RC5A 4ME3A 5DM61 4YWLA 5IP7L 3BVIA 3E6SA 5IX6A 4ZL6A 2HR5A 1JYBA 2ZURX 3SIDA 3VPBE 3UNOA 2Y3QA 5GN8A 3GVYA 2UX1A 2XJOA 2B5ID 3AF9X 2VXIA 1JI4A 3ES3A 4MXPA 3AF8X 2CIHA 1RCGA 4RC6B 3S1NL 3PW1B 4U3GA 2FFXJ 3F36A 3KA6A 1I50L 1Z92B 2E2HL 2ZG9X 4CVRA 2Z6MA 1B2OA 4UY81 1ZRPA 4II4B 3J7Z1 4A3DL 1YK4A 2CF7A 3KYWA 2V2NA 4DZ0A 1FHHA 1YV1A 2GYQA 3B08B 4ISMA 3OJ5A 5D8XA 3GTKL 2JA7L 2V2OA 2ZA8A 1BFRA 1XZ1A 3GTOL 3RZOL 1T9OA 1RDGA 2V2SA 4A3GL 3SE1A 2C41A 3QHCA 4Z3BA 5J8WA 1TKOA 2MGYA 1TJOA 2OKCA 3PVTB 3S16L 1OWBA 2IY4A 3Q4QA 1PFUA 3PVRA 5ERKA 2Z5QA 5GAGc 3DBYA 2PYBA 3GHQA 3SHXA 2CLUA 1XZ3A 1VZHA 2APOB 1JTSA 3FI6A 4PGIA 1RYQA 2V15A 2ZA6A 2XGWA 2Z3RB 2PYAA 2JA6L 2AR0A 5J9VA 5H1Sc 4CVSA 2Z5RA 3TA8A 1PFWA 3E1PA 4ZL5A 3I4NL 4LQVA 1BCFA 5JKMG 2A6HD 3S2DL 2FG4A 2XJSA 3LKDA 5D8YA 4MN9A 5C4XL 3PIP1 3LNLA 1UVHA 5CZUA 4ZKHA 1DPSA 1VCXA 5EINC 4Y52L 2CR8A 1EUMA 5IYDL 5MGNA 1BFYA 4M35A 1QGHA 3AJQA 2HVYC 1VEQA 3HOYL 4DYXA 3F38A 2A6ED 2PMZP 2R93L 2BW1A 2FG8A 5C3EL 3F35A 2C2UA 4LPMA 1VLGA 4BXXL 1LKOA 3FSEA 5IY0A 1TWGL 1L8HA 3PIO1 4ETRA 3EZUA 2WTLA 4TW3A 4W4KB 3HOXL 3AK9A 3KX9A 4KVSA 1L8IA 1I3QL 3LPEB 5M5XL 2ZG7X 5HQOA 2V8TA 2ERJA 3EGMA 1ZS3A 4LPJA 1TWAL 4TOCA 3S1ML 6RXNA 2W0OA 3C1YA 1IERA 2YJKA 2XJRA 4A25A 5FFEA 4LYUA 3LWPB 1I6HL 3S17L 2C2JA 4QUWA 4JADA 5M5YL 4R42A 2YW7A 1VJXA 3F37A 3UOIA 4MUDA 1R0FA 3VVAA 2VUML 2Y44A 1MFRA 3O7SA 2WAQP 3PL5A 3RBCA 2RBDA 1Y1WL 1LKMA 2V3BB 3K35A 2RFKB 4E6YA 5K53A 4ZKXA 2V0EA 1YUXA 5LBHA 2PSMC 3GTLL 2V2LA 1TK6A 4WJG4 5FJ8L 1JIGA 3RD0A 3FRRA 4ZMCA 2PPTA 5IYBL 4RC7A 3ERZA 4AR4A 1TWCL 2FKZA 3RZ6A 4XGSA 1B2JA 4TVMA 3A68A 2C6AA 4CVPA 3GTML 3HOZL 1CAAA 1S2ZA 5FFDA 1IRNA 4AI2A 5MFZA 4AR3A 5FFCA 1R0HA 2AYJA 3QVDA 2JD60 3S2HL 4DYZA 1C09A 4M32A 4LHLA 5C44L 3MQKB 3PWQA 3C21A 1NF6A 5D8QA 3JR7A 2D5KA 4GS7D 2WWXB 3PW8A 4DYYA 4KXRB 4A3EL 2JD70 1R0JA 1Z6OM 4POFA 4M33A 4RC5B 3PW1A 1MOJA 5D8PA 1AEWA 4XXBB 2NYDA 4DI0A 2JI1A 2KN9A 1QYBA 1VZGA 1JGCA 4EVDA 3VNXA 5GN8B 4XKTA 3KYYA 2BKCA 2DSXA 3QD8A 3HL1A 2OH3A 2V2MA 2WLAA 3BVFA 4ML5A 1JKUA 2CHIA 2PVXA 3NFPI 3BKNA 2XJVA 3M4OL 3W54A 1N1QA 2GYDA 1BQ8A 4JAGA 3HOVL 2CN6A 2JI3A 4TPUA 3SS2A 2JA5L 4CMYV 3RGDA 4PG0A 3IQ1A 3R2SA 4TODA 2CWLA 3PVTA 5JKLA 5JVH1 3GGZA 4OYNA 1OWCA 1Z4AA 1HRSA 2YW6A 3R2OA 4AHXA 4BY7L 3E1JA 3KDQA 2MS3A 1LB3A 3LWVB 2R7ZL 3HIUA 4LQJA 5JDOB 4RXNA 5M3ML 5MF6A 4A3LL 2KKDA 2Z5PA 2ZG8X 2AQCA 3H97A 5HJHA 1JKVA 3WWNB 3FDJA 3EZ0A 2XJNA 3PVRB 3PZAA 2G4HA 2C6BA 1RYTA 2GMGA 4LPNA 4REUA 2JI2A 2JD80 3WWLA 4AI3A 3WVVA 4AHYA 2FL0A 4A3KL 3KYUA 4MJYA 4E6KA 3S15L 3PKIA 5FEJA 2IB0A 3PKJA 4Y08A 3O7RA 3ISEA 3KA9A 4K9FA 2CEIA 3JZ9A 4QIWP 2BE5D 3HOWL 5K52A 1UMNA 2Y0SP 2F7NA 3E1OA 3PVYA 5GU0X 3KA4A 2OC5A 3HKZP 4AM5A 3QQCE 3VV9A 1CADA 4YWMA 4YXMA 3KYVA 4JAFA 5FFBA 4PG1A 3A44A 4C2M1 4A3ML 5GADc 2R92L 5J93A 4C3JL 1H96A 3H7GA 2EY4E 3MSUA 4ITWA 3BVKA 4PGKA 3F34A 4CY9A 1IU6A 4B8CD 2NVYL 2QF9A 1Z6OA 1RCDA 2N02A 4MY7A 4KVQA 1S3QA 5M3FL 3ISFA 3S1QL 1QQTA 1RCIA 2QL0A 2WLUA 4POGA 4AM4A 1ZUJA 3F33A 2M6OA 3GTJL 2G38B 3LWQB 4DYUA 2H12A 7RXNA 1B71A 5LG2A 1IROA 1IU5A 1BRFA 1F30A 2CLBA 1RDVA 3LWOB 1R0IA 4BY1L 1H7VA 5E1UA 2M6PA 2LCQA 4A3CL 1VZIA 4XKSA 2C2FA 1F33A 3HJYB 3UFBA 5GU1X 2YJJA 3ZG6A 3R2HA 3JZAB 3R2MA 1PFVA 2V2RA 4RC8A 4YXJA 5LG8A 4V196 2FJCA 4TOEA 3GGYA 5GOUA 2BJYA 4X6AL 4TO9A 1RB9A 4AHWA 1NNQA 4CMYA 3Q4NA 4A3JL 4TOAA 1SQ3A 5GU3X 1BE7A 5JVG1 4CVTA 4AI1A 3B0AB 1NFVA 2BK6A 2Z90A 3C1ZA 5LS9A 3IU3I 2J9UB 2XJMA 5D8OA 1QCVA 4AM2A 1WCML 1YK5A 2M4VA 1R0GA 3QHBA 3IS7A 4RC7B 3A9QA 5EIOC 2K2DA 4RC6A 2GS4A 4ZKWA 2WB1P 3R2KA 4TOGA 3P2AA 4BBRL 4A93L 3AJPA 3NP2X 2M4YA 3QB9A 1SMMA 2NVQL 3OGHA 5AI3A 4II4A 4IWKA 5JKMA 3BT5A 3S14L 1JI5A 1O9IA 1R03A 4LQNA 2AUSB 3RYGA 5CMQA 3Q4OA 2ERSA 5GAEc 2PVEA 5AN9H 4TOFA 1B13A 4DE6A 2XJUA 5E2DA 2HTNA 3E1MA 3J7Y1 2QQYA 1VEIA 3D19A 4EVEA 3WVWA 1LTLA 5K2ME 1RCEA 4AHZA 2V2IA 1SOFA 3IS8A 1PZXA 2CKCA 1OTKA 5GAHc 3GTQL 3M3YL 1DVBA 1IESA 5AXSA 4XGHA 1GWGA 2ZA7A 1TWFL 3HOUL 5J8SA 3FRSA 4C3IL 4LHNA 2E2JL 1S30A 3C23A 1RCCA 4X0JA 3M6JA 3E6RA 2Z3QB 5HJFA 3H99A 4TOHA 4ZN1B 3E1QA 4LYXA 4Z5SA 3U90A 3MPSA 4DASA 3AJOA 5JDOA 2XJPA 5FLML 5HU6D 3V3KB 4A3BL 3UOFA 4AR5A 1DX8A 2VL6A 1S24A 3KA8A 2NVTL 4BBSL 3PWFA 4ITTA 5RXNA 5C4JL 4Y7NL 1Y1VL 1BG7A 4W4LB 2XJTA 3RAVA 3GTGL 3KYXA 2V8UA 3P8BA 8RXNA 4G6BA 4LQHA 3E2CA 5IP9L 4AR6A 1KRQA 1T9PA 4M34A 4U671 3L0MA 5AI2A 4XKUA 3PWQC 1NF4A 2O5JD 1TKPA 1SFOL 4ERUA 3PW8C 2B63L 4ISPA 3H9BA 5D8RA 3LWRB 3F39A 4C3HL 4TOBA 4CYAA 2XKQA 1LKPA 4ZLWA 5IYCL 3CQZL 1K83L 2RDVA 1FHMA 3KWOA 2CKAA 2XJQA 3Q4RA 3F32A 1NXEA 3BVLA 3NOZX 3AK8A 3HAXC 2A68D 2NVXL 3H3VM 3KHKA 5C6FA 3E1NA 3SH6A 4IWJA 3PVYB 4KVRA 2VZBA 2V2JA 3RE7A 3WVUA 5JKLG 1RWDA 1JREA 4YKHA 1IW7D 1O9RA 4E40A 4EVBA 3GTPL 4ZN3B 3I4ML 2JA8L 1WJVA 1R9TL 1VELA 3NP0X 1NXGA 3KA3A 2X170 1SMWA 4WFN1 2CN7A 3GE4A 5DM71 3PO3L 1FHAA 4CYBA 2YU9L 2FZFA 3T9JA 2E2IL 3HJWB 3AF7X 1J30A 5CMRA 5D8SA 3H0GL 2ZIXA 2V0FA 3K7AL 5M5WL 2V2PA 1ODHA 4ZJKA 5GU2X 4AYBP 1YUZA 2FHAA 2VXXA 4JAEA 3FVBA 3N6OA 3R2LA 1T9QA 5JACA 5FFAA 5MLC3 3PO2L 2A69D 4A3IL 4AI0A 3BVEA 3QZ3A 1E8JA 4EVCA 3RZDL 1BQ9A 2IU2A 4IXKA
chains in the Genus database with same CATH topology
5I4JA 3E1LA 3KXUA 4ZTTA 1DATA 5MFPA 1SMUA 2C6RA 3R2RA 2ITBA 5ERJA 4P18A 2CHPA 4MKUA 3WNWA 2L0ZA 3RZTA 4YVZA 4ME3A 4RC5A 5DM61 4YWLA 3BVIA 3E6SA 5IX6A 4ZL6A 2HR5A 1JYBA 2ZURX 3SIDA 3VPBE 3UNOA 2Y3QA 5GN8A 3GVYA 2UX1A 2XJOA 2B5ID 3AF9X 2VXIA 1JI4A 3ES3A 4MXPA 3AF8X 2CIHA 1RCGA 4RC6B 3PW1B 4U3GA 2FFXJ 3F36A 3KA6A 1Z92B 4UY81 2ZG9X 4CVRA 2Z6MA 1B2OA 1ZRPA 4II4B 3J7Z1 1YK4A 2CF7A 3KYWA 2V2NA 4DZ0A 1FHHA 1YV1A 2GYQA 3B08B 4ISMA 3OJ5A 5D8XA 2V2OA 2ZA8A 1BFRA 1XZ1A 1T9OA 1RDGA 2V2SA 3SE1A 2C41A 3QHCA 4Z3BA 5J8WA 1TKOA 2MGYA 1TJOA 2OKCA 3PVTB 1OWBA 2IY4A 3Q4QA 3PVRA 5ERKA 2Z5QA 5GAGc 3DBYA 2PYBA 3GHQA 3SHXA 2CLUA 1XZ3A 1VZHA 1JTSA 3FI6A 4PGIA 1RYQA 2V15A 2ZA6A 2XGWA 2Z3RB 2PYAA 2AR0A 5J9VA 5H1Sc 4CVSA 2Z5RA 3TA8A 3E1PA 4ZL5A 4LQVA 1BCFA 5JKMG 2A6HD 2FG4A 2XJSA 3LKDA 5D8YA 4MN9A 3PIP1 3LNLA 1UVHA 5CZUA 4ZKHA 1DPSA 1VCXA 5EINC 2CR8A 1EUMA 5MGNA 1BFYA 4M35A 1QGHA 3AJQA 1VEQA 4DYXA 3F38A 2A6ED 2BW1A 2FG8A 3F35A 2C2UA 4LPMA 1VLGA 1LKOA 3FSEA 5IY0A 1L8HA 3PIO1 4ETRA 3EZUA 2WTLA 4TW3A 4W4KB 3AK9A 3KX9A 4KVSA 1L8IA 3LPEB 2ZG7X 5HQOA 2V8TA 2ERJA 3EGMA 1ZS3A 4LPJA 4TOCA 6RXNA 2W0OA 3C1YA 1IERA 2YJKA 2XJRA 4A25A 5FFEA 4LYUA 2C2JA 4QUWA 4JADA 4R42A 2YW7A 1VJXA 3F37A 3UOIA 4MUDA 1R0FA 3VVAA 2Y44A 1MFRA 3O7SA 3RBCA 2RBDA 1LKMA 2V3BB 3K35A 4E6YA 5K53A 4ZKXA 2V0EA 1YUXA 5LBHA 2PSMC 2V2LA 1TK6A 4WJG4 1JIGA 3RD0A 3FRRA 4ZMCA 2PPTA 4RC7A 3ERZA 4AR4A 2FKZA 3RZ6A 4XGSA 1B2JA 4TVMA 3A68A 2C6AA 4CVPA 1CAAA 1S2ZA 5FFDA 1IRNA 4AI2A 5MFZA 4AR3A 5FFCA 1R0HA 2AYJA 3QVDA 2JD60 4DYZA 1C09A 4M32A 4LHLA 3PWQA 3C21A 1NF6A 5D8QA 2D5KA 4GS7D 2WWXB 3PW8A 4DYYA 4KXRB 2JD70 1R0JA 1Z6OM 4POFA 4M33A 4RC5B 3PW1A 1MOJA 5D8PA 1AEWA 4XXBB 2NYDA 4DI0A 2JI1A 2KN9A 1QYBA 1VZGA 1JGCA 4EVDA 3VNXA 5GN8B 4XKTA 3KYYA 2BKCA 2DSXA 3QD8A 3HL1A 2OH3A 2V2MA 2WLAA 3BVFA 4ML5A 1JKUA 2CHIA 2PVXA 3NFPI 3BKNA 2XJVA 3W54A 1N1QA 2GYDA 1BQ8A 4JAGA 2CN6A 2JI3A 4TPUA 3SS2A 4CMYV 3RGDA 4PG0A 3IQ1A 3R2SA 4TODA 2CWLA 3PVTA 5JKLA 5JVH1 3GGZA 4OYNA 1OWCA 1Z4AA 1HRSA 2YW6A 3R2OA 4AHXA 3E1JA 3KDQA 2MS3A 1LB3A 3HIUA 4LQJA 5JDOB 4RXNA 5MF6A 2KKDA 2Z5PA 2ZG8X 5HJHA 1JKVA 3WWNB 3EZ0A 2XJNA 3PVRB 3PZAA 2G4HA 2C6BA 1RYTA 2GMGA 4LPNA 4REUA 2JI2A 2JD80 3WWLA 4AI3A 3WVVA 4AHYA 2FL0A 3KYUA 4MJYA 4E6KA 3PKIA 5FEJA 2IB0A 3PKJA 4Y08A 3O7RA 3ISEA 3KA9A 4K9FA 2CEIA 3JZ9A 2BE5D 5K52A 1UMNA 2F7NA 3E1OA 3PVYA 5GU0X 3KA4A 2OC5A 3QQCE 4AM5A 3VV9A 1CADA 4YWMA 4YXMA 3KYVA 4JAFA 5FFBA 4PG1A 3A44A 5GADc 5J93A 1H96A 3H7GA 3MSUA 4ITWA 3BVKA 4PGKA 3F34A 4CY9A 1IU6A 4B8CD 2QF9A 1Z6OA 1RCDA 2N02A 4MY7A 4KVQA 1S3QA 3ISFA 1RCIA 2QL0A 2WLUA 4POGA 4AM4A 1ZUJA 3F33A 2M6OA 2G38B 4DYUA 2H12A 7RXNA 1B71A 5LG2A 1IROA 1IU5A 1BRFA 1F30A 2CLBA 1RDVA 1R0IA 1H7VA 5E1UA 2M6PA 2LCQA 1VZIA 4XKSA 2C2FA 1F33A 3UFBA 5GU1X 2YJJA 3ZG6A 3R2HA 3JZAB 3R2MA 2V2RA 4RC8A 4YXJA 5LG8A 4V196 2FJCA 4TOEA 3GGYA 5GOUA 2BJYA 4TO9A 1RB9A 4AHWA 1NNQA 4CMYA 3Q4NA 4TOAA 1SQ3A 5GU3X 1BE7A 5JVG1 4CVTA 4AI1A 3B0AB 1NFVA 2BK6A 2Z90A 3C1ZA 5LS9A 3IU3I 2J9UB 2XJMA 5D8OA 1QCVA 4AM2A 1YK5A 2M4VA 1R0GA 5EIOC 3QHBA 3IS7A 4RC7B 3A9QA 2K2DA 4RC6A 2GS4A 4ZKWA 3P2AA 3R2KA 4TOGA 3AJPA 3NP2X 2M4YA 3QB9A 1SMMA 3OGHA 5AI3A 4II4A 4IWKA 5JKMA 3BT5A 1JI5A 1O9IA 1R03A 4LQNA 3RYGA 5CMQA 3Q4OA 2ERSA 5GAEc 2PVEA 5AN9H 4TOFA 1B13A 4DE6A 2XJUA 5E2DA 2HTNA 3E1MA 3J7Y1 2QQYA 1VEIA 3D19A 4EVEA 3WVWA 1LTLA 5K2ME 1RCEA 4AHZA 2V2IA 1SOFA 3IS8A 2CKCA 1OTKA 5GAHc 1DVBA 1IESA 5AXSA 4XGHA 1GWGA 2ZA7A 5J8SA 3FRSA 4LHNA 1S30A 3C23A 1RCCA 4X0JA 3M6JA 3E6RA 2Z3QB 5HJFA 4ZN1B 4TOHA 3E1QA 4LYXA 4Z5SA 3U90A 3MPSA 4DASA 3AJOA 5JDOA 2XJPA 5HU6D 3V3KB 3UOFA 4AR5A 1DX8A 2VL6A 1S24A 3KA8A 3PWFA 4ITTA 5RXNA 1BG7A 4W4LB 2XJTA 3RAVA 3KYXA 2V8UA 3P8BA 8RXNA 4G6BA 4LQHA 3E2CA 4AR6A 1KRQA 1T9PA 4M34A 4U671 3L0MA 5AI2A 4XKUA 3PWQC 1NF4A 2O5JD 1TKPA 4ERUA 3PW8C 4ISPA 5D8RA 3F39A 4TOBA 4CYAA 2XKQA 1LKPA 4ZLWA 2RDVA 1FHMA 3KWOA 2CKAA 2XJQA 3Q4RA 3F32A 1NXEA 3BVLA 3NOZX 3AK8A 2A68D 3KHKA 5C6FA 3E1NA 3SH6A 4IWJA 3PVYB 4KVRA 2VZBA 2V2JA 3RE7A 3WVUA 5JKLG 1RWDA 1JREA 4YKHA 1IW7D 1O9RA 4E40A 4EVBA 4ZN3B 1WJVA 1VELA 3NP0X 1NXGA 3KA3A 2X170 1SMWA 4WFN1 2CN7A 3GE4A 5DM71 1FHAA 4CYBA 2FZFA 3T9JA 3AF7X 1J30A 5CMRA 5D8SA 2ZIXA 2V0FA 1ODHA 2V2PA 4ZJKA 5GU2X 1YUZA 2FHAA 2VXXA 4JAEA 3FVBA 3N6OA 3R2LA 1T9QA 5JACA 5FFAA 5MLC3 2A69D 4AI0A 3BVEA 3QZ3A 1E8JA 4EVCA 1BQ9A 2IU2A 4IXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I4J A;  3E1L A;  3KXU A;  4ZTT A;  1DAT A;  1SMU A;  2C6R A;  3R2R A;  2ITB A;  5ERJ A;  4P18 A;  2CHP A;  4MKU A;  3WNW A;  3RZT A;  4ME3 A;  4RC5 A;  4YWL A;  3BVI A;  3E6S A;  5IX6 A;  4ZL6 A;  2HR5 A;  1JYB A;  2ZUR X;  3SID A;  3UNO A;  2Y3Q A;  5GN8 A;  3GVY A;  2UX1 A;  2XJO A;  3AF9 X;  2VXI A;  1JI4 A;  3ES3 A;  3AF8 X;  2CIH A;  1RCG A;  4RC6 B;  3PW1 B;  4U3G A;  2FFX J;  3F36 A;  3KA6 A;  2ZG9 X;  4CVR A;  2Z6M A;  1B2O A;  1ZRP A;  4II4 B;  1YK4 A;  2CF7 A;  3KYW A;  2V2N A;  4DZ0 A;  1FHH A;  1YV1 A;  2GYQ A;  4ISM A;  3OJ5 A;  5D8X A;  2V2O A;  2ZA8 A;  1BFR A;  1XZ1 A;  1T9O A;  1RDG A;  2V2S A;  3SE1 A;  2C41 A;  3QHC A;  4Z3B A;  5J8W A;  1TKO A;  1TJO A;  3PVT B;  2IY4 A;  3Q4Q A;  3PVR A;  5ERK A;  2Z5Q A;  2PYB A;  3GHQ A;  3SHX A;  2CLU A;  1XZ3 A;  1JTS A;  3FI6 A;  4PGI A;  2V15 A;  2ZA6 A;  2XGW A;  2PYA A;  5J9V A;  4CVS A;  2Z5R A;  3TA8 A;  3E1P A;  4ZL5 A;  4LQV A;  1BCF A;  5JKM G;  2FG4 A;  5D8Y A;  4MN9 A;  1UVH A;  5CZU A;  4ZKH A;  1DPS A;  1VCX A;  1EUM A;  1BFY A;  4M35 A;  1QGH A;  3AJQ A;  1VEQ A;  4DYX A;  3F38 A;  2BW1 A;  2FG8 A;  3F35 A;  2C2U A;  4LPM A;  1VLG A;  1LKO A;  3FSE A;  5IY0 A;  1L8H A;  4ETR A;  3EZU A;  2WTL A;  4TW3 A;  3AK9 A;  3KX9 A;  4KVS A;  1L8I A;  2ZG7 X;  5HQO A;  3EGM A;  1ZS3 A;  4LPJ A;  4TOC A;  6RXN A;  2W0O A;  1IER A;  2YJK A;  4A25 A;  5FFE A;  4LYU A;  2C2J A;  4QUW A;  4R42 A;  2YW7 A;  1VJX A;  3F37 A;  3UOI A;  4MUD A;  1R0F A;  1MFR A;  3O7S A;  3RBC A;  2RBD A;  1LKM A;  2V3B B;  5K53 A;  4ZKX A;  1YUX A;  5LBH A;  2V2L A;  1TK6 A;  1JIG A;  3RD0 A;  4ZMC A;  4RC7 A;  3ERZ A;  4AR4 A;  2FKZ A;  3RZ6 A;  4XGS A;  1B2J A;  3A68 A;  4CVP A;  1CAA A;  1S2Z A;  5FFD A;  1IRN A;  4AR3 A;  5FFC A;  1R0H A;  3QVD A;  2JD6 0;  4DYZ A;  1C09 A;  4M32 A;  3PWQ A;  1NF6 A;  5D8Q A;  2D5K A;  3PW8 A;  4DYY A;  2JD7 0;  1R0J A;  1Z6O M;  4POF A;  4M33 A;  4RC5 B;  3PW1 A;  1MOJ A;  5D8P A;  1AEW A;  4DI0 A;  2KN9 A;  1QYB A;  1JGC A;  4EVD A;  3VNX A;  5GN8 B;  4XKT A;  3KYY A;  2BKC A;  2DSX A;  3QD8 A;  3HL1 A;  2OH3 A;  2V2M A;  2WLA A;  3BVF A;  4ML5 A;  1JKU A;  2CHI A;  2PVX A;  3BKN A;  1N1Q A;  2GYD A;  1BQ8 A;  2CN6 A;  4TPU A;  3SS2 A;  4CMY V;  3RGD A;  4PG0 A;  3IQ1 A;  3R2S A;  4TOD A;  3PVT A;  5JKL A;  4OYN A;  1Z4A A;  1HRS A;  2YW6 A;  3R2O A;  3E1J A;  2MS3 A;  1LB3 A;  3HIU A;  4LQJ A;  4RXN A;  2KKD A;  2Z5P A;  2ZG8 X;  5HJH A;  1JKV A;  3EZ0 A;  2XJN A;  3PVR B;  3PZA A;  2G4H A;  1RYT A;  2GMG A;  4LPN A;  4REU A;  2JD8 0;  3WVV A;  2FL0 A;  3KYU A;  4MJY A;  4E6K A;  5FEJ A;  2IB0 A;  4Y08 A;  3O7R A;  3ISE A;  3KA9 A;  4K9F A;  2CEI A;  5K52 A;  1UMN A;  2F7N A;  3E1O A;  3PVY A;  5GU0 X;  3KA4 A;  2OC5 A;  4AM5 A;  1CAD A;  4YWM A;  3KYV A;  5FFB A;  4PG1 A;  3A44 A;  5J93 A;  1H96 A;  3H7G A;  4ITW A;  3BVK A;  4PGK A;  3F34 A;  4CY9 A;  1IU6 A;  2QF9 A;  1Z6O A;  1RCD A;  4MY7 A;  4KVQ A;  1S3Q A;  3ISF A;  1RCI A;  2QL0 A;  2WLU A;  4POG A;  4AM4 A;  1ZUJ A;  3F33 A;  4DYU A;  7RXN A;  1B71 A;  5LG2 A;  1IRO A;  1IU5 A;  1BRF A;  1F30 A;  2CLB A;  1RDV A;  1R0I A;  1H7V A;  5E1U A;  2LCQ A;  4XKS A;  2C2F A;  1F33 A;  5GU1 X;  2YJJ A;  3R2H A;  3R2M A;  2V2R A;  4RC8 A;  5LG8 A;  2FJC A;  4TOE A;  5GOU A;  2BJY A;  4TO9 A;  1RB9 A;  1NNQ A;  4CMY A;  3Q4N A;  4TOA A;  1SQ3 A;  5GU3 X;  1BE7 A;  4CVT A;  1NFV A;  2BK6 A;  2Z90 A;  5LS9 A;  2XJM A;  5D8O A;  1QCV A;  4AM2 A;  1YK5 A;  1R0G A;  3QHB A;  3IS7 A;  4RC7 B;  3A9Q A;  2K2D A;  4RC6 A;  2GS4 A;  4ZKW A;  3R2K A;  4TOG A;  3AJP A;  3NP2 X;  2M4Y A;  3QB9 A;  1SMM A;  3OGH A;  5AI3 A;  4II4 A;  4IWK A;  5JKM A;  3BT5 A;  1JI5 A;  1O9I A;  1R03 A;  4LQN A;  3RYG A;  5CMQ A;  3Q4O A;  2PVE A;  4TOF A;  1B13 A;  4DE6 A;  5E2D A;  2HTN A;  3E1M A;  2QQY A;  1VEI A;  4EVE A;  3WVW A;  1LTL A;  1RCE A;  2V2I A;  1SOF A;  3IS8 A;  1OTK A;  1DVB A;  1IES A;  5AXS A;  1GWG A;  2ZA7 A;  5J8S A;  1S30 A;  1RCC A;  3E6R A;  5HJF A;  4TOH A;  3E1Q A;  4LYX A;  4Z5S A;  3U90 A;  3MPS A;  4DAS A;  3AJO A;  3UOF A;  4AR5 A;  1DX8 A;  2VL6 A;  1S24 A;  3KA8 A;  3PWF A;  4ITT A;  5RXN A;  1BG7 A;  3RAV A;  3KYX A;  8RXN A;  4LQH A;  3E2C A;  4AR6 A;  1KRQ A;  1T9P A;  4M34 A;  5AI2 A;  4XKU A;  3PWQ C;  1NF4 A;  1TKP A;  4ERU A;  3PW8 C;  4ISP A;  5D8R A;  3F39 A;  4TOB A;  4CYA A;  2XKQ A;  1LKP A;  4ZLW A;  2RDV A;  1FHM A;  3KWO A;  3Q4R A;  3F32 A;  3BVL A;  3NOZ X;  3AK8 A;  5C6F A;  3E1N A;  3SH6 A;  4IWJ A;  3PVY B;  4KVR A;  2VZB A;  2V2J A;  3RE7 A;  3WVU A;  5JKL G;  1RWD A;  1JRE A;  4YKH A;  1O9R A;  4EVB A;  1VEL A;  3NP0 X;  3KA3 A;  2X17 0;  1SMW A;  2CN7 A;  3GE4 A;  1FHA A;  4CYB A;  2FZF A;  3T9J A;  3AF7 X;  1J30 A;  5CMR A;  5D8S A;  2V2P A;  4ZJK A;  5GU2 X;  1YUZ A;  2FHA A;  2VXX A;  3FVB A;  3R2L A;  1T9Q A;  5JAC A;  5FFA A;  3BVE A;  3QZ3 A;  1E8J A;  4EVC A;  1BQ9 A;  2IU2 A;  4IXK A; 
#chains in the Genus database with same CATH topology
 5I4J A;  3E1L A;  3KXU A;  3H9C A;  4ZTT A;  1DAT A;  5MFP A;  1P7P A;  1SMU A;  2C6R A;  3R2R A;  2ITB A;  4A3F L;  5ERJ A;  3S1R L;  1F4L A;  4P18 A;  2CHP A;  4MKU A;  3WNW A;  2L0Z A;  3FKI L;  3RZT A;  1PFY A;  4YVZ A;  1TWH L;  4RC5 A;  4ME3 A;  5DM6 1;  4YWL A;  5IP7 L;  3BVI A;  3E6S A;  5IX6 A;  4ZL6 A;  2HR5 A;  1JYB A;  2ZUR X;  3SID A;  3VPB E;  3UNO A;  2Y3Q A;  5GN8 A;  3GVY A;  2UX1 A;  2XJO A;  2B5I D;  3AF9 X;  2VXI A;  1JI4 A;  3ES3 A;  4MXP A;  3AF8 X;  2CIH A;  1RCG A;  4RC6 B;  3S1N L;  3PW1 B;  4U3G A;  2FFX J;  3F36 A;  3KA6 A;  1I50 L;  1Z92 B;  2E2H L;  2ZG9 X;  4CVR A;  2Z6M A;  1B2O A;  4UY8 1;  1ZRP A;  4II4 B;  3J7Z 1;  4A3D L;  1YK4 A;  2CF7 A;  3KYW A;  2V2N A;  4DZ0 A;  1FHH A;  1YV1 A;  2GYQ A;  3B08 B;  4ISM A;  3OJ5 A;  5D8X A;  3GTK L;  2JA7 L;  2V2O A;  2ZA8 A;  1BFR A;  1XZ1 A;  3GTO L;  3RZO L;  1T9O A;  1RDG A;  2V2S A;  4A3G L;  3SE1 A;  2C41 A;  3QHC A;  4Z3B A;  5J8W A;  1TKO A;  2MGY A;  1TJO A;  2OKC A;  3PVT B;  3S16 L;  1OWB A;  2IY4 A;  3Q4Q A;  1PFU A;  3PVR A;  5ERK A;  2Z5Q A;  5GAG c;  3DBY A;  2PYB A;  3GHQ A;  3SHX A;  2CLU A;  1XZ3 A;  1VZH A;  2APO B;  1JTS A;  3FI6 A;  4PGI A;  1RYQ A;  2V15 A;  2ZA6 A;  2XGW A;  2Z3R B;  2PYA A;  2JA6 L;  2AR0 A;  5J9V A;  5H1S c;  4CVS A;  2Z5R A;  3TA8 A;  1PFW A;  3E1P A;  4ZL5 A;  3I4N L;  4LQV A;  1BCF A;  5JKM G;  2A6H D;  3S2D L;  2FG4 A;  2XJS A;  3LKD A;  5D8Y A;  4MN9 A;  5C4X L;  3PIP 1;  3LNL A;  1UVH A;  5CZU A;  4ZKH A;  1DPS A;  1VCX A;  5EIN C;  4Y52 L;  2CR8 A;  1EUM A;  5IYD L;  5MGN A;  1BFY A;  4M35 A;  1QGH A;  3AJQ A;  2HVY C;  1VEQ A;  3HOY L;  4DYX A;  3F38 A;  2A6E D;  2PMZ P;  2R93 L;  2BW1 A;  2FG8 A;  5C3E L;  3F35 A;  2C2U A;  4LPM A;  1VLG A;  4BXX L;  1LKO A;  3FSE A;  5IY0 A;  1TWG L;  1L8H A;  3PIO 1;  4ETR A;  3EZU A;  2WTL A;  4TW3 A;  4W4K B;  3HOX L;  3AK9 A;  3KX9 A;  4KVS A;  1L8I A;  1I3Q L;  3LPE B;  5M5X L;  2ZG7 X;  5HQO A;  2V8T A;  2ERJ A;  3EGM A;  1ZS3 A;  4LPJ A;  1TWA L;  4TOC A;  3S1M L;  6RXN A;  2W0O A;  3C1Y A;  1IER A;  2YJK A;  2XJR A;  4A25 A;  5FFE A;  4LYU A;  3LWP B;  1I6H L;  3S17 L;  2C2J A;  4QUW A;  4JAD A;  5M5Y L;  4R42 A;  2YW7 A;  1VJX A;  3F37 A;  3UOI A;  4MUD A;  1R0F A;  3VVA A;  2VUM L;  2Y44 A;  1MFR A;  3O7S A;  2WAQ P;  3PL5 A;  3RBC A;  2RBD A;  1Y1W L;  1LKM A;  2V3B B;  3K35 A;  2RFK B;  4E6Y A;  5K53 A;  4ZKX A;  2V0E A;  1YUX A;  5LBH A;  2PSM C;  3GTL L;  2V2L A;  1TK6 A;  4WJG 4;  5FJ8 L;  1JIG A;  3RD0 A;  3FRR A;  4ZMC A;  2PPT A;  5IYB L;  4RC7 A;  3ERZ A;  4AR4 A;  1TWC L;  2FKZ A;  3RZ6 A;  4XGS A;  1B2J A;  4TVM A;  3A68 A;  2C6A A;  4CVP A;  3GTM L;  3HOZ L;  1CAA A;  1S2Z A;  5FFD A;  1IRN A;  4AI2 A;  5MFZ A;  4AR3 A;  5FFC A;  1R0H A;  2AYJ A;  3QVD A;  2JD6 0;  3S2H L;  4DYZ A;  1C09 A;  4M32 A;  4LHL A;  5C44 L;  3MQK B;  3PWQ A;  3C21 A;  1NF6 A;  5D8Q A;  3JR7 A;  2D5K A;  4GS7 D;  2WWX B;  3PW8 A;  4DYY A;  4KXR B;  4A3E L;  2JD7 0;  1R0J A;  1Z6O M;  4POF A;  4M33 A;  4RC5 B;  3PW1 A;  1MOJ A;  5D8P A;  1AEW A;  4XXB B;  2NYD A;  4DI0 A;  2JI1 A;  2KN9 A;  1QYB A;  1VZG A;  1JGC A;  4EVD A;  3VNX A;  5GN8 B;  4XKT A;  3KYY A;  2BKC A;  2DSX A;  3QD8 A;  3HL1 A;  2OH3 A;  2V2M A;  2WLA A;  3BVF A;  4ML5 A;  1JKU A;  2CHI A;  2PVX A;  3NFP I;  3BKN A;  2XJV A;  3M4O L;  3W54 A;  1N1Q A;  2GYD A;  1BQ8 A;  4JAG A;  3HOV L;  2CN6 A;  2JI3 A;  4TPU A;  3SS2 A;  2JA5 L;  4CMY V;  3RGD A;  4PG0 A;  3IQ1 A;  3R2S A;  4TOD A;  2CWL A;  3PVT A;  5JKL A;  5JVH 1;  3GGZ A;  4OYN A;  1OWC A;  1Z4A A;  1HRS A;  2YW6 A;  3R2O A;  4AHX A;  4BY7 L;  3E1J A;  3KDQ A;  2MS3 A;  1LB3 A;  3LWV B;  2R7Z L;  3HIU A;  4LQJ A;  5JDO B;  4RXN A;  5M3M L;  5MF6 A;  4A3L L;  2KKD A;  2Z5P A;  2ZG8 X;  2AQC A;  3H97 A;  5HJH A;  1JKV A;  3WWN B;  3FDJ A;  3EZ0 A;  2XJN A;  3PVR B;  3PZA A;  2G4H A;  2C6B A;  1RYT A;  2GMG A;  4LPN A;  4REU A;  2JI2 A;  2JD8 0;  3WWL A;  4AI3 A;  3WVV A;  4AHY A;  2FL0 A;  4A3K L;  3KYU A;  4MJY A;  4E6K A;  3S15 L;  3PKI A;  5FEJ A;  2IB0 A;  3PKJ A;  4Y08 A;  3O7R A;  3ISE A;  3KA9 A;  4K9F A;  2CEI A;  3JZ9 A;  4QIW P;  2BE5 D;  3HOW L;  5K52 A;  1UMN A;  2Y0S P;  2F7N A;  3E1O A;  3PVY A;  5GU0 X;  3KA4 A;  2OC5 A;  3HKZ P;  4AM5 A;  3QQC E;  3VV9 A;  1CAD A;  4YWM A;  4YXM A;  3KYV A;  4JAF A;  5FFB A;  4PG1 A;  3A44 A;  4C2M 1;  4A3M L;  5GAD c;  2R92 L;  5J93 A;  4C3J L;  1H96 A;  3H7G A;  2EY4 E;  3MSU A;  4ITW A;  3BVK A;  4PGK A;  3F34 A;  4CY9 A;  1IU6 A;  4B8C D;  2NVY L;  2QF9 A;  1Z6O A;  1RCD A;  2N02 A;  4MY7 A;  4KVQ A;  1S3Q A;  5M3F L;  3ISF A;  3S1Q L;  1QQT A;  1RCI A;  2QL0 A;  2WLU A;  4POG A;  4AM4 A;  1ZUJ A;  3F33 A;  2M6O A;  3GTJ L;  2G38 B;  3LWQ B;  4DYU A;  2H12 A;  7RXN A;  1B71 A;  5LG2 A;  1IRO A;  1IU5 A;  1BRF A;  1F30 A;  2CLB A;  1RDV A;  3LWO B;  1R0I A;  4BY1 L;  1H7V A;  5E1U A;  2M6P A;  2LCQ A;  4A3C L;  1VZI A;  4XKS A;  2C2F A;  1F33 A;  3HJY B;  3UFB A;  5GU1 X;  2YJJ A;  3ZG6 A;  3R2H A;  3JZA B;  3R2M A;  1PFV A;  2V2R A;  4RC8 A;  4YXJ A;  5LG8 A;  4V19 6;  2FJC A;  4TOE A;  3GGY A;  5GOU A;  2BJY A;  4X6A L;  4TO9 A;  1RB9 A;  4AHW A;  1NNQ A;  4CMY A;  3Q4N A;  4A3J L;  4TOA A;  1SQ3 A;  5GU3 X;  1BE7 A;  5JVG 1;  4CVT A;  4AI1 A;  3B0A B;  1NFV A;  2BK6 A;  2Z90 A;  3C1Z A;  5LS9 A;  3IU3 I;  2J9U B;  2XJM A;  5D8O A;  1QCV A;  4AM2 A;  1WCM L;  1YK5 A;  2M4V A;  1R0G A;  3QHB A;  3IS7 A;  4RC7 B;  3A9Q A;  5EIO C;  2K2D A;  4RC6 A;  2GS4 A;  4ZKW A;  2WB1 P;  3R2K A;  4TOG A;  3P2A A;  4BBR L;  4A93 L;  3AJP A;  3NP2 X;  2M4Y A;  3QB9 A;  1SMM A;  2NVQ L;  3OGH A;  5AI3 A;  4II4 A;  4IWK A;  5JKM A;  3BT5 A;  3S14 L;  1JI5 A;  1O9I A;  1R03 A;  4LQN A;  2AUS B;  3RYG A;  5CMQ A;  3Q4O A;  2ERS A;  5GAE c;  2PVE A;  5AN9 H;  4TOF A;  1B13 A;  4DE6 A;  2XJU A;  5E2D A;  2HTN A;  3E1M A;  3J7Y 1;  2QQY A;  1VEI A;  3D19 A;  4EVE A;  3WVW A;  1LTL A;  5K2M E;  1RCE A;  4AHZ A;  2V2I A;  1SOF A;  3IS8 A;  1PZX A;  2CKC A;  1OTK A;  5GAH c;  3GTQ L;  3M3Y L;  1DVB A;  1IES A;  5AXS A;  4XGH A;  1GWG A;  2ZA7 A;  1TWF L;  3HOU L;  5J8S A;  3FRS A;  4C3I L;  4LHN A;  2E2J L;  1S30 A;  3C23 A;  1RCC A;  4X0J A;  3M6J A;  3E6R A;  2Z3Q B;  5HJF A;  3H99 A;  4TOH A;  4ZN1 B;  3E1Q A;  4LYX A;  4Z5S A;  3U90 A;  3MPS A;  4DAS A;  3AJO A;  5JDO A;  2XJP A;  5FLM L;  5HU6 D;  3V3K B;  4A3B L;  3UOF A;  4AR5 A;  1DX8 A;  2VL6 A;  1S24 A;  3KA8 A;  2NVT L;  4BBS L;  3PWF A;  4ITT A;  5RXN A;  5C4J L;  4Y7N L;  1Y1V L;  1BG7 A;  4W4L B;  2XJT A;  3RAV A;  3GTG L;  3KYX A;  2V8U A;  3P8B A;  8RXN A;  4G6B A;  4LQH A;  3E2C A;  5IP9 L;  4AR6 A;  1KRQ A;  1T9P A;  4M34 A;  4U67 1;  3L0M A;  5AI2 A;  4XKU A;  3PWQ C;  1NF4 A;  2O5J D;  1TKP A;  1SFO L;  4ERU A;  3PW8 C;  2B63 L;  4ISP A;  3H9B A;  5D8R A;  3LWR B;  3F39 A;  4C3H L;  4TOB A;  4CYA A;  2XKQ A;  1LKP A;  4ZLW A;  5IYC L;  3CQZ L;  1K83 L;  2RDV A;  1FHM A;  3KWO A;  2CKA A;  2XJQ A;  3Q4R A;  3F32 A;  1NXE A;  3BVL A;  3NOZ X;  3AK8 A;  3HAX C;  2A68 D;  2NVX L;  3H3V M;  3KHK A;  5C6F A;  3E1N A;  3SH6 A;  4IWJ A;  3PVY B;  4KVR A;  2VZB A;  2V2J A;  3RE7 A;  3WVU A;  5JKL G;  1RWD A;  1JRE A;  4YKH A;  1IW7 D;  1O9R A;  4E40 A;  4EVB A;  3GTP L;  4ZN3 B;  3I4M L;  2JA8 L;  1WJV A;  1R9T L;  1VEL A;  3NP0 X;  1NXG A;  3KA3 A;  2X17 0;  1SMW A;  4WFN 1;  2CN7 A;  3GE4 A;  5DM7 1;  3PO3 L;  1FHA A;  4CYB A;  2YU9 L;  2FZF A;  3T9J A;  2E2I L;  3HJW B;  3AF7 X;  1J30 A;  5CMR A;  5D8S A;  3H0G L;  2ZIX A;  2V0F A;  3K7A L;  5M5W L;  2V2P A;  1ODH A;  4ZJK A;  5GU2 X;  4AYB P;  1YUZ A;  2FHA A;  2VXX A;  4JAE A;  3FVB A;  3N6O A;  3R2L A;  1T9Q A;  5JAC A;  5FFA A;  5MLC 3;  3PO2 L;  2A69 D;  4A3I L;  4AI0 A;  3BVE A;  3QZ3 A;  1E8J A;  4EVC A;  3RZD L;  1BQ9 A;  2IU2 A;  4IXK A; 
#chains in the Genus database with same CATH homology
 5I4J A;  3E1L A;  3KXU A;  4ZTT A;  1DAT A;  5MFP A;  1SMU A;  2C6R A;  3R2R A;  2ITB A;  5ERJ A;  4P18 A;  2CHP A;  4MKU A;  3WNW A;  2L0Z A;  3RZT A;  4YVZ A;  4ME3 A;  4RC5 A;  5DM6 1;  4YWL A;  3BVI A;  3E6S A;  5IX6 A;  4ZL6 A;  2HR5 A;  1JYB A;  2ZUR X;  3SID A;  3VPB E;  3UNO A;  2Y3Q A;  5GN8 A;  3GVY A;  2UX1 A;  2XJO A;  2B5I D;  3AF9 X;  2VXI A;  1JI4 A;  3ES3 A;  4MXP A;  3AF8 X;  2CIH A;  1RCG A;  4RC6 B;  3PW1 B;  4U3G A;  2FFX J;  3F36 A;  3KA6 A;  1Z92 B;  4UY8 1;  2ZG9 X;  4CVR A;  2Z6M A;  1B2O A;  1ZRP A;  4II4 B;  3J7Z 1;  1YK4 A;  2CF7 A;  3KYW A;  2V2N A;  4DZ0 A;  1FHH A;  1YV1 A;  2GYQ A;  3B08 B;  4ISM A;  3OJ5 A;  5D8X A;  2V2O A;  2ZA8 A;  1BFR A;  1XZ1 A;  1T9O A;  1RDG A;  2V2S A;  3SE1 A;  2C41 A;  3QHC A;  4Z3B A;  5J8W A;  1TKO A;  2MGY A;  1TJO A;  2OKC A;  3PVT B;  1OWB A;  2IY4 A;  3Q4Q A;  3PVR A;  5ERK A;  2Z5Q A;  5GAG c;  3DBY A;  2PYB A;  3GHQ A;  3SHX A;  2CLU A;  1XZ3 A;  1VZH A;  1JTS A;  3FI6 A;  4PGI A;  1RYQ A;  2V15 A;  2ZA6 A;  2XGW A;  2Z3R B;  2PYA A;  2AR0 A;  5J9V A;  5H1S c;  4CVS A;  2Z5R A;  3TA8 A;  3E1P A;  4ZL5 A;  4LQV A;  1BCF A;  5JKM G;  2A6H D;  2FG4 A;  2XJS A;  3LKD A;  5D8Y A;  4MN9 A;  3PIP 1;  3LNL A;  1UVH A;  5CZU A;  4ZKH A;  1DPS A;  1VCX A;  5EIN C;  2CR8 A;  1EUM A;  5MGN A;  1BFY A;  4M35 A;  1QGH A;  3AJQ A;  1VEQ A;  4DYX A;  3F38 A;  2A6E D;  2BW1 A;  2FG8 A;  3F35 A;  2C2U A;  4LPM A;  1VLG A;  1LKO A;  3FSE A;  5IY0 A;  1L8H A;  3PIO 1;  4ETR A;  3EZU A;  2WTL A;  4TW3 A;  4W4K B;  3AK9 A;  3KX9 A;  4KVS A;  1L8I A;  3LPE B;  2ZG7 X;  5HQO A;  2V8T A;  2ERJ A;  3EGM A;  1ZS3 A;  4LPJ A;  4TOC A;  6RXN A;  2W0O A;  3C1Y A;  1IER A;  2YJK A;  2XJR A;  4A25 A;  5FFE A;  4LYU A;  2C2J A;  4QUW A;  4JAD A;  4R42 A;  2YW7 A;  1VJX A;  3F37 A;  3UOI A;  4MUD A;  1R0F A;  3VVA A;  2Y44 A;  1MFR A;  3O7S A;  3RBC A;  2RBD A;  1LKM A;  2V3B B;  3K35 A;  4E6Y A;  5K53 A;  4ZKX A;  2V0E A;  1YUX A;  5LBH A;  2PSM C;  2V2L A;  1TK6 A;  4WJG 4;  1JIG A;  3RD0 A;  3FRR A;  4ZMC A;  2PPT A;  4RC7 A;  3ERZ A;  4AR4 A;  2FKZ A;  3RZ6 A;  4XGS A;  1B2J A;  4TVM A;  3A68 A;  2C6A A;  4CVP A;  1CAA A;  1S2Z A;  5FFD A;  1IRN A;  4AI2 A;  5MFZ A;  4AR3 A;  5FFC A;  1R0H A;  2AYJ A;  3QVD A;  2JD6 0;  4DYZ A;  1C09 A;  4M32 A;  4LHL A;  3PWQ A;  3C21 A;  1NF6 A;  5D8Q A;  2D5K A;  4GS7 D;  2WWX B;  3PW8 A;  4DYY A;  4KXR B;  2JD7 0;  1R0J A;  1Z6O M;  4POF A;  4M33 A;  4RC5 B;  3PW1 A;  1MOJ A;  5D8P A;  1AEW A;  4XXB B;  2NYD A;  4DI0 A;  2JI1 A;  2KN9 A;  1QYB A;  1VZG A;  1JGC A;  4EVD A;  3VNX A;  5GN8 B;  4XKT A;  3KYY A;  2BKC A;  2DSX A;  3QD8 A;  3HL1 A;  2OH3 A;  2V2M A;  2WLA A;  3BVF A;  4ML5 A;  1JKU A;  2CHI A;  2PVX A;  3NFP I;  3BKN A;  2XJV A;  3W54 A;  1N1Q A;  2GYD A;  1BQ8 A;  4JAG A;  2CN6 A;  2JI3 A;  4TPU A;  3SS2 A;  4CMY V;  3RGD A;  4PG0 A;  3IQ1 A;  3R2S A;  4TOD A;  2CWL A;  3PVT A;  5JKL A;  5JVH 1;  3GGZ A;  4OYN A;  1OWC A;  1Z4A A;  1HRS A;  2YW6 A;  3R2O A;  4AHX A;  3E1J A;  3KDQ A;  2MS3 A;  1LB3 A;  3HIU A;  4LQJ A;  5JDO B;  4RXN A;  5MF6 A;  2KKD A;  2Z5P A;  2ZG8 X;  5HJH A;  1JKV A;  3WWN B;  3EZ0 A;  2XJN A;  3PVR B;  3PZA A;  2G4H A;  2C6B A;  1RYT A;  2GMG A;  4LPN A;  4REU A;  2JI2 A;  2JD8 0;  3WWL A;  4AI3 A;  3WVV A;  4AHY A;  2FL0 A;  3KYU A;  4MJY A;  4E6K A;  3PKI A;  5FEJ A;  2IB0 A;  3PKJ A;  4Y08 A;  3O7R A;  3ISE A;  3KA9 A;  4K9F A;  2CEI A;  3JZ9 A;  2BE5 D;  5K52 A;  1UMN A;  2F7N A;  3E1O A;  3PVY A;  5GU0 X;  3KA4 A;  2OC5 A;  3QQC E;  4AM5 A;  3VV9 A;  1CAD A;  4YWM A;  4YXM A;  3KYV A;  4JAF A;  5FFB A;  4PG1 A;  3A44 A;  5GAD c;  5J93 A;  1H96 A;  3H7G A;  3MSU A;  4ITW A;  3BVK A;  4PGK A;  3F34 A;  4CY9 A;  1IU6 A;  4B8C D;  2QF9 A;  1Z6O A;  1RCD A;  2N02 A;  4MY7 A;  4KVQ A;  1S3Q A;  3ISF A;  1RCI A;  2QL0 A;  2WLU A;  4POG A;  4AM4 A;  1ZUJ A;  3F33 A;  2M6O A;  2G38 B;  4DYU A;  2H12 A;  7RXN A;  1B71 A;  5LG2 A;  1IRO A;  1IU5 A;  1BRF A;  1F30 A;  2CLB A;  1RDV A;  1R0I A;  1H7V A;  5E1U A;  2M6P A;  2LCQ A;  1VZI A;  4XKS A;  2C2F A;  1F33 A;  3UFB A;  5GU1 X;  2YJJ A;  3ZG6 A;  3R2H A;  3JZA B;  3R2M A;  2V2R A;  4RC8 A;  4YXJ A;  5LG8 A;  4V19 6;  2FJC A;  4TOE A;  3GGY A;  5GOU A;  2BJY A;  4TO9 A;  1RB9 A;  4AHW A;  1NNQ A;  4CMY A;  3Q4N A;  4TOA A;  1SQ3 A;  5GU3 X;  1BE7 A;  5JVG 1;  4CVT A;  4AI1 A;  3B0A B;  1NFV A;  2BK6 A;  2Z90 A;  3C1Z A;  5LS9 A;  3IU3 I;  2J9U B;  2XJM A;  5D8O A;  1QCV A;  4AM2 A;  1YK5 A;  2M4V A;  1R0G A;  5EIO C;  3QHB A;  3IS7 A;  4RC7 B;  3A9Q A;  2K2D A;  4RC6 A;  2GS4 A;  4ZKW A;  3P2A A;  3R2K A;  4TOG A;  3AJP A;  3NP2 X;  2M4Y A;  3QB9 A;  1SMM A;  3OGH A;  5AI3 A;  4II4 A;  4IWK A;  5JKM A;  3BT5 A;  1JI5 A;  1O9I A;  1R03 A;  4LQN A;  3RYG A;  5CMQ A;  3Q4O A;  2ERS A;  5GAE c;  2PVE A;  5AN9 H;  4TOF A;  1B13 A;  4DE6 A;  2XJU A;  5E2D A;  2HTN A;  3E1M A;  3J7Y 1;  2QQY A;  1VEI A;  3D19 A;  4EVE A;  3WVW A;  1LTL A;  5K2M E;  1RCE A;  4AHZ A;  2V2I A;  1SOF A;  3IS8 A;  2CKC A;  1OTK A;  5GAH c;  1DVB A;  1IES A;  5AXS A;  4XGH A;  1GWG A;  2ZA7 A;  5J8S A;  3FRS A;  4LHN A;  1S30 A;  3C23 A;  1RCC A;  4X0J A;  3M6J A;  3E6R A;  2Z3Q B;  5HJF A;  4ZN1 B;  4TOH A;  3E1Q A;  4LYX A;  4Z5S A;  3U90 A;  3MPS A;  4DAS A;  3AJO A;  5JDO A;  2XJP A;  5HU6 D;  3V3K B;  3UOF A;  4AR5 A;  1DX8 A;  2VL6 A;  1S24 A;  3KA8 A;  3PWF A;  4ITT A;  5RXN A;  1BG7 A;  4W4L B;  2XJT A;  3RAV A;  3KYX A;  2V8U A;  3P8B A;  8RXN A;  4G6B A;  4LQH A;  3E2C A;  4AR6 A;  1KRQ A;  1T9P A;  4M34 A;  4U67 1;  3L0M A;  5AI2 A;  4XKU A;  3PWQ C;  1NF4 A;  2O5J D;  1TKP A;  4ERU A;  3PW8 C;  4ISP A;  5D8R A;  3F39 A;  4TOB A;  4CYA A;  2XKQ A;  1LKP A;  4ZLW A;  2RDV A;  1FHM A;  3KWO A;  2CKA A;  2XJQ A;  3Q4R A;  3F32 A;  1NXE A;  3BVL A;  3NOZ X;  3AK8 A;  2A68 D;  3KHK A;  5C6F A;  3E1N A;  3SH6 A;  4IWJ A;  3PVY B;  4KVR A;  2VZB A;  2V2J A;  3RE7 A;  3WVU A;  5JKL G;  1RWD A;  1JRE A;  4YKH A;  1IW7 D;  1O9R A;  4E40 A;  4EVB A;  4ZN3 B;  1WJV A;  1VEL A;  3NP0 X;  1NXG A;  3KA3 A;  2X17 0;  1SMW A;  4WFN 1;  2CN7 A;  3GE4 A;  5DM7 1;  1FHA A;  4CYB A;  2FZF A;  3T9J A;  3AF7 X;  1J30 A;  5CMR A;  5D8S A;  2ZIX A;  2V0F A;  1ODH A;  2V2P A;  4ZJK A;  5GU2 X;  1YUZ A;  2FHA A;  2VXX A;  4JAE A;  3FVB A;  3N6O A;  3R2L A;  1T9Q A;  5JAC A;  5FFA A;  5MLC 3;  2A69 D;  4AI0 A;  3BVE A;  3QZ3 A;  1E8J A;  4EVC A;  1BQ9 A;  2IU2 A;  4IXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...