2HR5A

Pf1283- rubrerythrin from pyrococcus furiosus iron bound form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Rubrerythrin
publication title Crystal structure of iron bound Rubrerythrin from Pyrococcus Furiosus
rcsb
source organism Pyrococcus furiosus
total genus 62
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2hr5A01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2hr5A02
1N1QA 2V3BB 4AM2A 3T9JA 4TO9A 4TOFA 3E1NA 2ZA6A 3R2RA 4EVCA 5FFEA 5JKLG 3F37A 4LPNA 4MN9A 1B71A 3OGHA 4RC8A 4R42A 4RC7A 5LS9A 1JIGA 3KYYA 2OH3A 4XKTA 5D8PA 2C6RA 2GMGA 3RZ6A 1RCDA 3BVFA 4YWMA 5J8WA 4LYUA 1IRNA 2OC5A 3IS7A 1R03A 1SQ3A 2C2JA 4TOHA 2FFXJ 2FJCA 4K9FA 2W0OA 3E1PA 4CVPA 1Z6OA 3PVYB 3RZTA 2QQYA 2G4HA 4TOAA 4DYZA 1BFYA 2V15A 5ERKA 2C2UA 2Z5RA 4MY7A 3SIDA 2BJYA 2KN9A 4LPJA 2V2MA 2XJOA 2BK6A 2Z5QA 3QB9A 4CYBA 3GHQA 4LQHA 5CMQA 2ITBA 4ISMA 3UOIA 4ETRA 5J93A 4RC6A 4XKSA 5J8SA 4ITWA 1KRQA 1F33A 3AF8X 3ISFA 4II4A 4DI0A 3EZUA 4ML5A 1RWDA 1DX8A 5D8RA 1JTSA 5FEJA 3F36A 3KWOA 5GU1X 1YK5A 4RXNA 2RBDA 3PW8C 2GS4A 2LCQA 1TJOA 3F35A 3FSEA 5CZUA 2VXIA 4ITTA 4AM5A 3E1JA 4QUWA 2Z90A 3H7GA 1S24A 1RDVA 3BKNA 2FL0A 2CF7A 3PW1A 8RXNA 2UX1A 5D8YA 1L8IA 3QVDA 4AR3A 1RCGA 3O7SA 3E6SA 4IWKA 1QCVA 2YJJA 4ERUA 1R0IA 2CLBA 4POFA 1TKOA 3PW8A 5GU3X 2IB0A 1VEIA 1NF4A 3SS2A 1FHMA 3PZAA 3QHBA 2GYDA 4ZL6A 3SH6A 4ZTTA 3Q4RA 1NF6A 1AEWA 1S30A 3WVWA 4PG1A 1T9OA 1IU5A 3BVLA 1UVHA 4DYXA 2V2OA 4CVTA 5JACA 3KA4A 4CMYV 4M35A 1SOFA 2ZG9X 2FHAA 2JD60 2XKQA 1R0FA 4TODA 1S3QA 4E6KA 1F30A 1T9QA 2RDVA 1L8HA 5K52A 4ZJKA 4POGA 1IESA 3A68A 3KYVA 2K2DA 1CADA 1JREA 5JKMA 7RXNA 4AR6A 4II4B 1HRSA 5LBHA 1O9RA 1QGHA 4CVRA 3E2CA 3AK8A 3KA8A 4REUA 2GYQA 5FFAA 1ZS3A 6RXNA 1J30A 4AM4A 1R0HA 3FI6A 2HTNA 5HQOA 1RDGA 3KA6A 3NP2X 1IERA 4PGIA 2X170 2V2PA 1C09A 1JKVA 3WVUA 2PYAA 5GN8A 4YWLA 3BVEA 3AJQA 1RCIA 3E6RA 3PWQC 3KX9A 3RBCA 3F32A 1BG7A 2CN7A 5AI2A 1BQ9A 1TKPA 2FZFA 3QD8A 2YW7A 1R0JA 4XKUA 3IS8A 4RC5A 1BRFA 2ZURX 4LQVA 3EGMA 3KA3A 1FHAA 3QZ3A 3E1LA 3NOZX 4LYXA 1DATA 2WTLA 2VZBA 2V2JA 3QHCA 2F7NA 2V2SA 1LKMA 3AF9X 2QL0A 5HJHA 2WLAA 3RGDA 4EVEA 3PWQA 4ZMCA 1JYBA 2YJKA 2V2RA 3PVRB 1RB9A 2D5KA 2V2LA 5FFDA 1VELA 5GU2X 3BT5A 1LTLA 2FKZA 5GOUA 5HJFA 1H7VA 2KKDA 1ZUJA 4Z5SA 3U90A 1XZ3A 3AF7X 2Z6MA 1Z4AA 4XGSA 2VL6A 1BCFA 1FHHA 3Q4NA 2XGWA 4RC7B 3FVBA 1TK6A 3UNOA 1QYBA 3OJ5A 5J9VA 1BE7A 3NP0X 4DYUA 2VXXA 1IROA 2CHIA 5GU0X 4ZKXA 4AR5A 3A9QA 3PVYA 1RCEA 2FG4A 4M32A 1E8JA 1VJXA 2V2IA 2C2FA 3F39A 1S2ZA 3RAVA 3KYXA 5E2DA 3A44A 3AJPA 5LG2A 2CLUA 4ZKWA 3WVVA 4MJYA 1EUMA 2C41A 3RYGA 2ZA8A 2MS3A 1B2OA 5IY0A 4MUDA 3R2HA 4TOGA 4TPUA 1B2JA 4ZLWA 4RC6B 1BQ8A 4M33A 1SMMA 3F38A 3HL1A 5I4JA 3RE7A 2CEIA 3GE4A 3GVYA 2PYBA 5JKLA 4EVBA 1NFVA 2JD70 4PGKA 5JKMG 5FFBA 1T9PA 4Y08A 3E1OA 3Q4QA 4LPMA 4MKUA 1YUXA 4P18A 4IXKA 3PWFA 5C6FA 4A25A 3E1MA 3ERZA 4IWJA 4CMYA 3WNWA 2FG8A 3Q4OA 2CHPA 3TA8A 1SMUA 1LKOA 4DYYA 1DVBA 3SHXA 4ZKHA 3VNXA 3KXUA 5AXSA 3PW1B 4DE6A 1GWGA 4ME3A 2BKCA 2Y3QA 3HIUA 4Z3BA 4TOEA 1R0GA 2QF9A 2PVXA 3O7RA 3UOFA 1YK4A 4DZ0A 4CYAA 2Z5PA 2IY4A 4CY9A 3KYUA 4YKHA 1UMNA 3PVTA 3F34A 1BFRA 2ZG7X 4M34A 2CN6A 5E1UA 3R2OA 4AR4A 3MPSA 2HR5A 2M4YA 1LKPA 1JGCA 2V2NA 3AK9A 3RD0A 5LG8A 5AI3A 4PG0A 4KVRA 1NNQA 2WLUA 2YW6A 4CVSA 3KYWA 4OYNA 4KVQA 5D8OA 1SMWA 1IU6A 5IX6A 3BVKA 3R2LA 1OTKA 1XZ1A 1MOJA 1H96A 4DASA 2ZA7A 1VCXA 3AJOA 3F33A 1VLGA 1MFRA 1JKUA 3R2SA 1JI5A 4TOCA 1Z6OM 5FFCA 1CAAA 1YV1A 5D8XA 1LB3A 5GN8B 1ZRPA 3SE1A 3EZ0A 2CIHA 4TOBA 4EVDA 1RYTA 5D8SA 3KA9A 4ISPA 5K53A 1O9IA 2JD80 4RC5B 3BVIA 4LQJA 4TW3A 2DSXA 3R2MA 4ZL5A 4U3GA 1B13A 4KVSA 2ZG8X 5RXNA 2PVEA 1JI4A 1YUZA 1DPSA 3E1QA 5D8QA 2BW1A 2IU2A 3ISEA 5ERJA 3PVRA 3R2KA 3ES3A 2XJMA 3IQ1A 1RCCA 3PVTB 4LQNA 2XJNA 5CMRA 1VEQA
chains in the Genus database with same CATH superfamily
1N1QA 2V3BB 3LWQB 4AM2A 3T9JA 4KXRB 4BXXL 4TO9A 4TOFA 3E1NA 2ZA6A 3R2RA 4EVCA 2M6OA 3LWRB 5FFEA 5JKLG 3F37A 4LPNA 4MN9A 2WWXB 2AQCA 1B71A 2Z3RB 3OGHA 4RC8A 4R42A 4RC7A 5LS9A 1PZXA 1JIGA 3KYYA 2OH3A 4XKTA 3QQCE 3HOUL 5D8PA 3HOWL 2C6RA 2GMGA 4E40A 2XJSA 2PPTA 3RZ6A 1RCDA 3BVFA 4YWMA 5J8WA 4LYUA 1IRNA 3PO3L 1SFOL 2OC5A 3IS7A 3LPEB 3JZ9A 1R03A 1SQ3A 1OWBA 2C2JA 2MGYA 4TOHA 2FFXJ 2FJCA 3P2AA 4K9FA 3JZAB 2EY4E 2W0OA 3E1PA 1P7PA 4CVPA 1Z6OA 4A93L 3PVYB 3RZTA 2QQYA 2G4HA 4TOAA 4DYZA 1BFYA 3M6JA 4YXMA 4AI3A 2V15A 2JA7L 5ERKA 2C2UA 2Z5RA 4MY7A 1Y1VL 3SIDA 2BJYA 3H97A 4GS7D 3WWLA 2KN9A 3ZG6A 4LPJA 2V2MA 5DM61 1I3QL 2XJOA 2BK6A 2Z5QA 3QB9A 2JA8L 3GTJL 4CYBA 2XJQA 5IP9L 5M3FL 3GHQA 4LQHA 5CMQA 2ITBA 4ISMA 3UOIA 4ETRA 5J93A 3C1YA 4RC6A 4XKSA 5J8SA 3K35A 5MLC3 4ITWA 2C6AA 1KRQA 4C3IL 1F33A 3AF8X 3GGZA 2ERSA 3C1ZA 3HKZP 3ISFA 4II4A 3NFPI 3HOYL 4DI0A 4A3KL 3EZUA 2BE5D 4ML5A 1RWDA 5M3ML 2M4VA 1DX8A 5D8RA 1JTSA 3IU3I 5C3EL 4A3IL 5FEJA 3F36A 1IW7D 3GTQL 3KWOA 5GU1X 1YK5A 4RXNA 3HJWB 4X6AL 2RBDA 2XJTA 3KDQA 3PW8C 2GS4A 1TWHL 2LCQA 1TJOA 3F35A 4XGHA 5HU6D 1PFWA 3FKIL 5FJ8L 3FSEA 3GTLL 5CZUA 4A3CL 2VXIA 4ITTA 2NVTL 4AM5A 3LWOB 3E1JA 4QUWA 2Z90A 3H7GA 4MXPA 1S24A 1RDVA 3BKNA 2FL0A 2CF7A 3PW1A 8RXNA 3S17L 2UX1A 5D8YA 2XJRA 1L8IA 3QVDA 4AR3A 1RCGA 3O7SA 3E6SA 4IWKA 1QCVA 2YJJA 4ERUA 1R0IA 3HAXC 2C6BA 2CLBA 2V8UA 3FDJA 4POFA 1TKOA 3PW8A 4C3HL 5GU3X 2IB0A 1VEIA 1NF4A 3SS2A 1FHMA 4QIWP 5IYDL 3PZAA 3QHBA 5MF6A 5EIOC 3M4OL 3GTML 2GYDA 4ZL6A 3SH6A 2PMZP 4ZTTA 3Q4RA 2A6HD 1NF6A 1AEWA 3FRRA 1S30A 3WVWA 5JVG1 4PG1A 4W4KB 1T9OA 1IU5A 3BVLA 1UVHA 4DYXA 4LHLA 3H3VM 2V2OA 4CVTA 5JACA 3V3KB 3KA4A 1TWGL 4CMYV 4M35A 1SOFA 1VZGA 1TWCL 2A69D 2ZG9X 4JADA 2FHAA 2JD60 2XKQA 4A3JL 1R0FA 4TODA 1WCML 1S3QA 4E6KA 1F30A 1T9QA 2RDVA 4Y7NL 3FRSA 1L8HA 5K52A 4ZJKA 2CKAA 2ERJA 2JI3A 3H0GL 4POGA 1IESA 3A68A 1F4LA 5EINC 3KYVA 2K2DA 1CADA 2NVXL 1JREA 5JKMA 7RXNA 4AR6A 5C4JL 4II4B 1HRSA 5LBHA 1O9RA 1QGHA 4CVRA 3GTGL 3E2CA 3AK8A 3KA8A 4REUA 2GYQA 5FFAA 1ZS3A 2ZIXA 6RXNA 4AHWA 4A3GL 1J30A 4AM4A 1R0HA 3FI6A 2HTNA 5HQOA 1RDGA 3KA6A 5M5XL 3NP2X 1IERA 4PGIA 2X170 3VV9A 2V2PA 1C09A 1JKVA 3H99A 3WVUA 2PYAA 5GN8A 4YWLA 3BVEA 3HOVL 3AJQA 3PIP1 1NXGA 1RCIA 3E6RA 3PWQC 3KX9A 1R9TL 3RBCA 3F32A 1BG7A 2CN7A 4TVMA 5AI2A 1BQ9A 1TKPA 2FZFA 3QD8A 2NYDA 2YW7A 1R0JA 4A3LL 4XKUA 3IS8A 4RC5A 4A3EL 5H1Sc 1BRFA 5JDOA 2ZURX 3MQKB 4LQVA 2XJUA 3EGMA 3KA3A 1FHAA 3QZ3A 3E1LA 4V196 3NOZX 4LYXA 1DATA 2WTLA 2VZBA 5M5WL 2V2JA 3QHCA 2F7NA 4WJG4 3D19A 3HOZL 2V2SA 5JVH1 1LKMA 5GAEc 2E2HL 3PKJA 3AF9X 2QL0A 5HJHA 2WLAA 3LNLA 3RGDA 4EVEA 3PWQA 4ZMCA 1JYBA 2YJKA 3LWPB 4UY81 2V2RA 3PVRB 1RB9A 2D5KA 2V2LA 3S15L 4BY7L 5FFDA 1VELA 5GU2X 3BT5A 1LTLA 2FKZA 3PKIA 3S2DL 5GOUA 2AR0A 5HJFA 3W54A 1H7VA 5IP7L 2R92L 2KKDA 1ZUJA 4Z5SA 3U90A 1XZ3A 3AF7X 2AUSB 2Z6MA 2V0EA 4JAEA 1Z4AA 4XGSA 3PL5A 2HVYC 1Y1WL 2VL6A 1BCFA 2RFKB 1FHHA 3Q4NA 2XGWA 4RC7B 3FVBA 1TK6A 3UNOA 1QYBA 3OJ5A 5FLML 5J9VA 1BE7A 3NP0X 4DYUA 4W4LB 4LHNA 3GTPL 2Z3QB 2VXXA 4AHXA 1IROA 3S2HL 2L0ZA 2CHIA 5GU0X 4ZKXA 4AR5A 5DM71 4Y52L 4AHYA 3H9CA 2N02A 3A9QA 3PVYA 4YXJA 1RCEA 2FG4A 4M32A 2J9UB 2A68D 4AI1A 1TWFL 1E8JA 1VJXA 2M6PA 2V2IA 3N6OA 4YVZA 2C2FA 3HJYB 2NVQL 3GTOL 3F39A 3P8BA 1S2ZA 3RAVA 3KYXA 5E2DA 4AYBP 3A44A 5JDOB 3AJPA 5LG2A 2CLUA 4ZKWA 3WVVA 4MJYA 2O5JD 1EUMA 3UFBA 5IYBL 2C41A 3RYGA 2ZA8A 2MS3A 1B2OA 4BBRL 4A3FL 2V8TA 5IY0A 2B63L 2CKCA 4MUDA 3R2HA 4TOGA 4TPUA 1B2JA 4ZLWA 4RC6B 1BQ8A 4A3ML 4M33A 1SMMA 3F38A 3HL1A 5I4JA 4G6BA 3RE7A 2Y0SP 2CEIA 1OWCA 3GE4A 3GTKL 4B8CD 1NXEA 3GVYA 5MFPA 2PYBA 5JKLA 1I50L 3S14L 2APOB 3K7AL 2NVYL 4EVBA 1NFVA 3RZDL 1RYQA 2JD70 5K2ME 4PGKA 4BY1L 5JKMG 3S1ML 5FFBA 1T9PA 4Y08A 3E1OA 5GAGc 3Q4QA 4LPMA 3J7Y1 4MKUA 2JI2A 1YUXA 4P18A 1WJVA 4IXKA 2E2JL 3PWFA 3KHKA 5C6FA 4A25A 2VUML 3E1MA 3ERZA 4IWJA 4ZN3B 4CMYA 3WNWA 1PFYA 2FG8A 3Q4OA 2CHPA 3TA8A 2CWLA 1SMUA 1LKOA 4DYYA 1DVBA 3SHXA 4ZKHA 3VNXA 2WAQP 3MSUA 3PIO1 3KXUA 5AXSA 2YU9L 3PW1B 4DE6A 1GWGA 4E6YA 4ME3A 2G38B 2BKCA 2Y3QA 3HIUA 4Z3BA 2Y44A 4TOEA 5MGNA 1R0GA 4ZN1B 5C44L 3J7Z1 2QF9A 2PVXA 3O7RA 3UOFA 2R93L 2H12A 1YK4A 4DZ0A 4CYAA 2Z5PA 4JAGA 2IY4A 4CY9A 2B5ID 3KYUA 4YKHA 1UMNA 3PVTA 2JA6L 3F34A 3RZOL 1BFRA 3DBYA 2ZG7X 4M34A 2CN6A 5E1UA 3R2OA 4AR4A 3MPSA 5IYCL 3S1RL 2HR5A 2OKCA 2M4YA 1LKPA 3LWVB 1JGCA 2V2NA 3AK9A 3GGYA 3RD0A 5LG8A 2E2IL 5AI3A 3CQZL 4PG0A 4KVRA 4AI0A 1NNQA 2WLUA 2YW6A 3VVAA 4CVSA 1ODHA 3S1QL 2CR8A 5C4XL 3S16L 3KYWA 5AN9H 2WB1P 4OYNA 4KVQA 5D8OA 1SMWA 2XJPA 2JA5L 1IU6A 5IX6A 3BVKA 3B08B 3R2LA 1Z92B 5GAHc 1OTKA 1XZ1A 3LKDA 4A3DL 1MOJA 1H96A 4DASA 3H9BA 2ZA7A 1VCXA 3AJOA 3F33A 3S1NL 3HOXL 2JI1A 3WWNB 4U671 1VLGA 3C23A 1MFRA 1JKUA 3R2SA 4JAFA 2XJVA 1JI5A 4TOCA 1Z6OM 5FFCA 1CAAA 2R7ZL 1YV1A 5D8XA 1LB3A 3I4ML 5GN8B 1ZRPA 3SE1A 3EZ0A 1TWAL 2CIHA 2A6ED 5MFZA 1K83L 4TOBA 4EVDA 1RYTA 5D8SA 3KA9A 4ISPA 1PFUA 2AYJA 1PFVA 3VPBE 4AHZA 5K53A 1VZHA 1O9IA 2JD80 1I6HL 3PO2L 4A3BL 4RC5B 3BVIA 1VZIA 3L0MA 4XXBB 4LQJA 4TW3A 2DSXA 4C2M1 3R2MA 4ZL5A 4U3GA 1B13A 4KVSA 2ZG8X 3C21A 3B0AB 5RXNA 2PVEA 4AI2A 5GADc 5M5YL 1JI4A 1YUZA 1DPSA 3E1QA 5D8QA 2BW1A 2IU2A 4WFN1 3ISEA 3I4NL 2V0FA 4C3JL 5ERJA 3JR7A 3PVRA 3R2KA 4X0JA 3ES3A 2XJMA 3IQ1A 1RCCA 2PSMC 4BBSL 3PVTB 4LQNA 2XJNA 5CMRA 3M3YL 1QQTA 1VEQA
chains in the Genus database with same CATH topology
1N1QA 2V3BB 4AM2A 3T9JA 4KXRB 4TO9A 4TOFA 3E1NA 2ZA6A 3R2RA 4EVCA 2M6OA 5FFEA 5JKLG 3F37A 4LPNA 4MN9A 2WWXB 1B71A 2Z3RB 3OGHA 4RC8A 4R42A 4RC7A 5LS9A 1JIGA 3KYYA 2OH3A 4XKTA 3QQCE 5D8PA 2C6RA 2GMGA 4E40A 2XJSA 2PPTA 3RZ6A 1RCDA 3BVFA 4YWMA 5J8WA 4LYUA 1IRNA 2OC5A 3IS7A 3LPEB 3JZ9A 1R03A 1SQ3A 1OWBA 2C2JA 2MGYA 4TOHA 2FFXJ 2FJCA 3P2AA 4K9FA 3JZAB 2W0OA 3E1PA 4CVPA 1Z6OA 3PVYB 3RZTA 2QQYA 2G4HA 4TOAA 4DYZA 1BFYA 3M6JA 4YXMA 4AI3A 2V15A 5ERKA 2C2UA 2Z5RA 4MY7A 3SIDA 2BJYA 4GS7D 3WWLA 2KN9A 3ZG6A 4LPJA 2V2MA 5DM61 2XJOA 2BK6A 2Z5QA 3QB9A 4CYBA 2XJQA 3GHQA 4LQHA 5CMQA 2ITBA 4ISMA 3UOIA 4ETRA 5J93A 3C1YA 4RC6A 4XKSA 5J8SA 3K35A 5MLC3 4ITWA 2C6AA 1KRQA 1F33A 3AF8X 3GGZA 2ERSA 3C1ZA 3ISFA 4II4A 3NFPI 4DI0A 3EZUA 2BE5D 4ML5A 1RWDA 2M4VA 1DX8A 5D8RA 1JTSA 3IU3I 5FEJA 3F36A 1IW7D 3KWOA 5GU1X 1YK5A 4RXNA 2RBDA 2XJTA 3KDQA 3PW8C 2GS4A 2LCQA 1TJOA 3F35A 4XGHA 5HU6D 3FSEA 5CZUA 2VXIA 4ITTA 4AM5A 3E1JA 4QUWA 2Z90A 3H7GA 4MXPA 1S24A 1RDVA 3BKNA 2FL0A 2CF7A 3PW1A 8RXNA 2UX1A 5D8YA 2XJRA 1L8IA 3QVDA 4AR3A 1RCGA 3O7SA 3E6SA 4IWKA 1QCVA 2YJJA 4ERUA 1R0IA 2C6BA 2CLBA 2V8UA 4POFA 1TKOA 3PW8A 5GU3X 2IB0A 1VEIA 1NF4A 3SS2A 1FHMA 3PZAA 3QHBA 5MF6A 5EIOC 2GYDA 4ZL6A 3SH6A 4ZTTA 3Q4RA 2A6HD 1NF6A 1AEWA 3FRRA 1S30A 3WVWA 5JVG1 4PG1A 4W4KB 1T9OA 1IU5A 3BVLA 1UVHA 4DYXA 4LHLA 2V2OA 4CVTA 5JACA 3V3KB 3KA4A 4CMYV 4M35A 1SOFA 1VZGA 2A69D 2ZG9X 4JADA 2FHAA 2JD60 2XKQA 1R0FA 4TODA 1S3QA 4E6KA 1F30A 1T9QA 2RDVA 3FRSA 1L8HA 5K52A 4ZJKA 2CKAA 2ERJA 2JI3A 4POGA 1IESA 3A68A 5EINC 3KYVA 2K2DA 1CADA 1JREA 5JKMA 7RXNA 4AR6A 4II4B 1HRSA 5LBHA 1O9RA 1QGHA 4CVRA 3E2CA 3AK8A 3KA8A 4REUA 2GYQA 5FFAA 1ZS3A 2ZIXA 6RXNA 4AHWA 1J30A 4AM4A 1R0HA 3FI6A 2HTNA 5HQOA 1RDGA 3KA6A 3NP2X 1IERA 4PGIA 2X170 3VV9A 2V2PA 1C09A 1JKVA 3WVUA 2PYAA 5GN8A 4YWLA 3BVEA 3AJQA 3PIP1 1NXGA 1RCIA 3E6RA 3PWQC 3KX9A 3RBCA 3F32A 1BG7A 2CN7A 4TVMA 5AI2A 1BQ9A 1TKPA 2FZFA 3QD8A 2NYDA 2YW7A 1R0JA 4XKUA 3IS8A 4RC5A 5H1Sc 1BRFA 5JDOA 2ZURX 4LQVA 2XJUA 3EGMA 3KA3A 1FHAA 3QZ3A 3E1LA 4V196 3NOZX 4LYXA 1DATA 2WTLA 2VZBA 2V2JA 3QHCA 2F7NA 4WJG4 3D19A 2V2SA 5JVH1 1LKMA 5GAEc 3PKJA 3AF9X 2QL0A 5HJHA 2WLAA 3LNLA 3RGDA 4EVEA 3PWQA 4ZMCA 1JYBA 2YJKA 4UY81 2V2RA 3PVRB 1RB9A 2D5KA 2V2LA 5FFDA 1VELA 5GU2X 3BT5A 1LTLA 2FKZA 3PKIA 5GOUA 2AR0A 5HJFA 3W54A 1H7VA 2KKDA 1ZUJA 4Z5SA 3U90A 1XZ3A 3AF7X 2Z6MA 2V0EA 4JAEA 1Z4AA 4XGSA 2VL6A 1BCFA 1FHHA 3Q4NA 2XGWA 4RC7B 3FVBA 1TK6A 3UNOA 1QYBA 3OJ5A 5J9VA 1BE7A 3NP0X 4DYUA 4W4LB 4LHNA 2Z3QB 2VXXA 4AHXA 1IROA 2L0ZA 2CHIA 5GU0X 4ZKXA 4AR5A 5DM71 4AHYA 2N02A 3A9QA 3PVYA 4YXJA 1RCEA 2FG4A 4M32A 2J9UB 2A68D 4AI1A 1E8JA 1VJXA 2M6PA 2V2IA 3N6OA 4YVZA 2C2FA 3F39A 3P8BA 1S2ZA 3RAVA 3KYXA 5E2DA 3A44A 5JDOB 3AJPA 5LG2A 2CLUA 4ZKWA 3WVVA 4MJYA 2O5JD 1EUMA 3UFBA 2C41A 3RYGA 2ZA8A 2MS3A 1B2OA 2V8TA 5IY0A 2CKCA 4MUDA 3R2HA 4TOGA 4TPUA 1B2JA 4ZLWA 4RC6B 1BQ8A 4M33A 1SMMA 3F38A 3HL1A 5I4JA 4G6BA 3RE7A 2CEIA 1OWCA 3GE4A 4B8CD 1NXEA 3GVYA 5MFPA 2PYBA 5JKLA 4EVBA 1NFVA 1RYQA 2JD70 5K2ME 4PGKA 5JKMG 5FFBA 1T9PA 4Y08A 3E1OA 5GAGc 3Q4QA 4LPMA 3J7Y1 4MKUA 2JI2A 1YUXA 4P18A 1WJVA 4IXKA 3PWFA 3KHKA 5C6FA 4A25A 3E1MA 3ERZA 4IWJA 4ZN3B 4CMYA 3WNWA 2FG8A 3Q4OA 2CHPA 3TA8A 2CWLA 1SMUA 1LKOA 4DYYA 1DVBA 3SHXA 4ZKHA 3VNXA 3MSUA 3PIO1 3KXUA 5AXSA 3PW1B 4DE6A 1GWGA 4E6YA 4ME3A 2G38B 2BKCA 2Y3QA 3HIUA 4Z3BA 2Y44A 4TOEA 5MGNA 1R0GA 4ZN1B 3J7Z1 2QF9A 2PVXA 3O7RA 3UOFA 2H12A 1YK4A 4DZ0A 4CYAA 2Z5PA 4JAGA 2IY4A 4CY9A 2B5ID 3KYUA 4YKHA 1UMNA 3PVTA 3F34A 1BFRA 3DBYA 2ZG7X 4M34A 2CN6A 5E1UA 3R2OA 4AR4A 3MPSA 2HR5A 2OKCA 2M4YA 1LKPA 1JGCA 2V2NA 3AK9A 3GGYA 3RD0A 5LG8A 5AI3A 4PG0A 4KVRA 4AI0A 1NNQA 2WLUA 2YW6A 3VVAA 4CVSA 1ODHA 2CR8A 3KYWA 5AN9H 4OYNA 4KVQA 5D8OA 1SMWA 2XJPA 1IU6A 5IX6A 3BVKA 3B08B 3R2LA 1Z92B 5GAHc 1OTKA 1XZ1A 3LKDA 1MOJA 1H96A 4DASA 2ZA7A 1VCXA 3AJOA 3F33A 2JI1A 3WWNB 4U671 1VLGA 3C23A 1MFRA 1JKUA 3R2SA 4JAFA 2XJVA 1JI5A 4TOCA 1Z6OM 5FFCA 1CAAA 1YV1A 5D8XA 1LB3A 5GN8B 1ZRPA 3SE1A 3EZ0A 2CIHA 2A6ED 5MFZA 4TOBA 4EVDA 1RYTA 5D8SA 3KA9A 4ISPA 2AYJA 3VPBE 4AHZA 5K53A 1VZHA 1O9IA 2JD80 4RC5B 3BVIA 1VZIA 3L0MA 4XXBB 4LQJA 4TW3A 2DSXA 3R2MA 4ZL5A 4U3GA 1B13A 4KVSA 2ZG8X 3C21A 3B0AB 5RXNA 2PVEA 4AI2A 5GADc 1JI4A 1YUZA 1DPSA 3E1QA 5D8QA 2BW1A 2IU2A 4WFN1 3ISEA 2V0FA 5ERJA 3PVRA 3R2KA 4X0JA 3ES3A 2XJMA 3IQ1A 1RCCA 2PSMC 3PVTB 4LQNA 2XJNA 5CMRA 1VEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1Q A;  2V3B B;  4AM2 A;  3T9J A;  4TO9 A;  4TOF A;  3E1N A;  2ZA6 A;  3R2R A;  4EVC A;  5FFE A;  5JKL G;  3F37 A;  4LPN A;  4MN9 A;  1B71 A;  3OGH A;  4RC8 A;  4R42 A;  4RC7 A;  5LS9 A;  1JIG A;  3KYY A;  2OH3 A;  4XKT A;  5D8P A;  2C6R A;  2GMG A;  3RZ6 A;  1RCD A;  3BVF A;  4YWM A;  5J8W A;  4LYU A;  1IRN A;  2OC5 A;  3IS7 A;  1R03 A;  1SQ3 A;  2C2J A;  4TOH A;  2FFX J;  2FJC A;  4K9F A;  2W0O A;  3E1P A;  4CVP A;  1Z6O A;  3PVY B;  3RZT A;  2QQY A;  2G4H A;  4TOA A;  4DYZ A;  1BFY A;  2V15 A;  5ERK A;  2C2U A;  2Z5R A;  4MY7 A;  3SID A;  2BJY A;  2KN9 A;  4LPJ A;  2V2M A;  2XJO A;  2BK6 A;  2Z5Q A;  3QB9 A;  4CYB A;  3GHQ A;  4LQH A;  5CMQ A;  2ITB A;  4ISM A;  3UOI A;  4ETR A;  5J93 A;  4RC6 A;  4XKS A;  5J8S A;  4ITW A;  1KRQ A;  1F33 A;  3AF8 X;  3ISF A;  4II4 A;  4DI0 A;  3EZU A;  4ML5 A;  1RWD A;  1DX8 A;  5D8R A;  1JTS A;  5FEJ A;  3F36 A;  3KWO A;  5GU1 X;  1YK5 A;  4RXN A;  2RBD A;  3PW8 C;  2GS4 A;  2LCQ A;  1TJO A;  3F35 A;  3FSE A;  5CZU A;  2VXI A;  4ITT A;  4AM5 A;  3E1J A;  4QUW A;  2Z90 A;  3H7G A;  1S24 A;  1RDV A;  3BKN A;  2FL0 A;  2CF7 A;  3PW1 A;  8RXN A;  2UX1 A;  5D8Y A;  1L8I A;  3QVD A;  4AR3 A;  1RCG A;  3O7S A;  3E6S A;  4IWK A;  1QCV A;  2YJJ A;  4ERU A;  1R0I A;  2CLB A;  4POF A;  1TKO A;  3PW8 A;  5GU3 X;  2IB0 A;  1VEI A;  1NF4 A;  3SS2 A;  1FHM A;  3PZA A;  3QHB A;  2GYD A;  4ZL6 A;  3SH6 A;  4ZTT A;  3Q4R A;  1NF6 A;  1AEW A;  1S30 A;  3WVW A;  4PG1 A;  1T9O A;  1IU5 A;  3BVL A;  1UVH A;  4DYX A;  2V2O A;  4CVT A;  5JAC A;  3KA4 A;  4CMY V;  4M35 A;  1SOF A;  2ZG9 X;  2FHA A;  2JD6 0;  2XKQ A;  1R0F A;  4TOD A;  1S3Q A;  4E6K A;  1F30 A;  1T9Q A;  2RDV A;  1L8H A;  5K52 A;  4ZJK A;  4POG A;  1IES A;  3A68 A;  3KYV A;  2K2D A;  1CAD A;  1JRE A;  5JKM A;  7RXN A;  4AR6 A;  4II4 B;  1HRS A;  5LBH A;  1O9R A;  1QGH A;  4CVR A;  3E2C A;  3AK8 A;  3KA8 A;  4REU A;  2GYQ A;  5FFA A;  1ZS3 A;  6RXN A;  1J30 A;  4AM4 A;  1R0H A;  3FI6 A;  2HTN A;  5HQO A;  1RDG A;  3KA6 A;  3NP2 X;  1IER A;  4PGI A;  2X17 0;  2V2P A;  1C09 A;  1JKV A;  3WVU A;  2PYA A;  5GN8 A;  4YWL A;  3BVE A;  3AJQ A;  1RCI A;  3E6R A;  3PWQ C;  3KX9 A;  3RBC A;  3F32 A;  1BG7 A;  2CN7 A;  5AI2 A;  1BQ9 A;  1TKP A;  2FZF A;  3QD8 A;  2YW7 A;  1R0J A;  4XKU A;  3IS8 A;  4RC5 A;  1BRF A;  2ZUR X;  4LQV A;  3EGM A;  3KA3 A;  1FHA A;  3QZ3 A;  3E1L A;  3NOZ X;  4LYX A;  1DAT A;  2WTL A;  2VZB A;  2V2J A;  3QHC A;  2F7N A;  2V2S A;  1LKM A;  3AF9 X;  2QL0 A;  5HJH A;  2WLA A;  3RGD A;  4EVE A;  3PWQ A;  4ZMC A;  1JYB A;  2YJK A;  2V2R A;  3PVR B;  1RB9 A;  2D5K A;  2V2L A;  5FFD A;  1VEL A;  5GU2 X;  3BT5 A;  1LTL A;  2FKZ A;  5GOU A;  5HJF A;  1H7V A;  2KKD A;  1ZUJ A;  4Z5S A;  3U90 A;  1XZ3 A;  3AF7 X;  2Z6M A;  1Z4A A;  4XGS A;  2VL6 A;  1BCF A;  1FHH A;  3Q4N A;  2XGW A;  4RC7 B;  3FVB A;  1TK6 A;  3UNO A;  1QYB A;  3OJ5 A;  5J9V A;  1BE7 A;  3NP0 X;  4DYU A;  2VXX A;  1IRO A;  2CHI A;  5GU0 X;  4ZKX A;  4AR5 A;  3A9Q A;  3PVY A;  1RCE A;  2FG4 A;  4M32 A;  1E8J A;  1VJX A;  2V2I A;  2C2F A;  3F39 A;  1S2Z A;  3RAV A;  3KYX A;  5E2D A;  3A44 A;  3AJP A;  5LG2 A;  2CLU A;  4ZKW A;  3WVV A;  4MJY A;  1EUM A;  2C41 A;  3RYG A;  2ZA8 A;  2MS3 A;  1B2O A;  5IY0 A;  4MUD A;  3R2H A;  4TOG A;  4TPU A;  1B2J A;  4ZLW A;  4RC6 B;  1BQ8 A;  4M33 A;  1SMM A;  3F38 A;  3HL1 A;  5I4J A;  3RE7 A;  2CEI A;  3GE4 A;  3GVY A;  2PYB A;  5JKL A;  4EVB A;  1NFV A;  2JD7 0;  4PGK A;  5JKM G;  5FFB A;  1T9P A;  4Y08 A;  3E1O A;  3Q4Q A;  4LPM A;  4MKU A;  1YUX A;  4P18 A;  4IXK A;  3PWF A;  5C6F A;  4A25 A;  3E1M A;  3ERZ A;  4IWJ A;  4CMY A;  3WNW A;  2FG8 A;  3Q4O A;  2CHP A;  3TA8 A;  1SMU A;  1LKO A;  4DYY A;  1DVB A;  3SHX A;  4ZKH A;  3VNX A;  3KXU A;  5AXS A;  3PW1 B;  4DE6 A;  1GWG A;  4ME3 A;  2BKC A;  2Y3Q A;  3HIU A;  4Z3B A;  4TOE A;  1R0G A;  2QF9 A;  2PVX A;  3O7R A;  3UOF A;  1YK4 A;  4DZ0 A;  4CYA A;  2Z5P A;  2IY4 A;  4CY9 A;  3KYU A;  4YKH A;  1UMN A;  3PVT A;  3F34 A;  1BFR A;  2ZG7 X;  4M34 A;  2CN6 A;  5E1U A;  3R2O A;  4AR4 A;  3MPS A;  2HR5 A;  2M4Y A;  1LKP A;  1JGC A;  2V2N A;  3AK9 A;  3RD0 A;  5LG8 A;  5AI3 A;  4PG0 A;  4KVR A;  1NNQ A;  2WLU A;  2YW6 A;  4CVS A;  3KYW A;  4OYN A;  4KVQ A;  5D8O A;  1SMW A;  1IU6 A;  5IX6 A;  3BVK A;  3R2L A;  1OTK A;  1XZ1 A;  1MOJ A;  1H96 A;  4DAS A;  2ZA7 A;  1VCX A;  3AJO A;  3F33 A;  1VLG A;  1MFR A;  1JKU A;  3R2S A;  1JI5 A;  4TOC A;  1Z6O M;  5FFC A;  1CAA A;  1YV1 A;  5D8X A;  1LB3 A;  5GN8 B;  1ZRP A;  3SE1 A;  3EZ0 A;  2CIH A;  4TOB A;  4EVD A;  1RYT A;  5D8S A;  3KA9 A;  4ISP A;  5K53 A;  1O9I A;  2JD8 0;  4RC5 B;  3BVI A;  4LQJ A;  4TW3 A;  2DSX A;  3R2M A;  4ZL5 A;  4U3G A;  1B13 A;  4KVS A;  2ZG8 X;  5RXN A;  2PVE A;  1JI4 A;  1YUZ A;  1DPS A;  3E1Q A;  5D8Q A;  2BW1 A;  2IU2 A;  3ISE A;  5ERJ A;  3PVR A;  3R2K A;  3ES3 A;  2XJM A;  3IQ1 A;  1RCC A;  3PVT B;  4LQN A;  2XJN A;  5CMR A;  1VEQ A; 
#chains in the Genus database with same CATH topology
 1N1Q A;  2V3B B;  3LWQ B;  4AM2 A;  3T9J A;  4KXR B;  4BXX L;  4TO9 A;  4TOF A;  3E1N A;  2ZA6 A;  3R2R A;  4EVC A;  2M6O A;  3LWR B;  5FFE A;  5JKL G;  3F37 A;  4LPN A;  4MN9 A;  2WWX B;  2AQC A;  1B71 A;  2Z3R B;  3OGH A;  4RC8 A;  4R42 A;  4RC7 A;  5LS9 A;  1PZX A;  1JIG A;  3KYY A;  2OH3 A;  4XKT A;  3QQC E;  3HOU L;  5D8P A;  3HOW L;  2C6R A;  2GMG A;  4E40 A;  2XJS A;  2PPT A;  3RZ6 A;  1RCD A;  3BVF A;  4YWM A;  5J8W A;  4LYU A;  1IRN A;  3PO3 L;  1SFO L;  2OC5 A;  3IS7 A;  3LPE B;  3JZ9 A;  1R03 A;  1SQ3 A;  1OWB A;  2C2J A;  2MGY A;  4TOH A;  2FFX J;  2FJC A;  3P2A A;  4K9F A;  3JZA B;  2EY4 E;  2W0O A;  3E1P A;  1P7P A;  4CVP A;  1Z6O A;  4A93 L;  3PVY B;  3RZT A;  2QQY A;  2G4H A;  4TOA A;  4DYZ A;  1BFY A;  3M6J A;  4YXM A;  4AI3 A;  2V15 A;  2JA7 L;  5ERK A;  2C2U A;  2Z5R A;  4MY7 A;  1Y1V L;  3SID A;  2BJY A;  3H97 A;  4GS7 D;  3WWL A;  2KN9 A;  3ZG6 A;  4LPJ A;  2V2M A;  5DM6 1;  1I3Q L;  2XJO A;  2BK6 A;  2Z5Q A;  3QB9 A;  2JA8 L;  3GTJ L;  4CYB A;  2XJQ A;  5IP9 L;  5M3F L;  3GHQ A;  4LQH A;  5CMQ A;  2ITB A;  4ISM A;  3UOI A;  4ETR A;  5J93 A;  3C1Y A;  4RC6 A;  4XKS A;  5J8S A;  3K35 A;  5MLC 3;  4ITW A;  2C6A A;  1KRQ A;  4C3I L;  1F33 A;  3AF8 X;  3GGZ A;  2ERS A;  3C1Z A;  3HKZ P;  3ISF A;  4II4 A;  3NFP I;  3HOY L;  4DI0 A;  4A3K L;  3EZU A;  2BE5 D;  4ML5 A;  1RWD A;  5M3M L;  2M4V A;  1DX8 A;  5D8R A;  1JTS A;  3IU3 I;  5C3E L;  4A3I L;  5FEJ A;  3F36 A;  1IW7 D;  3GTQ L;  3KWO A;  5GU1 X;  1YK5 A;  4RXN A;  3HJW B;  4X6A L;  2RBD A;  2XJT A;  3KDQ A;  3PW8 C;  2GS4 A;  1TWH L;  2LCQ A;  1TJO A;  3F35 A;  4XGH A;  5HU6 D;  1PFW A;  3FKI L;  5FJ8 L;  3FSE A;  3GTL L;  5CZU A;  4A3C L;  2VXI A;  4ITT A;  2NVT L;  4AM5 A;  3LWO B;  3E1J A;  4QUW A;  2Z90 A;  3H7G A;  4MXP A;  1S24 A;  1RDV A;  3BKN A;  2FL0 A;  2CF7 A;  3PW1 A;  8RXN A;  3S17 L;  2UX1 A;  5D8Y A;  2XJR A;  1L8I A;  3QVD A;  4AR3 A;  1RCG A;  3O7S A;  3E6S A;  4IWK A;  1QCV A;  2YJJ A;  4ERU A;  1R0I A;  3HAX C;  2C6B A;  2CLB A;  2V8U A;  3FDJ A;  4POF A;  1TKO A;  3PW8 A;  4C3H L;  5GU3 X;  2IB0 A;  1VEI A;  1NF4 A;  3SS2 A;  1FHM A;  4QIW P;  5IYD L;  3PZA A;  3QHB A;  5MF6 A;  5EIO C;  3M4O L;  3GTM L;  2GYD A;  4ZL6 A;  3SH6 A;  2PMZ P;  4ZTT A;  3Q4R A;  2A6H D;  1NF6 A;  1AEW A;  3FRR A;  1S30 A;  3WVW A;  5JVG 1;  4PG1 A;  4W4K B;  1T9O A;  1IU5 A;  3BVL A;  1UVH A;  4DYX A;  4LHL A;  3H3V M;  2V2O A;  4CVT A;  5JAC A;  3V3K B;  3KA4 A;  1TWG L;  4CMY V;  4M35 A;  1SOF A;  1VZG A;  1TWC L;  2A69 D;  2ZG9 X;  4JAD A;  2FHA A;  2JD6 0;  2XKQ A;  4A3J L;  1R0F A;  4TOD A;  1WCM L;  1S3Q A;  4E6K A;  1F30 A;  1T9Q A;  2RDV A;  4Y7N L;  3FRS A;  1L8H A;  5K52 A;  4ZJK A;  2CKA A;  2ERJ A;  2JI3 A;  3H0G L;  4POG A;  1IES A;  3A68 A;  1F4L A;  5EIN C;  3KYV A;  2K2D A;  1CAD A;  2NVX L;  1JRE A;  5JKM A;  7RXN A;  4AR6 A;  5C4J L;  4II4 B;  1HRS A;  5LBH A;  1O9R A;  1QGH A;  4CVR A;  3GTG L;  3E2C A;  3AK8 A;  3KA8 A;  4REU A;  2GYQ A;  5FFA A;  1ZS3 A;  2ZIX A;  6RXN A;  4AHW A;  4A3G L;  1J30 A;  4AM4 A;  1R0H A;  3FI6 A;  2HTN A;  5HQO A;  1RDG A;  3KA6 A;  5M5X L;  3NP2 X;  1IER A;  4PGI A;  2X17 0;  3VV9 A;  2V2P A;  1C09 A;  1JKV A;  3H99 A;  3WVU A;  2PYA A;  5GN8 A;  4YWL A;  3BVE A;  3HOV L;  3AJQ A;  3PIP 1;  1NXG A;  1RCI A;  3E6R A;  3PWQ C;  3KX9 A;  1R9T L;  3RBC A;  3F32 A;  1BG7 A;  2CN7 A;  4TVM A;  5AI2 A;  1BQ9 A;  1TKP A;  2FZF A;  3QD8 A;  2NYD A;  2YW7 A;  1R0J A;  4A3L L;  4XKU A;  3IS8 A;  4RC5 A;  4A3E L;  5H1S c;  1BRF A;  5JDO A;  2ZUR X;  3MQK B;  4LQV A;  2XJU A;  3EGM A;  3KA3 A;  1FHA A;  3QZ3 A;  3E1L A;  4V19 6;  3NOZ X;  4LYX A;  1DAT A;  2WTL A;  2VZB A;  5M5W L;  2V2J A;  3QHC A;  2F7N A;  4WJG 4;  3D19 A;  3HOZ L;  2V2S A;  5JVH 1;  1LKM A;  5GAE c;  2E2H L;  3PKJ A;  3AF9 X;  2QL0 A;  5HJH A;  2WLA A;  3LNL A;  3RGD A;  4EVE A;  3PWQ A;  4ZMC A;  1JYB A;  2YJK A;  3LWP B;  4UY8 1;  2V2R A;  3PVR B;  1RB9 A;  2D5K A;  2V2L A;  3S15 L;  4BY7 L;  5FFD A;  1VEL A;  5GU2 X;  3BT5 A;  1LTL A;  2FKZ A;  3PKI A;  3S2D L;  5GOU A;  2AR0 A;  5HJF A;  3W54 A;  1H7V A;  5IP7 L;  2R92 L;  2KKD A;  1ZUJ A;  4Z5S A;  3U90 A;  1XZ3 A;  3AF7 X;  2AUS B;  2Z6M A;  2V0E A;  4JAE A;  1Z4A A;  4XGS A;  3PL5 A;  2HVY C;  1Y1W L;  2VL6 A;  1BCF A;  2RFK B;  1FHH A;  3Q4N A;  2XGW A;  4RC7 B;  3FVB A;  1TK6 A;  3UNO A;  1QYB A;  3OJ5 A;  5FLM L;  5J9V A;  1BE7 A;  3NP0 X;  4DYU A;  4W4L B;  4LHN A;  3GTP L;  2Z3Q B;  2VXX A;  4AHX A;  1IRO A;  3S2H L;  2L0Z A;  2CHI A;  5GU0 X;  4ZKX A;  4AR5 A;  5DM7 1;  4Y52 L;  4AHY A;  3H9C A;  2N02 A;  3A9Q A;  3PVY A;  4YXJ A;  1RCE A;  2FG4 A;  4M32 A;  2J9U B;  2A68 D;  4AI1 A;  1TWF L;  1E8J A;  1VJX A;  2M6P A;  2V2I A;  3N6O A;  4YVZ A;  2C2F A;  3HJY B;  2NVQ L;  3GTO L;  3F39 A;  3P8B A;  1S2Z A;  3RAV A;  3KYX A;  5E2D A;  4AYB P;  3A44 A;  5JDO B;  3AJP A;  5LG2 A;  2CLU A;  4ZKW A;  3WVV A;  4MJY A;  2O5J D;  1EUM A;  3UFB A;  5IYB L;  2C41 A;  3RYG A;  2ZA8 A;  2MS3 A;  1B2O A;  4BBR L;  4A3F L;  2V8T A;  5IY0 A;  2B63 L;  2CKC A;  4MUD A;  3R2H A;  4TOG A;  4TPU A;  1B2J A;  4ZLW A;  4RC6 B;  1BQ8 A;  4A3M L;  4M33 A;  1SMM A;  3F38 A;  3HL1 A;  5I4J A;  4G6B A;  3RE7 A;  2Y0S P;  2CEI A;  1OWC A;  3GE4 A;  3GTK L;  4B8C D;  1NXE A;  3GVY A;  5MFP A;  2PYB A;  5JKL A;  1I50 L;  3S14 L;  2APO B;  3K7A L;  2NVY L;  4EVB A;  1NFV A;  3RZD L;  1RYQ A;  2JD7 0;  5K2M E;  4PGK A;  4BY1 L;  5JKM G;  3S1M L;  5FFB A;  1T9P A;  4Y08 A;  3E1O A;  5GAG c;  3Q4Q A;  4LPM A;  3J7Y 1;  4MKU A;  2JI2 A;  1YUX A;  4P18 A;  1WJV A;  4IXK A;  2E2J L;  3PWF A;  3KHK A;  5C6F A;  4A25 A;  2VUM L;  3E1M A;  3ERZ A;  4IWJ A;  4ZN3 B;  4CMY A;  3WNW A;  1PFY A;  2FG8 A;  3Q4O A;  2CHP A;  3TA8 A;  2CWL A;  1SMU A;  1LKO A;  4DYY A;  1DVB A;  3SHX A;  4ZKH A;  3VNX A;  2WAQ P;  3MSU A;  3PIO 1;  3KXU A;  5AXS A;  2YU9 L;  3PW1 B;  4DE6 A;  1GWG A;  4E6Y A;  4ME3 A;  2G38 B;  2BKC A;  2Y3Q A;  3HIU A;  4Z3B A;  2Y44 A;  4TOE A;  5MGN A;  1R0G A;  4ZN1 B;  5C44 L;  3J7Z 1;  2QF9 A;  2PVX A;  3O7R A;  3UOF A;  2R93 L;  2H12 A;  1YK4 A;  4DZ0 A;  4CYA A;  2Z5P A;  4JAG A;  2IY4 A;  4CY9 A;  2B5I D;  3KYU A;  4YKH A;  1UMN A;  3PVT A;  2JA6 L;  3F34 A;  3RZO L;  1BFR A;  3DBY A;  2ZG7 X;  4M34 A;  2CN6 A;  5E1U A;  3R2O A;  4AR4 A;  3MPS A;  5IYC L;  3S1R L;  2HR5 A;  2OKC A;  2M4Y A;  1LKP A;  3LWV B;  1JGC A;  2V2N A;  3AK9 A;  3GGY A;  3RD0 A;  5LG8 A;  2E2I L;  5AI3 A;  3CQZ L;  4PG0 A;  4KVR A;  4AI0 A;  1NNQ A;  2WLU A;  2YW6 A;  3VVA A;  4CVS A;  1ODH A;  3S1Q L;  2CR8 A;  5C4X L;  3S16 L;  3KYW A;  5AN9 H;  2WB1 P;  4OYN A;  4KVQ A;  5D8O A;  1SMW A;  2XJP A;  2JA5 L;  1IU6 A;  5IX6 A;  3BVK A;  3B08 B;  3R2L A;  1Z92 B;  5GAH c;  1OTK A;  1XZ1 A;  3LKD A;  4A3D L;  1MOJ A;  1H96 A;  4DAS A;  3H9B A;  2ZA7 A;  1VCX A;  3AJO A;  3F33 A;  3S1N L;  3HOX L;  2JI1 A;  3WWN B;  4U67 1;  1VLG A;  3C23 A;  1MFR A;  1JKU A;  3R2S A;  4JAF A;  2XJV A;  1JI5 A;  4TOC A;  1Z6O M;  5FFC A;  1CAA A;  2R7Z L;  1YV1 A;  5D8X A;  1LB3 A;  3I4M L;  5GN8 B;  1ZRP A;  3SE1 A;  3EZ0 A;  1TWA L;  2CIH A;  2A6E D;  5MFZ A;  1K83 L;  4TOB A;  4EVD A;  1RYT A;  5D8S A;  3KA9 A;  4ISP A;  1PFU A;  2AYJ A;  1PFV A;  3VPB E;  4AHZ A;  5K53 A;  1VZH A;  1O9I A;  2JD8 0;  1I6H L;  3PO2 L;  4A3B L;  4RC5 B;  3BVI A;  1VZI A;  3L0M A;  4XXB B;  4LQJ A;  4TW3 A;  2DSX A;  4C2M 1;  3R2M A;  4ZL5 A;  4U3G A;  1B13 A;  4KVS A;  2ZG8 X;  3C21 A;  3B0A B;  5RXN A;  2PVE A;  4AI2 A;  5GAD c;  5M5Y L;  1JI4 A;  1YUZ A;  1DPS A;  3E1Q A;  5D8Q A;  2BW1 A;  2IU2 A;  4WFN 1;  3ISE A;  3I4N L;  2V0F A;  4C3J L;  5ERJ A;  3JR7 A;  3PVR A;  3R2K A;  4X0J A;  3ES3 A;  2XJM A;  3IQ1 A;  1RCC A;  2PSM C;  4BBS L;  3PVT B;  4LQN A;  2XJN A;  5CMR A;  3M3Y L;  1QQT A;  1VEQ A; 
#chains in the Genus database with same CATH homology
 1N1Q A;  2V3B B;  4AM2 A;  3T9J A;  4KXR B;  4TO9 A;  4TOF A;  3E1N A;  2ZA6 A;  3R2R A;  4EVC A;  2M6O A;  5FFE A;  5JKL G;  3F37 A;  4LPN A;  4MN9 A;  2WWX B;  1B71 A;  2Z3R B;  3OGH A;  4RC8 A;  4R42 A;  4RC7 A;  5LS9 A;  1JIG A;  3KYY A;  2OH3 A;  4XKT A;  3QQC E;  5D8P A;  2C6R A;  2GMG A;  4E40 A;  2XJS A;  2PPT A;  3RZ6 A;  1RCD A;  3BVF A;  4YWM A;  5J8W A;  4LYU A;  1IRN A;  2OC5 A;  3IS7 A;  3LPE B;  3JZ9 A;  1R03 A;  1SQ3 A;  1OWB A;  2C2J A;  2MGY A;  4TOH A;  2FFX J;  2FJC A;  3P2A A;  4K9F A;  3JZA B;  2W0O A;  3E1P A;  4CVP A;  1Z6O A;  3PVY B;  3RZT A;  2QQY A;  2G4H A;  4TOA A;  4DYZ A;  1BFY A;  3M6J A;  4YXM A;  4AI3 A;  2V15 A;  5ERK A;  2C2U A;  2Z5R A;  4MY7 A;  3SID A;  2BJY A;  4GS7 D;  3WWL A;  2KN9 A;  3ZG6 A;  4LPJ A;  2V2M A;  5DM6 1;  2XJO A;  2BK6 A;  2Z5Q A;  3QB9 A;  4CYB A;  2XJQ A;  3GHQ A;  4LQH A;  5CMQ A;  2ITB A;  4ISM A;  3UOI A;  4ETR A;  5J93 A;  3C1Y A;  4RC6 A;  4XKS A;  5J8S A;  3K35 A;  5MLC 3;  4ITW A;  2C6A A;  1KRQ A;  1F33 A;  3AF8 X;  3GGZ A;  2ERS A;  3C1Z A;  3ISF A;  4II4 A;  3NFP I;  4DI0 A;  3EZU A;  2BE5 D;  4ML5 A;  1RWD A;  2M4V A;  1DX8 A;  5D8R A;  1JTS A;  3IU3 I;  5FEJ A;  3F36 A;  1IW7 D;  3KWO A;  5GU1 X;  1YK5 A;  4RXN A;  2RBD A;  2XJT A;  3KDQ A;  3PW8 C;  2GS4 A;  2LCQ A;  1TJO A;  3F35 A;  4XGH A;  5HU6 D;  3FSE A;  5CZU A;  2VXI A;  4ITT A;  4AM5 A;  3E1J A;  4QUW A;  2Z90 A;  3H7G A;  4MXP A;  1S24 A;  1RDV A;  3BKN A;  2FL0 A;  2CF7 A;  3PW1 A;  8RXN A;  2UX1 A;  5D8Y A;  2XJR A;  1L8I A;  3QVD A;  4AR3 A;  1RCG A;  3O7S A;  3E6S A;  4IWK A;  1QCV A;  2YJJ A;  4ERU A;  1R0I A;  2C6B A;  2CLB A;  2V8U A;  4POF A;  1TKO A;  3PW8 A;  5GU3 X;  2IB0 A;  1VEI A;  1NF4 A;  3SS2 A;  1FHM A;  3PZA A;  3QHB A;  5MF6 A;  5EIO C;  2GYD A;  4ZL6 A;  3SH6 A;  4ZTT A;  3Q4R A;  2A6H D;  1NF6 A;  1AEW A;  3FRR A;  1S30 A;  3WVW A;  5JVG 1;  4PG1 A;  4W4K B;  1T9O A;  1IU5 A;  3BVL A;  1UVH A;  4DYX A;  4LHL A;  2V2O A;  4CVT A;  5JAC A;  3V3K B;  3KA4 A;  4CMY V;  4M35 A;  1SOF A;  1VZG A;  2A69 D;  2ZG9 X;  4JAD A;  2FHA A;  2JD6 0;  2XKQ A;  1R0F A;  4TOD A;  1S3Q A;  4E6K A;  1F30 A;  1T9Q A;  2RDV A;  3FRS A;  1L8H A;  5K52 A;  4ZJK A;  2CKA A;  2ERJ A;  2JI3 A;  4POG A;  1IES A;  3A68 A;  5EIN C;  3KYV A;  2K2D A;  1CAD A;  1JRE A;  5JKM A;  7RXN A;  4AR6 A;  4II4 B;  1HRS A;  5LBH A;  1O9R A;  1QGH A;  4CVR A;  3E2C A;  3AK8 A;  3KA8 A;  4REU A;  2GYQ A;  5FFA A;  1ZS3 A;  2ZIX A;  6RXN A;  4AHW A;  1J30 A;  4AM4 A;  1R0H A;  3FI6 A;  2HTN A;  5HQO A;  1RDG A;  3KA6 A;  3NP2 X;  1IER A;  4PGI A;  2X17 0;  3VV9 A;  2V2P A;  1C09 A;  1JKV A;  3WVU A;  2PYA A;  5GN8 A;  4YWL A;  3BVE A;  3AJQ A;  3PIP 1;  1NXG A;  1RCI A;  3E6R A;  3PWQ C;  3KX9 A;  3RBC A;  3F32 A;  1BG7 A;  2CN7 A;  4TVM A;  5AI2 A;  1BQ9 A;  1TKP A;  2FZF A;  3QD8 A;  2NYD A;  2YW7 A;  1R0J A;  4XKU A;  3IS8 A;  4RC5 A;  5H1S c;  1BRF A;  5JDO A;  2ZUR X;  4LQV A;  2XJU A;  3EGM A;  3KA3 A;  1FHA A;  3QZ3 A;  3E1L A;  4V19 6;  3NOZ X;  4LYX A;  1DAT A;  2WTL A;  2VZB A;  2V2J A;  3QHC A;  2F7N A;  4WJG 4;  3D19 A;  2V2S A;  5JVH 1;  1LKM A;  5GAE c;  3PKJ A;  3AF9 X;  2QL0 A;  5HJH A;  2WLA A;  3LNL A;  3RGD A;  4EVE A;  3PWQ A;  4ZMC A;  1JYB A;  2YJK A;  4UY8 1;  2V2R A;  3PVR B;  1RB9 A;  2D5K A;  2V2L A;  5FFD A;  1VEL A;  5GU2 X;  3BT5 A;  1LTL A;  2FKZ A;  3PKI A;  5GOU A;  2AR0 A;  5HJF A;  3W54 A;  1H7V A;  2KKD A;  1ZUJ A;  4Z5S A;  3U90 A;  1XZ3 A;  3AF7 X;  2Z6M A;  2V0E A;  4JAE A;  1Z4A A;  4XGS A;  2VL6 A;  1BCF A;  1FHH A;  3Q4N A;  2XGW A;  4RC7 B;  3FVB A;  1TK6 A;  3UNO A;  1QYB A;  3OJ5 A;  5J9V A;  1BE7 A;  3NP0 X;  4DYU A;  4W4L B;  4LHN A;  2Z3Q B;  2VXX A;  4AHX A;  1IRO A;  2L0Z A;  2CHI A;  5GU0 X;  4ZKX A;  4AR5 A;  5DM7 1;  4AHY A;  2N02 A;  3A9Q A;  3PVY A;  4YXJ A;  1RCE A;  2FG4 A;  4M32 A;  2J9U B;  2A68 D;  4AI1 A;  1E8J A;  1VJX A;  2M6P A;  2V2I A;  3N6O A;  4YVZ A;  2C2F A;  3F39 A;  3P8B A;  1S2Z A;  3RAV A;  3KYX A;  5E2D A;  3A44 A;  5JDO B;  3AJP A;  5LG2 A;  2CLU A;  4ZKW A;  3WVV A;  4MJY A;  2O5J D;  1EUM A;  3UFB A;  2C41 A;  3RYG A;  2ZA8 A;  2MS3 A;  1B2O A;  2V8T A;  5IY0 A;  2CKC A;  4MUD A;  3R2H A;  4TOG A;  4TPU A;  1B2J A;  4ZLW A;  4RC6 B;  1BQ8 A;  4M33 A;  1SMM A;  3F38 A;  3HL1 A;  5I4J A;  4G6B A;  3RE7 A;  2CEI A;  1OWC A;  3GE4 A;  4B8C D;  1NXE A;  3GVY A;  5MFP A;  2PYB A;  5JKL A;  4EVB A;  1NFV A;  1RYQ A;  2JD7 0;  5K2M E;  4PGK A;  5JKM G;  5FFB A;  1T9P A;  4Y08 A;  3E1O A;  5GAG c;  3Q4Q A;  4LPM A;  3J7Y 1;  4MKU A;  2JI2 A;  1YUX A;  4P18 A;  1WJV A;  4IXK A;  3PWF A;  3KHK A;  5C6F A;  4A25 A;  3E1M A;  3ERZ A;  4IWJ A;  4ZN3 B;  4CMY A;  3WNW A;  2FG8 A;  3Q4O A;  2CHP A;  3TA8 A;  2CWL A;  1SMU A;  1LKO A;  4DYY A;  1DVB A;  3SHX A;  4ZKH A;  3VNX A;  3MSU A;  3PIO 1;  3KXU A;  5AXS A;  3PW1 B;  4DE6 A;  1GWG A;  4E6Y A;  4ME3 A;  2G38 B;  2BKC A;  2Y3Q A;  3HIU A;  4Z3B A;  2Y44 A;  4TOE A;  5MGN A;  1R0G A;  4ZN1 B;  3J7Z 1;  2QF9 A;  2PVX A;  3O7R A;  3UOF A;  2H12 A;  1YK4 A;  4DZ0 A;  4CYA A;  2Z5P A;  4JAG A;  2IY4 A;  4CY9 A;  2B5I D;  3KYU A;  4YKH A;  1UMN A;  3PVT A;  3F34 A;  1BFR A;  3DBY A;  2ZG7 X;  4M34 A;  2CN6 A;  5E1U A;  3R2O A;  4AR4 A;  3MPS A;  2HR5 A;  2OKC A;  2M4Y A;  1LKP A;  1JGC A;  2V2N A;  3AK9 A;  3GGY A;  3RD0 A;  5LG8 A;  5AI3 A;  4PG0 A;  4KVR A;  4AI0 A;  1NNQ A;  2WLU A;  2YW6 A;  3VVA A;  4CVS A;  1ODH A;  2CR8 A;  3KYW A;  5AN9 H;  4OYN A;  4KVQ A;  5D8O A;  1SMW A;  2XJP A;  1IU6 A;  5IX6 A;  3BVK A;  3B08 B;  3R2L A;  1Z92 B;  5GAH c;  1OTK A;  1XZ1 A;  3LKD A;  1MOJ A;  1H96 A;  4DAS A;  2ZA7 A;  1VCX A;  3AJO A;  3F33 A;  2JI1 A;  3WWN B;  4U67 1;  1VLG A;  3C23 A;  1MFR A;  1JKU A;  3R2S A;  4JAF A;  2XJV A;  1JI5 A;  4TOC A;  1Z6O M;  5FFC A;  1CAA A;  1YV1 A;  5D8X A;  1LB3 A;  5GN8 B;  1ZRP A;  3SE1 A;  3EZ0 A;  2CIH A;  2A6E D;  5MFZ A;  4TOB A;  4EVD A;  1RYT A;  5D8S A;  3KA9 A;  4ISP A;  2AYJ A;  3VPB E;  4AHZ A;  5K53 A;  1VZH A;  1O9I A;  2JD8 0;  4RC5 B;  3BVI A;  1VZI A;  3L0M A;  4XXB B;  4LQJ A;  4TW3 A;  2DSX A;  3R2M A;  4ZL5 A;  4U3G A;  1B13 A;  4KVS A;  2ZG8 X;  3C21 A;  3B0A B;  5RXN A;  2PVE A;  4AI2 A;  5GAD c;  1JI4 A;  1YUZ A;  1DPS A;  3E1Q A;  5D8Q A;  2BW1 A;  2IU2 A;  4WFN 1;  3ISE A;  2V0F A;  5ERJ A;  3PVR A;  3R2K A;  4X0J A;  3ES3 A;  2XJM A;  3IQ1 A;  1RCC A;  2PSM C;  3PVT B;  4LQN A;  2XJN A;  5CMR A;  1VEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...