2C41A

X-ray structure of dps from thermosynechococcus elongatus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
155
structure length
155
Chain Sequence
TTTLKEQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAERSLMLDGQPVADPADYLKVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAGDIGTADLYTRLVQTHQKHRWFLKEFLAKGDGLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Iron-binding/oxidation protein
molecule keywords DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
publication title Antioxidant Dps Protein from the Thermophilic Cyanobacterium Thermosynechococcus Elongatus.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 65
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2c41A01
1L8IA 3QZ3A 3ES3A 3KXUA 3KA8A 2BK6A 5FFEA 3F34A 5D8SA 1BCFA 2OC5A 4ZKXA 5E1UA 3F39A 1S30A 2XKQA 2FG4A 2CLBA 3PZAA 3R2SA 4ZJKA 4EVBA 1RCCA 3KX9A 1VLGA 4IWJA 5D8XA 1SOFA 2BJYA 3O7RA 2IY4A 4TOHA 2ZG7X 2CLUA 2C2JA 4TO9A 4CYBA 4CY9A 4DZ0A 1S2ZA 3QVDA 2FG8A 3BVLA 3AK9A 2UX1A 5J8SA 5LS9A 3QB9A 1MFRA 2CF7A 3ERZA 3NOZX 5GOUA 2C41A 3TA8A 3R2OA 4DYXA 2V2PA 2WLAA 1VEIA 1B71A 4ISPA 1JKVA 4TW3A 2IB0A 1NF4A 4ITTA 3FVBA 4OYNA 3E6RA 3PWFA 5C6FA 4DYYA 2Z5RA 3RGDA 3SE1A 3RE7A 2C2FA 3PVYA 2YJJA 2XJMA 2V2IA 1SQ3A 1VJXA 3GE4A 4MN9A 3U90A 4E6KA 2Z6MA 3Q4QA 2G4HA 4LQJA 3SHXA 4LQVA 4CVSA 3KA4A 3AK8A 2C6RA 2CHIA 4MUDA 3R2LA 4TOGA 2FFXJ 2V2LA 3KWOA 4TODA 4MJYA 4IXKA 5ERKA 2GYDA 3E1LA 1RCDA 3IS8A 3QHBA 4ITWA 5K53A 4KVSA 3F32A 5JKLG 1YUXA 3A9QA 2PYBA 4ZKHA 3RBCA 1RCGA 4TOEA 1JREA 4ZL6A 1OTKA 1RCEA 3HL1A 3BVFA 2OH3A 3RAVA 1J30A 4PGIA 3BVKA 4LQNA 4EVCA 1IERA 4CVRA 2V2SA 2HTNA 5JACA 5JKMA 4IWKA 2BW1A 4AM4A 3OGHA 5GU2X 4CYAA 2V2MA 3UOFA 2FHAA 3EZ0A 5GU3X 5LBHA 4DE6A 2IU2A 5HJHA 2XGWA 2C2UA 3F35A 4PGKA 4M32A 3F36A 4KVQA 5J8WA 4RC8A 3AF7X 5D8RA 4TOFA 5J9VA 4M34A 4TOBA 2FZFA 1MOJA 3NP2X 1JIGA 5D8PA 4M33A 5FFCA 5HQOA 3KA9A 2FL0A 3E1NA 1NF6A 3Q4NA 3PW1A 3E1OA 3PVRA 3PVRB 2Y3QA 4A25A 2CEIA 4DASA 4ERUA 3BT5A 3IS7A 3R2KA 4RC6A 1F33A 1N1QA 5FEJA 2XJOA 4PG1A 3FSEA 3PVYB 3EZUA 4MKUA 2V15A 1BG7A 1LKOA 2QF9A 2VXIA 3PVTA 2RBDA 1H96A 1DVBA 5GN8A 3WVWA 3PW8C 4LPJA 5FFAA 2ZG9X 5ERJA 3MPSA 4MY7A 1Z6OM 2W0OA 2XJNA 4LPNA 5IX6A 1GWGA 3GVYA 2QQYA 1NNQA 4LYUA 3VNXA 1QGHA 3KA3A 1JGCA 2YJKA 5K52A 4RC7A 4RC7B 1LKPA 5CMRA 3E1JA 2FKZA 1FHAA 3BVIA 1ZUJA 3AJOA 4XKSA 5GU0X 5AXSA 4TOAA 1BFRA 2V2NA 1JTSA 2CIHA 4Y08A 3BKNA 2BKCA 5CMQA 3EGMA 3PW8A 3Q4RA 4ZKWA 3NP0X 2V2JA 4P18A 1IESA 1DPSA 2D5KA 3Q4OA 4YKHA 3F37A 4RC5A 3E1QA 4KVRA 4RC5B 2V2RA 2ZG8X 2F7NA 3A68A 5I4JA 2JD80 3H7GA 4M35A 3F33A 4AM2A 4ZTTA 3PWQC 1JI5A 1F30A 4LPMA 4XGSA 1JYBA 2Z90A 1LKMA 1JI4A 4II4A 1UVHA 4U3GA 1YV1A 4ML5A 4ZLWA 3R2RA 1L8HA 5FFDA 4QUWA 3AF9X 4R42A 2Z5QA 3KA6A 3WVUA 1TKOA 5E2DA 4ETRA 5J93A 3HIUA 5JKLA 4XKUA 2V2OA 1VEQA 2FJCA 3UNOA 3UOIA 1R03A 4EVDA 3GHQA 2VXXA 3IQ1A 2JD60 2ZA6A 4DI0A 1Z6OA 1O9RA 2ZA7A 3PWQA 1LB3A 3AF8X 1UMNA 1NFVA 3PW1B 3E1MA 4Z3BA 1HRSA 1XZ3A 4Z5SA 2CN7A 2Z5PA 4RC6B 2GYQA 2WTLA 1Z4AA 2ZA8A 4ISMA 1QYBA 5GU1X 1EUMA 1DATA 3SH6A 3PVTB 1YUZA 3E6SA 2GS4A 5GN8B 3O7SA 5D8OA 2X170 1RYTA 2ZURX 1ZS3A 5D8QA 2WLUA 1TJOA 3SIDA 3ISEA 3ISFA 3E2CA 1XZ1A 2VZBA 4TOCA 4DYUA 4LQHA 5JKMG 3QD8A 4CMYV 4CVPA 4DYZA 2JD70 3RD0A 5LG8A 3BVEA 3FI6A 3AJQA 4EVEA 1KRQA 5FFBA 4CMYA 4ZL5A 5LG2A 1RCIA 2YW6A 1VELA 3T9JA 4CVTA 1TK6A 3QHCA 4AM5A 5CZUA 4ZMCA 3AJPA 3E1PA 4LYXA 2CHPA 3WNWA 2YW7A 2HR5A 1O9IA 1JKUA 3R2MA 3F38A 4PG0A 2ITBA 4XKTA 5D8YA 3WVVA 5HJFA 2CN6A 1S3QA 3OJ5A 4II4B 4REUA 3R2HA 1TKPA 1AEWA
chains in the Genus database with same CATH superfamily
1L8IA 3QZ3A 3ES3A 3KXUA 3KA8A 2BK6A 4MXPA 3F34A 5D8SA 4KXRB 1BCFA 5FFEA 2OC5A 4ZKXA 5E1UA 3F39A 1S30A 2XKQA 2FG4A 2CLBA 3PZAA 3R2SA 4ZJKA 4EVBA 1RCCA 3KX9A 1VLGA 3L0MA 4IWJA 1SOFA 5D8XA 2BJYA 3DBYA 3O7RA 2IY4A 4TOHA 2ZG7X 2CLUA 2C2JA 2N02A 4TO9A 4CYBA 4CY9A 4DZ0A 1S2ZA 3D19A 3QVDA 2FG8A 3BVLA 3AK9A 2UX1A 5J8SA 5LS9A 3QB9A 1MFRA 2CF7A 3ERZA 3NOZX 5GOUA 2C41A 3TA8A 3R2OA 4DYXA 2V2PA 2WLAA 1VEIA 1B71A 4ISPA 3FRSA 1JKVA 4TW3A 2IB0A 1NF4A 4ITTA 3FVBA 4OYNA 3E6RA 3PWFA 5C6FA 4DYYA 2Z5RA 3RGDA 3SE1A 3RE7A 2C2FA 3PVYA 2YJJA 2XJMA 2V2IA 1SQ3A 1VJXA 3GE4A 4MN9A 3U90A 3UFBA 4E6KA 2Z6MA 3Q4QA 2G4HA 4LQJA 3SHXA 4YXMA 4LQVA 4CVSA 3KA4A 3AK8A 2C6RA 2CHIA 4MUDA 3R2LA 4TOGA 2FFXJ 2V2LA 3KWOA 4TODA 4MJYA 4IXKA 5ERKA 2GYDA 3E1LA 1RCDA 3IS8A 5JDOB 3QHBA 4ITWA 5K53A 3FRRA 4KVSA 3F32A 5JKLG 3GGZA 1YUXA 3A9QA 2PYBA 4ZKHA 3RBCA 1RCGA 4TOEA 1JREA 4ZL6A 1OTKA 4YVZA 1RCEA 3HL1A 3KDQA 3BVFA 2OH3A 3RAVA 1J30A 4PGIA 3C1YA 3BVKA 4LQNA 4EVCA 1IERA 4CVRA 2V2SA 2HTNA 5JACA 5JKMA 4IWKA 2BW1A 4AM4A 3OGHA 5GU2X 4CYAA 2V2MA 3UOFA 2FHAA 3EZ0A 5GU3X 5LBHA 4DE6A 2IU2A 5HJHA 2XGWA 2C2UA 3F35A 4YXJA 4PGKA 4M32A 3F36A 4KVQA 5J8WA 4RC8A 3AF7X 5D8RA 4TOFA 5J9VA 4M34A 4TOBA 2FZFA 1MOJA 3NP2X 2G38B 1JIGA 5D8PA 4M33A 5FFCA 5HQOA 3KA9A 2FL0A 3E1NA 1NF6A 2OKCA 3Q4NA 3PW1A 3E1OA 3PVRA 3PVRB 2Y3QA 4A25A 2CEIA 4DASA 4ERUA 3BT5A 3IS7A 3R2KA 4RC6A 1F33A 1N1QA 5FEJA 2XJOA 4PG1A 3JZAB 3FSEA 3PVYB 3EZUA 4MKUA 2V15A 1BG7A 1LKOA 2QF9A 2VXIA 5HU6D 3PVTA 2RBDA 1H96A 1DVBA 5GN8A 3WVWA 3PW8C 4LPJA 5FFAA 2ZG9X 5ERJA 3MPSA 4MY7A 1Z6OM 2W0OA 2XJNA 4LPNA 5IX6A 1GWGA 3JZ9A 3GVYA 2QQYA 1NNQA 4LYUA 2AR0A 3M6JA 3VNXA 1QGHA 3KA3A 1JGCA 2YJKA 5K52A 4RC7A 4RC7B 1LKPA 5CMRA 3E1JA 2FKZA 1FHAA 3BVIA 1ZUJA 3AJOA 4XKSA 5GU0X 5AXSA 4TOAA 1BFRA 2V2NA 1JTSA 2CIHA 3VV9A 4E40A 4Y08A 3BKNA 2BKCA 5CMQA 3EGMA 2WWXB 3PW8A 3Q4RA 4ZKWA 3NP0X 2V2JA 4P18A 1IESA 1DPSA 2D5KA 3Q4OA 4YKHA 3F37A 4RC5A 3E1QA 4KVRA 4RC5B 2V2RA 2ZG8X 2F7NA 3A68A 3GGYA 3N6OA 5I4JA 2JD80 3H7GA 4M35A 4W4LB 3F33A 4AM2A 4ZTTA 3PWQC 1JI5A 1F30A 4LPMA 3C21A 4XGSA 1JYBA 2Z90A 1LKMA 2Y44A 1JI4A 4II4A 1UVHA 4U3GA 1YV1A 4ML5A 4ZLWA 3R2RA 3KHKA 2MGYA 1L8HA 5FFDA 4QUWA 3AF9X 4R42A 2Z5QA 3KA6A 3WVUA 1TKOA 5E2DA 4ETRA 5J93A 3HIUA 5JKLA 4WJG4 4XKUA 2V2OA 2CWLA 3C23A 1VEQA 2FJCA 3UNOA 3UOIA 1R03A 4EVDA 3GHQA 2VXXA 3IQ1A 2JD60 2ZA6A 4DI0A 1Z6OA 1O9RA 2ZA7A 3PWQA 1LB3A 3AF8X 1UMNA 1NFVA 3W54A 3PW1B 3E1MA 4Z3BA 2V8UA 1HRSA 1XZ3A 4Z5SA 2CN7A 2Z5PA 4RC6B 2GYQA 2WTLA 1Z4AA 2ZA8A 4ISMA 1QYBA 5GU1X 1EUMA 1DATA 3SH6A 3PVTB 4W4KB 1YUZA 3E6SA 2GS4A 5GN8B 3O7SA 5D8OA 2X170 1RYTA 2ZURX 1ZS3A 4X0JA 5D8QA 2WLUA 1TJOA 3SIDA 3ISEA 3ISFA 3V3KB 3E2CA 1XZ1A 2VZBA 4TOCA 3C1ZA 4DYUA 4LQHA 5JKMG 3QD8A 4CMYV 4CVPA 3VVAA 4DYZA 2JD70 3RD0A 5LG8A 3BVEA 5JDOA 3FI6A 3AJQA 4EVEA 1KRQA 5FFBA 3LKDA 4CMYA 4ZL5A 5LG2A 1RCIA 2YW6A 1VELA 3T9JA 4CVTA 1TK6A 3QHCA 4AM5A 5CZUA 4ZMCA 3AJPA 3E1PA 2V8TA 4LYXA 2CHPA 3WNWA 2YW7A 2HR5A 1O9IA 1JKUA 3R2MA 3F38A 4PG0A 2ITBA 4XKTA 5D8YA 3WVVA 5HJFA 2CN6A 1S3QA 3OJ5A 4II4B 4REUA 3R2HA 1TKPA 1AEWA
chains in the Genus database with same CATH topology
1L8IA 3QZ3A 3ES3A 3KXUA 3KA8A 2BK6A 4MXPA 3F34A 5D8SA 4KXRB 1BCFA 5FFEA 2OC5A 4ZKXA 5E1UA 3F39A 1S30A 2XKQA 2FG4A 2CLBA 3PZAA 3R2SA 4ZJKA 4EVBA 1RCCA 3KX9A 1VLGA 3L0MA 4IWJA 1SOFA 5D8XA 2BJYA 3DBYA 3O7RA 2IY4A 4TOHA 2ZG7X 2CLUA 2C2JA 2N02A 4TO9A 4CYBA 4CY9A 4DZ0A 1S2ZA 3D19A 3QVDA 2FG8A 3BVLA 3AK9A 2UX1A 5J8SA 5LS9A 3QB9A 1MFRA 2CF7A 3ERZA 3NOZX 5GOUA 2C41A 3TA8A 3R2OA 4DYXA 2V2PA 2WLAA 1VEIA 1B71A 4ISPA 3FRSA 1JKVA 4TW3A 2IB0A 1NF4A 4ITTA 3FVBA 4OYNA 3E6RA 3PWFA 5C6FA 4DYYA 2Z5RA 3RGDA 3SE1A 3RE7A 2C2FA 3PVYA 2YJJA 2XJMA 2V2IA 1SQ3A 1VJXA 3GE4A 4MN9A 3U90A 3UFBA 4E6KA 2Z6MA 3Q4QA 2G4HA 4LQJA 3SHXA 4YXMA 4LQVA 4CVSA 3KA4A 3AK8A 2C6RA 2CHIA 4MUDA 3R2LA 4TOGA 2FFXJ 2V2LA 3KWOA 4TODA 4MJYA 4IXKA 5ERKA 2GYDA 3E1LA 1RCDA 3IS8A 5JDOB 3QHBA 4ITWA 5K53A 3FRRA 4KVSA 3F32A 5JKLG 3GGZA 1YUXA 3A9QA 2PYBA 4ZKHA 3RBCA 1RCGA 4TOEA 1JREA 4ZL6A 1OTKA 4YVZA 1RCEA 3HL1A 3KDQA 3BVFA 2OH3A 3RAVA 1J30A 4PGIA 3C1YA 3BVKA 4LQNA 4EVCA 1IERA 4CVRA 2V2SA 2HTNA 5JACA 5JKMA 4IWKA 2BW1A 4AM4A 3OGHA 5GU2X 4CYAA 2V2MA 3UOFA 2FHAA 3EZ0A 5GU3X 5LBHA 4DE6A 2IU2A 5HJHA 2XGWA 2C2UA 3F35A 4YXJA 4PGKA 4M32A 3F36A 4KVQA 5J8WA 4RC8A 3AF7X 5D8RA 4TOFA 5J9VA 4M34A 4TOBA 2FZFA 1MOJA 3NP2X 2G38B 1JIGA 5D8PA 4M33A 5FFCA 5HQOA 3KA9A 2FL0A 3E1NA 1NF6A 2OKCA 3Q4NA 3PW1A 3E1OA 3PVRA 3PVRB 2Y3QA 4A25A 2CEIA 4DASA 4ERUA 3BT5A 3IS7A 3R2KA 4RC6A 1F33A 1N1QA 5FEJA 2XJOA 4PG1A 3JZAB 3FSEA 3PVYB 3EZUA 4MKUA 2V15A 1BG7A 1LKOA 2QF9A 2VXIA 5HU6D 3PVTA 2RBDA 1H96A 1DVBA 5GN8A 3WVWA 3PW8C 4LPJA 5FFAA 2ZG9X 5ERJA 3MPSA 4MY7A 1Z6OM 2W0OA 2XJNA 4LPNA 5IX6A 1GWGA 3JZ9A 3GVYA 2QQYA 1NNQA 4LYUA 2AR0A 3M6JA 3VNXA 1QGHA 3KA3A 1JGCA 2YJKA 5K52A 4RC7A 4RC7B 1LKPA 5CMRA 3E1JA 2FKZA 1FHAA 3BVIA 1ZUJA 3AJOA 4XKSA 5GU0X 5AXSA 4TOAA 1BFRA 2V2NA 1JTSA 2CIHA 3VV9A 4E40A 4Y08A 3BKNA 2BKCA 5CMQA 3EGMA 2WWXB 3PW8A 3Q4RA 4ZKWA 3NP0X 2V2JA 4P18A 1IESA 1DPSA 2D5KA 3Q4OA 4YKHA 3F37A 4RC5A 3E1QA 4KVRA 4RC5B 2V2RA 2ZG8X 2F7NA 3A68A 3GGYA 3N6OA 5I4JA 2JD80 3H7GA 4M35A 4W4LB 3F33A 4AM2A 4ZTTA 3PWQC 1JI5A 1F30A 4LPMA 3C21A 4XGSA 1JYBA 2Z90A 1LKMA 2Y44A 1JI4A 4II4A 1UVHA 4U3GA 1YV1A 4ML5A 4ZLWA 3R2RA 3KHKA 2MGYA 1L8HA 5FFDA 4QUWA 3AF9X 4R42A 2Z5QA 3KA6A 3WVUA 1TKOA 5E2DA 4ETRA 5J93A 3HIUA 5JKLA 4WJG4 4XKUA 2V2OA 2CWLA 3C23A 1VEQA 2FJCA 3UNOA 3UOIA 1R03A 4EVDA 3GHQA 2VXXA 3IQ1A 2JD60 2ZA6A 4DI0A 1Z6OA 1O9RA 2ZA7A 3PWQA 1LB3A 3AF8X 1UMNA 1NFVA 3W54A 3PW1B 3E1MA 4Z3BA 2V8UA 1HRSA 1XZ3A 4Z5SA 2CN7A 2Z5PA 4RC6B 2GYQA 2WTLA 1Z4AA 2ZA8A 4ISMA 1QYBA 5GU1X 1EUMA 1DATA 3SH6A 3PVTB 4W4KB 1YUZA 3E6SA 2GS4A 5GN8B 3O7SA 5D8OA 2X170 1RYTA 2ZURX 1ZS3A 4X0JA 5D8QA 2WLUA 1TJOA 3SIDA 3ISEA 3ISFA 3V3KB 3E2CA 1XZ1A 2VZBA 4TOCA 3C1ZA 4DYUA 4LQHA 5JKMG 3QD8A 4CMYV 4CVPA 3VVAA 4DYZA 2JD70 3RD0A 5LG8A 3BVEA 5JDOA 3FI6A 3AJQA 4EVEA 1KRQA 5FFBA 3LKDA 4CMYA 4ZL5A 5LG2A 1RCIA 2YW6A 1VELA 3T9JA 4CVTA 1TK6A 3QHCA 4AM5A 5CZUA 4ZMCA 3AJPA 3E1PA 2V8TA 4LYXA 2CHPA 3WNWA 2YW7A 2HR5A 1O9IA 1JKUA 3R2MA 3F38A 4PG0A 2ITBA 4XKTA 5D8YA 3WVVA 5HJFA 2CN6A 1S3QA 3OJ5A 4II4B 4REUA 3R2HA 1TKPA 1AEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L8I A;  3QZ3 A;  3ES3 A;  3KXU A;  3KA8 A;  2BK6 A;  5FFE A;  3F34 A;  5D8S A;  1BCF A;  2OC5 A;  4ZKX A;  5E1U A;  3F39 A;  1S30 A;  2XKQ A;  2FG4 A;  2CLB A;  3PZA A;  3R2S A;  4ZJK A;  4EVB A;  1RCC A;  3KX9 A;  1VLG A;  4IWJ A;  5D8X A;  1SOF A;  2BJY A;  3O7R A;  2IY4 A;  4TOH A;  2ZG7 X;  2CLU A;  2C2J A;  4TO9 A;  4CYB A;  4CY9 A;  4DZ0 A;  1S2Z A;  3QVD A;  2FG8 A;  3BVL A;  3AK9 A;  2UX1 A;  5J8S A;  5LS9 A;  3QB9 A;  1MFR A;  2CF7 A;  3ERZ A;  3NOZ X;  5GOU A;  2C41 A;  3TA8 A;  3R2O A;  4DYX A;  2V2P A;  2WLA A;  1VEI A;  1B71 A;  4ISP A;  1JKV A;  4TW3 A;  2IB0 A;  1NF4 A;  4ITT A;  3FVB A;  4OYN A;  3E6R A;  3PWF A;  5C6F A;  4DYY A;  2Z5R A;  3RGD A;  3SE1 A;  3RE7 A;  2C2F A;  3PVY A;  2YJJ A;  2XJM A;  2V2I A;  1SQ3 A;  1VJX A;  3GE4 A;  4MN9 A;  3U90 A;  4E6K A;  2Z6M A;  3Q4Q A;  2G4H A;  4LQJ A;  3SHX A;  4LQV A;  4CVS A;  3KA4 A;  3AK8 A;  2C6R A;  2CHI A;  4MUD A;  3R2L A;  4TOG A;  2FFX J;  2V2L A;  3KWO A;  4TOD A;  4MJY A;  4IXK A;  5ERK A;  2GYD A;  3E1L A;  1RCD A;  3IS8 A;  3QHB A;  4ITW A;  5K53 A;  4KVS A;  3F32 A;  5JKL G;  1YUX A;  3A9Q A;  2PYB A;  4ZKH A;  3RBC A;  1RCG A;  4TOE A;  1JRE A;  4ZL6 A;  1OTK A;  1RCE A;  3HL1 A;  3BVF A;  2OH3 A;  3RAV A;  1J30 A;  4PGI A;  3BVK A;  4LQN A;  4EVC A;  1IER A;  4CVR A;  2V2S A;  2HTN A;  5JAC A;  5JKM A;  4IWK A;  2BW1 A;  4AM4 A;  3OGH A;  5GU2 X;  4CYA A;  2V2M A;  3UOF A;  2FHA A;  3EZ0 A;  5GU3 X;  5LBH A;  4DE6 A;  2IU2 A;  5HJH A;  2XGW A;  2C2U A;  3F35 A;  4PGK A;  4M32 A;  3F36 A;  4KVQ A;  5J8W A;  4RC8 A;  3AF7 X;  5D8R A;  4TOF A;  5J9V A;  4M34 A;  4TOB A;  2FZF A;  1MOJ A;  3NP2 X;  1JIG A;  5D8P A;  4M33 A;  5FFC A;  5HQO A;  3KA9 A;  2FL0 A;  3E1N A;  1NF6 A;  3Q4N A;  3PW1 A;  3E1O A;  3PVR A;  3PVR B;  2Y3Q A;  4A25 A;  2CEI A;  4DAS A;  4ERU A;  3BT5 A;  3IS7 A;  3R2K A;  4RC6 A;  1F33 A;  1N1Q A;  5FEJ A;  2XJO A;  4PG1 A;  3FSE A;  3PVY B;  3EZU A;  4MKU A;  2V15 A;  1BG7 A;  1LKO A;  2QF9 A;  2VXI A;  3PVT A;  2RBD A;  1H96 A;  1DVB A;  5GN8 A;  3WVW A;  3PW8 C;  4LPJ A;  5FFA A;  2ZG9 X;  5ERJ A;  3MPS A;  4MY7 A;  1Z6O M;  2W0O A;  2XJN A;  4LPN A;  5IX6 A;  1GWG A;  3GVY A;  2QQY A;  1NNQ A;  4LYU A;  3VNX A;  1QGH A;  3KA3 A;  1JGC A;  2YJK A;  5K52 A;  4RC7 A;  4RC7 B;  1LKP A;  5CMR A;  3E1J A;  2FKZ A;  1FHA A;  3BVI A;  1ZUJ A;  3AJO A;  4XKS A;  5GU0 X;  5AXS A;  4TOA A;  1BFR A;  2V2N A;  1JTS A;  2CIH A;  4Y08 A;  3BKN A;  2BKC A;  5CMQ A;  3EGM A;  3PW8 A;  3Q4R A;  4ZKW A;  3NP0 X;  2V2J A;  4P18 A;  1IES A;  1DPS A;  2D5K A;  3Q4O A;  4YKH A;  3F37 A;  4RC5 A;  3E1Q A;  4KVR A;  4RC5 B;  2V2R A;  2ZG8 X;  2F7N A;  3A68 A;  5I4J A;  2JD8 0;  3H7G A;  4M35 A;  3F33 A;  4AM2 A;  4ZTT A;  3PWQ C;  1JI5 A;  1F30 A;  4LPM A;  4XGS A;  1JYB A;  2Z90 A;  1LKM A;  1JI4 A;  4II4 A;  1UVH A;  4U3G A;  1YV1 A;  4ML5 A;  4ZLW A;  3R2R A;  1L8H A;  5FFD A;  4QUW A;  3AF9 X;  4R42 A;  2Z5Q A;  3KA6 A;  3WVU A;  1TKO A;  5E2D A;  4ETR A;  5J93 A;  3HIU A;  5JKL A;  4XKU A;  2V2O A;  1VEQ A;  2FJC A;  3UNO A;  3UOI A;  1R03 A;  4EVD A;  3GHQ A;  2VXX A;  3IQ1 A;  2JD6 0;  2ZA6 A;  4DI0 A;  1Z6O A;  1O9R A;  2ZA7 A;  3PWQ A;  1LB3 A;  3AF8 X;  1UMN A;  1NFV A;  3PW1 B;  3E1M A;  4Z3B A;  1HRS A;  1XZ3 A;  4Z5S A;  2CN7 A;  2Z5P A;  4RC6 B;  2GYQ A;  2WTL A;  1Z4A A;  2ZA8 A;  4ISM A;  1QYB A;  5GU1 X;  1EUM A;  1DAT A;  3SH6 A;  3PVT B;  1YUZ A;  3E6S A;  2GS4 A;  5GN8 B;  3O7S A;  5D8O A;  2X17 0;  1RYT A;  2ZUR X;  1ZS3 A;  5D8Q A;  2WLU A;  1TJO A;  3SID A;  3ISE A;  3ISF A;  3E2C A;  1XZ1 A;  2VZB A;  4TOC A;  4DYU A;  4LQH A;  5JKM G;  3QD8 A;  4CMY V;  4CVP A;  4DYZ A;  2JD7 0;  3RD0 A;  5LG8 A;  3BVE A;  3FI6 A;  3AJQ A;  4EVE A;  1KRQ A;  5FFB A;  4CMY A;  4ZL5 A;  5LG2 A;  1RCI A;  2YW6 A;  1VEL A;  3T9J A;  4CVT A;  1TK6 A;  3QHC A;  4AM5 A;  5CZU A;  4ZMC A;  3AJP A;  3E1P A;  4LYX A;  2CHP A;  3WNW A;  2YW7 A;  2HR5 A;  1O9I A;  1JKU A;  3R2M A;  3F38 A;  4PG0 A;  2ITB A;  4XKT A;  5D8Y A;  3WVV A;  5HJF A;  2CN6 A;  1S3Q A;  3OJ5 A;  4II4 B;  4REU A;  3R2H A;  1TKP A;  1AEW A; 
#chains in the Genus database with same CATH topology
 1L8I A;  3QZ3 A;  3ES3 A;  3KXU A;  3KA8 A;  2BK6 A;  4MXP A;  3F34 A;  5D8S A;  4KXR B;  1BCF A;  5FFE A;  2OC5 A;  4ZKX A;  5E1U A;  3F39 A;  1S30 A;  2XKQ A;  2FG4 A;  2CLB A;  3PZA A;  3R2S A;  4ZJK A;  4EVB A;  1RCC A;  3KX9 A;  1VLG A;  3L0M A;  4IWJ A;  1SOF A;  5D8X A;  2BJY A;  3DBY A;  3O7R A;  2IY4 A;  4TOH A;  2ZG7 X;  2CLU A;  2C2J A;  2N02 A;  4TO9 A;  4CYB A;  4CY9 A;  4DZ0 A;  1S2Z A;  3D19 A;  3QVD A;  2FG8 A;  3BVL A;  3AK9 A;  2UX1 A;  5J8S A;  5LS9 A;  3QB9 A;  1MFR A;  2CF7 A;  3ERZ A;  3NOZ X;  5GOU A;  2C41 A;  3TA8 A;  3R2O A;  4DYX A;  2V2P A;  2WLA A;  1VEI A;  1B71 A;  4ISP A;  3FRS A;  1JKV A;  4TW3 A;  2IB0 A;  1NF4 A;  4ITT A;  3FVB A;  4OYN A;  3E6R A;  3PWF A;  5C6F A;  4DYY A;  2Z5R A;  3RGD A;  3SE1 A;  3RE7 A;  2C2F A;  3PVY A;  2YJJ A;  2XJM A;  2V2I A;  1SQ3 A;  1VJX A;  3GE4 A;  4MN9 A;  3U90 A;  3UFB A;  4E6K A;  2Z6M A;  3Q4Q A;  2G4H A;  4LQJ A;  3SHX A;  4YXM A;  4LQV A;  4CVS A;  3KA4 A;  3AK8 A;  2C6R A;  2CHI A;  4MUD A;  3R2L A;  4TOG A;  2FFX J;  2V2L A;  3KWO A;  4TOD A;  4MJY A;  4IXK A;  5ERK A;  2GYD A;  3E1L A;  1RCD A;  3IS8 A;  5JDO B;  3QHB A;  4ITW A;  5K53 A;  3FRR A;  4KVS A;  3F32 A;  5JKL G;  3GGZ A;  1YUX A;  3A9Q A;  2PYB A;  4ZKH A;  3RBC A;  1RCG A;  4TOE A;  1JRE A;  4ZL6 A;  1OTK A;  4YVZ A;  1RCE A;  3HL1 A;  3KDQ A;  3BVF A;  2OH3 A;  3RAV A;  1J30 A;  4PGI A;  3C1Y A;  3BVK A;  4LQN A;  4EVC A;  1IER A;  4CVR A;  2V2S A;  2HTN A;  5JAC A;  5JKM A;  4IWK A;  2BW1 A;  4AM4 A;  3OGH A;  5GU2 X;  4CYA A;  2V2M A;  3UOF A;  2FHA A;  3EZ0 A;  5GU3 X;  5LBH A;  4DE6 A;  2IU2 A;  5HJH A;  2XGW A;  2C2U A;  3F35 A;  4YXJ A;  4PGK A;  4M32 A;  3F36 A;  4KVQ A;  5J8W A;  4RC8 A;  3AF7 X;  5D8R A;  4TOF A;  5J9V A;  4M34 A;  4TOB A;  2FZF A;  1MOJ A;  3NP2 X;  2G38 B;  1JIG A;  5D8P A;  4M33 A;  5FFC A;  5HQO A;  3KA9 A;  2FL0 A;  3E1N A;  1NF6 A;  2OKC A;  3Q4N A;  3PW1 A;  3E1O A;  3PVR A;  3PVR B;  2Y3Q A;  4A25 A;  2CEI A;  4DAS A;  4ERU A;  3BT5 A;  3IS7 A;  3R2K A;  4RC6 A;  1F33 A;  1N1Q A;  5FEJ A;  2XJO A;  4PG1 A;  3JZA B;  3FSE A;  3PVY B;  3EZU A;  4MKU A;  2V15 A;  1BG7 A;  1LKO A;  2QF9 A;  2VXI A;  5HU6 D;  3PVT A;  2RBD A;  1H96 A;  1DVB A;  5GN8 A;  3WVW A;  3PW8 C;  4LPJ A;  5FFA A;  2ZG9 X;  5ERJ A;  3MPS A;  4MY7 A;  1Z6O M;  2W0O A;  2XJN A;  4LPN A;  5IX6 A;  1GWG A;  3JZ9 A;  3GVY A;  2QQY A;  1NNQ A;  4LYU A;  2AR0 A;  3M6J A;  3VNX A;  1QGH A;  3KA3 A;  1JGC A;  2YJK A;  5K52 A;  4RC7 A;  4RC7 B;  1LKP A;  5CMR A;  3E1J A;  2FKZ A;  1FHA A;  3BVI A;  1ZUJ A;  3AJO A;  4XKS A;  5GU0 X;  5AXS A;  4TOA A;  1BFR A;  2V2N A;  1JTS A;  2CIH A;  3VV9 A;  4E40 A;  4Y08 A;  3BKN A;  2BKC A;  5CMQ A;  3EGM A;  2WWX B;  3PW8 A;  3Q4R A;  4ZKW A;  3NP0 X;  2V2J A;  4P18 A;  1IES A;  1DPS A;  2D5K A;  3Q4O A;  4YKH A;  3F37 A;  4RC5 A;  3E1Q A;  4KVR A;  4RC5 B;  2V2R A;  2ZG8 X;  2F7N A;  3A68 A;  3GGY A;  3N6O A;  5I4J A;  2JD8 0;  3H7G A;  4M35 A;  4W4L B;  3F33 A;  4AM2 A;  4ZTT A;  3PWQ C;  1JI5 A;  1F30 A;  4LPM A;  3C21 A;  4XGS A;  1JYB A;  2Z90 A;  1LKM A;  2Y44 A;  1JI4 A;  4II4 A;  1UVH A;  4U3G A;  1YV1 A;  4ML5 A;  4ZLW A;  3R2R A;  3KHK A;  2MGY A;  1L8H A;  5FFD A;  4QUW A;  3AF9 X;  4R42 A;  2Z5Q A;  3KA6 A;  3WVU A;  1TKO A;  5E2D A;  4ETR A;  5J93 A;  3HIU A;  5JKL A;  4WJG 4;  4XKU A;  2V2O A;  2CWL A;  3C23 A;  1VEQ A;  2FJC A;  3UNO A;  3UOI A;  1R03 A;  4EVD A;  3GHQ A;  2VXX A;  3IQ1 A;  2JD6 0;  2ZA6 A;  4DI0 A;  1Z6O A;  1O9R A;  2ZA7 A;  3PWQ A;  1LB3 A;  3AF8 X;  1UMN A;  1NFV A;  3W54 A;  3PW1 B;  3E1M A;  4Z3B A;  2V8U A;  1HRS A;  1XZ3 A;  4Z5S A;  2CN7 A;  2Z5P A;  4RC6 B;  2GYQ A;  2WTL A;  1Z4A A;  2ZA8 A;  4ISM A;  1QYB A;  5GU1 X;  1EUM A;  1DAT A;  3SH6 A;  3PVT B;  4W4K B;  1YUZ A;  3E6S A;  2GS4 A;  5GN8 B;  3O7S A;  5D8O A;  2X17 0;  1RYT A;  2ZUR X;  1ZS3 A;  4X0J A;  5D8Q A;  2WLU A;  1TJO A;  3SID A;  3ISE A;  3ISF A;  3V3K B;  3E2C A;  1XZ1 A;  2VZB A;  4TOC A;  3C1Z A;  4DYU A;  4LQH A;  5JKM G;  3QD8 A;  4CMY V;  4CVP A;  3VVA A;  4DYZ A;  2JD7 0;  3RD0 A;  5LG8 A;  3BVE A;  5JDO A;  3FI6 A;  3AJQ A;  4EVE A;  1KRQ A;  5FFB A;  3LKD A;  4CMY A;  4ZL5 A;  5LG2 A;  1RCI A;  2YW6 A;  1VEL A;  3T9J A;  4CVT A;  1TK6 A;  3QHC A;  4AM5 A;  5CZU A;  4ZMC A;  3AJP A;  3E1P A;  2V8T A;  4LYX A;  2CHP A;  3WNW A;  2YW7 A;  2HR5 A;  1O9I A;  1JKU A;  3R2M A;  3F38 A;  4PG0 A;  2ITB A;  4XKT A;  5D8Y A;  3WVV A;  5HJF A;  2CN6 A;  1S3Q A;  3OJ5 A;  4II4 B;  4REU A;  3R2H A;  1TKP A;  1AEW A; 
#chains in the Genus database with same CATH homology
 1L8I A;  3QZ3 A;  3ES3 A;  3KXU A;  3KA8 A;  2BK6 A;  4MXP A;  3F34 A;  5D8S A;  4KXR B;  1BCF A;  5FFE A;  2OC5 A;  4ZKX A;  5E1U A;  3F39 A;  1S30 A;  2XKQ A;  2FG4 A;  2CLB A;  3PZA A;  3R2S A;  4ZJK A;  4EVB A;  1RCC A;  3KX9 A;  1VLG A;  3L0M A;  4IWJ A;  1SOF A;  5D8X A;  2BJY A;  3DBY A;  3O7R A;  2IY4 A;  4TOH A;  2ZG7 X;  2CLU A;  2C2J A;  2N02 A;  4TO9 A;  4CYB A;  4CY9 A;  4DZ0 A;  1S2Z A;  3D19 A;  3QVD A;  2FG8 A;  3BVL A;  3AK9 A;  2UX1 A;  5J8S A;  5LS9 A;  3QB9 A;  1MFR A;  2CF7 A;  3ERZ A;  3NOZ X;  5GOU A;  2C41 A;  3TA8 A;  3R2O A;  4DYX A;  2V2P A;  2WLA A;  1VEI A;  1B71 A;  4ISP A;  3FRS A;  1JKV A;  4TW3 A;  2IB0 A;  1NF4 A;  4ITT A;  3FVB A;  4OYN A;  3E6R A;  3PWF A;  5C6F A;  4DYY A;  2Z5R A;  3RGD A;  3SE1 A;  3RE7 A;  2C2F A;  3PVY A;  2YJJ A;  2XJM A;  2V2I A;  1SQ3 A;  1VJX A;  3GE4 A;  4MN9 A;  3U90 A;  3UFB A;  4E6K A;  2Z6M A;  3Q4Q A;  2G4H A;  4LQJ A;  3SHX A;  4YXM A;  4LQV A;  4CVS A;  3KA4 A;  3AK8 A;  2C6R A;  2CHI A;  4MUD A;  3R2L A;  4TOG A;  2FFX J;  2V2L A;  3KWO A;  4TOD A;  4MJY A;  4IXK A;  5ERK A;  2GYD A;  3E1L A;  1RCD A;  3IS8 A;  5JDO B;  3QHB A;  4ITW A;  5K53 A;  3FRR A;  4KVS A;  3F32 A;  5JKL G;  3GGZ A;  1YUX A;  3A9Q A;  2PYB A;  4ZKH A;  3RBC A;  1RCG A;  4TOE A;  1JRE A;  4ZL6 A;  1OTK A;  4YVZ A;  1RCE A;  3HL1 A;  3KDQ A;  3BVF A;  2OH3 A;  3RAV A;  1J30 A;  4PGI A;  3C1Y A;  3BVK A;  4LQN A;  4EVC A;  1IER A;  4CVR A;  2V2S A;  2HTN A;  5JAC A;  5JKM A;  4IWK A;  2BW1 A;  4AM4 A;  3OGH A;  5GU2 X;  4CYA A;  2V2M A;  3UOF A;  2FHA A;  3EZ0 A;  5GU3 X;  5LBH A;  4DE6 A;  2IU2 A;  5HJH A;  2XGW A;  2C2U A;  3F35 A;  4YXJ A;  4PGK A;  4M32 A;  3F36 A;  4KVQ A;  5J8W A;  4RC8 A;  3AF7 X;  5D8R A;  4TOF A;  5J9V A;  4M34 A;  4TOB A;  2FZF A;  1MOJ A;  3NP2 X;  2G38 B;  1JIG A;  5D8P A;  4M33 A;  5FFC A;  5HQO A;  3KA9 A;  2FL0 A;  3E1N A;  1NF6 A;  2OKC A;  3Q4N A;  3PW1 A;  3E1O A;  3PVR A;  3PVR B;  2Y3Q A;  4A25 A;  2CEI A;  4DAS A;  4ERU A;  3BT5 A;  3IS7 A;  3R2K A;  4RC6 A;  1F33 A;  1N1Q A;  5FEJ A;  2XJO A;  4PG1 A;  3JZA B;  3FSE A;  3PVY B;  3EZU A;  4MKU A;  2V15 A;  1BG7 A;  1LKO A;  2QF9 A;  2VXI A;  5HU6 D;  3PVT A;  2RBD A;  1H96 A;  1DVB A;  5GN8 A;  3WVW A;  3PW8 C;  4LPJ A;  5FFA A;  2ZG9 X;  5ERJ A;  3MPS A;  4MY7 A;  1Z6O M;  2W0O A;  2XJN A;  4LPN A;  5IX6 A;  1GWG A;  3JZ9 A;  3GVY A;  2QQY A;  1NNQ A;  4LYU A;  2AR0 A;  3M6J A;  3VNX A;  1QGH A;  3KA3 A;  1JGC A;  2YJK A;  5K52 A;  4RC7 A;  4RC7 B;  1LKP A;  5CMR A;  3E1J A;  2FKZ A;  1FHA A;  3BVI A;  1ZUJ A;  3AJO A;  4XKS A;  5GU0 X;  5AXS A;  4TOA A;  1BFR A;  2V2N A;  1JTS A;  2CIH A;  3VV9 A;  4E40 A;  4Y08 A;  3BKN A;  2BKC A;  5CMQ A;  3EGM A;  2WWX B;  3PW8 A;  3Q4R A;  4ZKW A;  3NP0 X;  2V2J A;  4P18 A;  1IES A;  1DPS A;  2D5K A;  3Q4O A;  4YKH A;  3F37 A;  4RC5 A;  3E1Q A;  4KVR A;  4RC5 B;  2V2R A;  2ZG8 X;  2F7N A;  3A68 A;  3GGY A;  3N6O A;  5I4J A;  2JD8 0;  3H7G A;  4M35 A;  4W4L B;  3F33 A;  4AM2 A;  4ZTT A;  3PWQ C;  1JI5 A;  1F30 A;  4LPM A;  3C21 A;  4XGS A;  1JYB A;  2Z90 A;  1LKM A;  2Y44 A;  1JI4 A;  4II4 A;  1UVH A;  4U3G A;  1YV1 A;  4ML5 A;  4ZLW A;  3R2R A;  3KHK A;  2MGY A;  1L8H A;  5FFD A;  4QUW A;  3AF9 X;  4R42 A;  2Z5Q A;  3KA6 A;  3WVU A;  1TKO A;  5E2D A;  4ETR A;  5J93 A;  3HIU A;  5JKL A;  4WJG 4;  4XKU A;  2V2O A;  2CWL A;  3C23 A;  1VEQ A;  2FJC A;  3UNO A;  3UOI A;  1R03 A;  4EVD A;  3GHQ A;  2VXX A;  3IQ1 A;  2JD6 0;  2ZA6 A;  4DI0 A;  1Z6O A;  1O9R A;  2ZA7 A;  3PWQ A;  1LB3 A;  3AF8 X;  1UMN A;  1NFV A;  3W54 A;  3PW1 B;  3E1M A;  4Z3B A;  2V8U A;  1HRS A;  1XZ3 A;  4Z5S A;  2CN7 A;  2Z5P A;  4RC6 B;  2GYQ A;  2WTL A;  1Z4A A;  2ZA8 A;  4ISM A;  1QYB A;  5GU1 X;  1EUM A;  1DAT A;  3SH6 A;  3PVT B;  4W4K B;  1YUZ A;  3E6S A;  2GS4 A;  5GN8 B;  3O7S A;  5D8O A;  2X17 0;  1RYT A;  2ZUR X;  1ZS3 A;  4X0J A;  5D8Q A;  2WLU A;  1TJO A;  3SID A;  3ISE A;  3ISF A;  3V3K B;  3E2C A;  1XZ1 A;  2VZB A;  4TOC A;  3C1Z A;  4DYU A;  4LQH A;  5JKM G;  3QD8 A;  4CMY V;  4CVP A;  3VVA A;  4DYZ A;  2JD7 0;  3RD0 A;  5LG8 A;  3BVE A;  5JDO A;  3FI6 A;  3AJQ A;  4EVE A;  1KRQ A;  5FFB A;  3LKD A;  4CMY A;  4ZL5 A;  5LG2 A;  1RCI A;  2YW6 A;  1VEL A;  3T9J A;  4CVT A;  1TK6 A;  3QHC A;  4AM5 A;  5CZU A;  4ZMC A;  3AJP A;  3E1P A;  2V8T A;  4LYX A;  2CHP A;  3WNW A;  2YW7 A;  2HR5 A;  1O9I A;  1JKU A;  3R2M A;  3F38 A;  4PG0 A;  2ITB A;  4XKT A;  5D8Y A;  3WVV A;  5HJF A;  2CN6 A;  1S3Q A;  3OJ5 A;  4II4 B;  4REU A;  3R2H A;  1TKP A;  1AEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...