2C41A

X-ray structure of dps from thermosynechococcus elongatus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
155
structure length
155
Chain Sequence
TTTLKEQVLTTLKREQANAVVMYLNYKKYHWLTYGPLFRDLHLLFEEQGSEVFAMIDELAERSLMLDGQPVADPADYLKVATVTPSSGQLTVKQMIEEAIANHELIITEMHQDAEIATEAGDIGTADLYTRLVQTHQKHRWFLKEFLAKGDGLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DPS FAMILY DNA-BINDING STRESS RESPONSE PROTEIN
publication title Antioxidant Dps Protein from the Thermophilic Cyanobacterium Thermosynechococcus Elongatus.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Iron-binding/oxidation protein
total genus 65
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2c41A01
2X170 3O7SA 3UNOA 3PWQA 3QB9A 3PWQC 3ERZA 3FVBA 4REUA 2FL0A 3E6SA 2CLBA 4DE6A 2V15A 2OH3A 2WLAA 4P18A 3IS7A 5D8OA 1DVBA 4ZTTA 4TOBA 5GN8B 2FG8A 2BKCA 3QD8A 2WLUA 4RC7A 2V2SA 1F33A 4KVSA 1BG7A 3QVDA 4MN9A 4KVRA 5ERJA 4II4A 4PG1A 5GU3X 1KRQA 2ZA8A 3PWFA 2ZA6A 4ZKHA 5J9VA 4M34A 3IQ1A 4DYXA 5K52A 4DASA 1TK6A 2YJKA 5GU2X 1HRSA 3F32A 1YUZA 4TW3A 1B71A 2QQYA 4RC6A 4ZL5A 3R2HA 3RAVA 4AM4A 3F35A 2ZA7A 4PGKA 1VEQA 4LQVA 3E6RA 5ERKA 1IERA 3EGMA 4M32A 3Q4OA 4CVRA 3F39A 3NP0X 4CVTA 2W0OA 3PVTA 4LYUA 4RC5A 4LPNA 3Q4RA 2C6RA 3E1PA 3F37A 4E6KA 1J30A 4ISPA 1VJXA 2V2MA 3BVFA 5AXSA 5D8SA 2BK6A 2ZG9X 5JKMG 3ISEA 2ZG8X 4Z3BA 3T9JA 1LKPA 3PVYA 4XKUA 4TOGA 1JI5A 4ERUA 4ML5A 3MPSA 1TKPA 2CHPA 1MOJA 5CMQA 4ZKXA 3EZUA 2YW6A 4DZ0A 4LQNA 5D8PA 2C41A 3BKNA 2CN7A 4TO9A 5K53A 4CYAA 5GU0X 2QF9A 4DYUA 1Z6OA 1S3QA 3AF8X 5D8XA 2FFXJ 3QHCA 4TOAA 4MUDA 1L8IA 3E1NA 5FFEA 3SE1A 3E1LA 4DI0A 2G4HA 1JKUA 1NNQA 2C2JA 2VXXA 4MJYA 4ZKWA 1H96A 1QGHA 3R2OA 1YUXA 3AF9X 4IWKA 3RBCA 4XGSA 2IU2A 5LG2A 3PVRB 4AM2A 5GOUA 2IB0A 2GYQA 3SH6A 4Y08A 5E1UA 1RCDA 3TA8A 3FSEA 2V2LA 4MKUA 1LKOA 5FEJA 1R03A 2C2UA 3KA3A 5JKLA 2ITBA 1RCEA 3GVYA 3R2MA 3E1MA 1BCFA 1JTSA 4XKSA 5C6FA 3ISFA 2XGWA 2Z5PA 2BW1A 1F30A 5LG8A 1IESA 1TJOA 2F7NA 5I4JA 3AK9A 4M33A 1VLGA 4ITWA 3OJ5A 3SIDA 3WVWA 4TODA 4Z5SA 2CEIA 3BVLA 1NFVA 2V2RA 2HR5A 3PW1A 4CMYA 1JREA 2GS4A 4CVSA 4RC7B 3RGDA 3KX9A 3AJOA 1Z4AA 4A25A 3NP2X 1EUMA 2ZG7X 3F36A 1N1QA 1L8HA 4IWJA 5JACA 1QYBA 1NF6A 2XJMA 4II4B 4PGIA 4TOHA 4ZLWA 5GU1X 3E1JA 3OGHA 4ETRA 3RD0A 3WVVA 1O9RA 1MFRA 3EZ0A 4CMYV 2HTNA 2FHAA 2VZBA 4PG0A 5LBHA 3PZAA 4QUWA 4TOCA 3A68A 2CHIA 4RC6B 3QHBA 4LPJA 1NF4A 3IS8A 3AF7X 1TKOA 4DYYA 2D5KA 5IX6A 1ZUJA 1YV1A 2RBDA 5GN8A 4EVDA 3AJPA 3R2RA 3FI6A 4ZMCA 2FG4A 2CIHA 2V2OA 1UMNA 4CYBA 3R2KA 3PVTB 4MY7A 1JKVA 4RC5B 1FHAA 2WTLA 1JGCA 3H7GA 3O7RA 5HJFA 3BVIA 4YKHA 2V2NA 3PW8C 2Z5QA 1RCIA 4XKTA 3KA8A 4EVCA 3BVKA 5CZUA 5FFBA 5HQOA 3KWOA 4TOEA 2YW7A 3WVUA 1SOFA 2Z5RA 2Z90A 3PVYB 2V2JA 5HJHA 4LPMA 3UOFA 1BFRA 3VNXA 2PYBA 3E2CA 3A9QA 4U3GA 3KXUA 4EVEA 2XKQA 3RE7A 2C2FA 3AJQA 3E1OA 5FFCA 4R42A 4OYNA 1DPSA 4RC8A 5D8YA 2JD80 2UX1A 2V2PA 4M35A 2GYDA 3BVEA 1S2ZA 5JKMA 5J93A 3KA6A 2VXIA 2ZURX 2IY4A 2YJJA 1RCGA 3R2SA 3GHQA 5D8QA 4ITTA 3BT5A 4ISMA 3KA9A 5D8RA 4LQHA 3HL1A 2Z6MA 1O9IA 2FJCA 4LQJA 1VEIA 1LKMA 1AEWA 4DYZA 5JKLG 3SHXA 3QZ3A 2CN6A 3AK8A 3F38A 3WNWA 4CY9A 1Z6OM 1LB3A 3F34A 1S30A 2JD70 2FZFA 2OC5A 3F33A 1VELA 3NOZX 5FFDA 4EVBA 3E1QA 4AM5A 3U90A 2JD60 1OTKA 2FKZA 1JI4A 3GE4A 2V2IA 4ZJKA 2XJNA 1RCCA 3HIUA 4ZL6A 5J8SA 3ES3A 3PVRA 1ZS3A 4LYXA 5LS9A 3PW1B 3KA4A 3Q4QA 1RYTA 5FFAA 1UVHA 4TOFA 1JYBA 2CF7A 1DATA 1XZ3A 3PW8A 3Q4NA 2CLUA 4KVQA 3UOIA 2BJYA 1XZ1A 2Y3QA 4IXKA 5CMRA 5E2DA 1SQ3A 1JIGA 5J8WA 4CVPA 1GWGA 3R2LA 2XJOA
chains in the Genus database with same CATH superfamily
2X170 3V3KB 3O7SA 3UNOA 3PWQA 3QB9A 3PWQC 3ERZA 3FVBA 4REUA 2FL0A 3E6SA 2CLBA 4DE6A 2V15A 2OH3A 2WLAA 4P18A 3IS7A 5D8OA 1DVBA 4ZTTA 4TOBA 5GN8B 2FG8A 2BKCA 3QD8A 2WLUA 4RC7A 2V2SA 1F33A 4KVSA 1BG7A 2OKCA 3QVDA 4MN9A 4KVRA 5ERJA 4II4A 4PG1A 5GU3X 1KRQA 2ZA8A 3PWFA 2ZA6A 4ZKHA 5J9VA 4M34A 3IQ1A 4DYXA 2Y44A 5K52A 4DASA 1TK6A 2YJKA 5GU2X 4KXRB 1HRSA 3F32A 1YUZA 4TW3A 3JZAB 1B71A 2QQYA 4RC6A 4ZL5A 3R2HA 3RAVA 4AM4A 3W54A 3F35A 2ZA7A 4PGKA 1VEQA 3C23A 4W4KB 4LQVA 3E6RA 5ERKA 1IERA 3EGMA 4M32A 3Q4OA 4CVRA 3F39A 3NP0X 4CVTA 2W0OA 3PVTA 4LYUA 4RC5A 2G38B 4LPNA 4YVZA 3Q4RA 2C6RA 3E1PA 3F37A 4E6KA 1J30A 3LKDA 4ISPA 3C1YA 1VJXA 2V2MA 3BVFA 5AXSA 3N6OA 5D8SA 2BK6A 2ZG9X 5JKMG 2AR0A 3ISEA 2ZG8X 4Z3BA 3T9JA 1LKPA 4YXMA 3PVYA 5JDOA 4XKUA 4TOGA 1JI5A 4ERUA 4ML5A 3MPSA 1TKPA 2CHPA 1MOJA 4E40A 5CMQA 4ZKXA 3EZUA 2YW6A 4DZ0A 4LQNA 5D8PA 3GGZA 2C41A 3BKNA 2CN7A 4TO9A 5K53A 4CYAA 5GU0X 2QF9A 4DYUA 1Z6OA 1S3QA 3AF8X 5D8XA 2FFXJ 3QHCA 4TOAA 4MUDA 1L8IA 3E1NA 5FFEA 3SE1A 3E1LA 4DI0A 2G4HA 1JKUA 1NNQA 2C2JA 2VXXA 4MJYA 4ZKWA 1H96A 1QGHA 3R2OA 1YUXA 3AF9X 4IWKA 3RBCA 4XGSA 2IU2A 5LG2A 3PVRB 4AM2A 5GOUA 2IB0A 2GYQA 3SH6A 4Y08A 5E1UA 1RCDA 3TA8A 3FSEA 2V2LA 4MKUA 1LKOA 2V8TA 5FEJA 1R03A 2CWLA 2C2UA 3KA3A 5JKLA 2ITBA 1RCEA 3GVYA 3R2MA 3E1MA 1BCFA 1JTSA 4XKSA 5C6FA 3ISFA 2XGWA 2Z5PA 2BW1A 1F30A 5LG8A 1IESA 1TJOA 2F7NA 5I4JA 3AK9A 3DBYA 4M33A 1VLGA 4ITWA 3OJ5A 3SIDA 3WVWA 4TODA 4Z5SA 2CEIA 3BVLA 3C1ZA 1NFVA 2V2RA 2HR5A 3PW1A 4CMYA 1JREA 2GS4A 4YXJA 4CVSA 4RC7B 3RGDA 3KX9A 3AJOA 1Z4AA 4A25A 3NP2X 1EUMA 3L0MA 2ZG7X 3F36A 1N1QA 1L8HA 4IWJA 5JACA 1QYBA 1NF6A 2XJMA 4II4B 3KDQA 4PGIA 4TOHA 4ZLWA 5GU1X 3E1JA 3OGHA 4ETRA 3RD0A 3WVVA 1O9RA 1MFRA 3EZ0A 4CMYV 2HTNA 2FHAA 2VZBA 4PG0A 5LBHA 3PZAA 4QUWA 4TOCA 2V8UA 3A68A 2CHIA 4RC6B 3FRRA 3QHBA 4LPJA 1NF4A 3VV9A 3IS8A 3AF7X 1TKOA 4DYYA 2D5KA 5IX6A 1ZUJA 1YV1A 2RBDA 5GN8A 4EVDA 3AJPA 3R2RA 3FI6A 4ZMCA 2FG4A 2CIHA 2V2OA 1UMNA 4CYBA 3R2KA 3PVTB 4MY7A 1JKVA 4RC5B 1FHAA 2WTLA 1JGCA 3H7GA 3O7RA 5HJFA 3BVIA 4YKHA 2V2NA 3PW8C 2Z5QA 1RCIA 3FRSA 4XKTA 3KA8A 4EVCA 3BVKA 5CZUA 5FFBA 5HQOA 3KWOA 4TOEA 2YW7A 3WVUA 1SOFA 3VVAA 2Z5RA 2Z90A 3PVYB 5JDOB 2V2JA 5HJHA 4LPMA 3UOFA 4WJG4 2N02A 1BFRA 3VNXA 2PYBA 3E2CA 3A9QA 4U3GA 3KXUA 4EVEA 3D19A 3UFBA 2XKQA 2MGYA 2C2FA 3RE7A 3AJQA 3E1OA 5FFCA 4R42A 4OYNA 1DPSA 4RC8A 5D8YA 2JD80 2UX1A 2V2PA 4M35A 2GYDA 3BVEA 1S2ZA 5JKMA 5J93A 3KA6A 2VXIA 2ZURX 2WWXB 2IY4A 2YJJA 1RCGA 3R2SA 3GHQA 5D8QA 3C21A 4ITTA 3BT5A 4ISMA 3KA9A 5D8RA 3M6JA 4LQHA 3HL1A 2Z6MA 4X0JA 1O9IA 2FJCA 4LQJA 1VEIA 1LKMA 1AEWA 4MXPA 4DYZA 5JKLG 3SHXA 3QZ3A 2CN6A 3AK8A 3F38A 3KHKA 3WNWA 4CY9A 1Z6OM 1LB3A 3F34A 1S30A 2JD70 2FZFA 2OC5A 3F33A 1VELA 3NOZX 3JZ9A 5FFDA 4EVBA 3E1QA 4AM5A 3U90A 2JD60 1OTKA 2FKZA 1JI4A 3GE4A 2V2IA 4ZJKA 2XJNA 1RCCA 3HIUA 3GGYA 4ZL6A 5J8SA 3ES3A 3PVRA 1ZS3A 4LYXA 5LS9A 3PW1B 3KA4A 3Q4QA 1RYTA 5FFAA 1UVHA 4TOFA 1JYBA 2CF7A 1DATA 1XZ3A 3PW8A 3Q4NA 4W4LB 2CLUA 4KVQA 3UOIA 2BJYA 1XZ1A 2Y3QA 4IXKA 5CMRA 5E2DA 1SQ3A 1JIGA 5J8WA 4CVPA 5HU6D 1GWGA 3R2LA 2XJOA
chains in the Genus database with same CATH topology
2X170 3V3KB 3O7SA 3UNOA 3PWQA 3QB9A 3PWQC 3ERZA 3FVBA 4REUA 2FL0A 3E6SA 2CLBA 4DE6A 2V15A 2OH3A 2WLAA 4P18A 3IS7A 5D8OA 1DVBA 4ZTTA 4TOBA 5GN8B 2FG8A 2BKCA 3QD8A 2WLUA 4RC7A 2V2SA 1F33A 4KVSA 1BG7A 2OKCA 3QVDA 4MN9A 4KVRA 5ERJA 4II4A 4PG1A 5GU3X 1KRQA 2ZA8A 3PWFA 2ZA6A 4ZKHA 5J9VA 4M34A 3IQ1A 4DYXA 2Y44A 5K52A 4DASA 1TK6A 2YJKA 5GU2X 4KXRB 1HRSA 3F32A 1YUZA 4TW3A 3JZAB 1B71A 2QQYA 4RC6A 4ZL5A 3R2HA 3RAVA 4AM4A 3W54A 3F35A 2ZA7A 4PGKA 1VEQA 3C23A 4W4KB 4LQVA 3E6RA 5ERKA 1IERA 3EGMA 4M32A 3Q4OA 4CVRA 3F39A 3NP0X 4CVTA 2W0OA 3PVTA 4LYUA 4RC5A 2G38B 4LPNA 4YVZA 3Q4RA 2C6RA 3E1PA 3F37A 4E6KA 1J30A 3LKDA 4ISPA 3C1YA 1VJXA 2V2MA 3BVFA 5AXSA 3N6OA 5D8SA 2BK6A 2ZG9X 5JKMG 2AR0A 3ISEA 2ZG8X 4Z3BA 3T9JA 1LKPA 4YXMA 3PVYA 5JDOA 4XKUA 4TOGA 1JI5A 4ERUA 4ML5A 3MPSA 1TKPA 2CHPA 1MOJA 4E40A 5CMQA 4ZKXA 3EZUA 2YW6A 4DZ0A 4LQNA 5D8PA 3GGZA 2C41A 3BKNA 2CN7A 4TO9A 5K53A 4CYAA 5GU0X 2QF9A 4DYUA 1Z6OA 1S3QA 3AF8X 5D8XA 2FFXJ 3QHCA 4TOAA 4MUDA 1L8IA 3E1NA 5FFEA 3SE1A 3E1LA 4DI0A 2G4HA 1JKUA 1NNQA 2C2JA 2VXXA 4MJYA 4ZKWA 1H96A 1QGHA 3R2OA 1YUXA 3AF9X 4IWKA 3RBCA 4XGSA 2IU2A 5LG2A 3PVRB 4AM2A 5GOUA 2IB0A 2GYQA 3SH6A 4Y08A 5E1UA 1RCDA 3TA8A 3FSEA 2V2LA 4MKUA 1LKOA 2V8TA 5FEJA 1R03A 2CWLA 2C2UA 3KA3A 5JKLA 2ITBA 1RCEA 3GVYA 3R2MA 3E1MA 1BCFA 1JTSA 4XKSA 5C6FA 3ISFA 2XGWA 2Z5PA 2BW1A 1F30A 5LG8A 1IESA 1TJOA 2F7NA 5I4JA 3AK9A 3DBYA 4M33A 1VLGA 4ITWA 3OJ5A 3SIDA 3WVWA 4TODA 4Z5SA 2CEIA 3BVLA 3C1ZA 1NFVA 2V2RA 2HR5A 3PW1A 4CMYA 1JREA 2GS4A 4YXJA 4CVSA 4RC7B 3RGDA 3KX9A 3AJOA 1Z4AA 4A25A 3NP2X 1EUMA 3L0MA 2ZG7X 3F36A 1N1QA 1L8HA 4IWJA 5JACA 1QYBA 1NF6A 2XJMA 4II4B 3KDQA 4PGIA 4TOHA 4ZLWA 5GU1X 3E1JA 3OGHA 4ETRA 3RD0A 3WVVA 1O9RA 1MFRA 3EZ0A 4CMYV 2HTNA 2FHAA 2VZBA 4PG0A 5LBHA 3PZAA 4QUWA 4TOCA 2V8UA 3A68A 2CHIA 4RC6B 3FRRA 3QHBA 4LPJA 1NF4A 3VV9A 3IS8A 3AF7X 1TKOA 4DYYA 2D5KA 5IX6A 1ZUJA 1YV1A 2RBDA 5GN8A 4EVDA 3AJPA 3R2RA 3FI6A 4ZMCA 2FG4A 2CIHA 2V2OA 1UMNA 4CYBA 3R2KA 3PVTB 4MY7A 1JKVA 4RC5B 1FHAA 2WTLA 1JGCA 3H7GA 3O7RA 5HJFA 3BVIA 4YKHA 2V2NA 3PW8C 2Z5QA 1RCIA 3FRSA 4XKTA 3KA8A 4EVCA 3BVKA 5CZUA 5FFBA 5HQOA 3KWOA 4TOEA 2YW7A 3WVUA 1SOFA 3VVAA 2Z5RA 2Z90A 3PVYB 5JDOB 2V2JA 5HJHA 4LPMA 3UOFA 4WJG4 2N02A 1BFRA 3VNXA 2PYBA 3E2CA 3A9QA 4U3GA 3KXUA 4EVEA 3D19A 3UFBA 2XKQA 2MGYA 2C2FA 3RE7A 3AJQA 3E1OA 5FFCA 4R42A 4OYNA 1DPSA 4RC8A 5D8YA 2JD80 2UX1A 2V2PA 4M35A 2GYDA 3BVEA 1S2ZA 5JKMA 5J93A 3KA6A 2VXIA 2ZURX 2WWXB 2IY4A 2YJJA 1RCGA 3R2SA 3GHQA 5D8QA 3C21A 4ITTA 3BT5A 4ISMA 3KA9A 5D8RA 3M6JA 4LQHA 3HL1A 2Z6MA 4X0JA 1O9IA 2FJCA 4LQJA 1VEIA 1LKMA 1AEWA 4MXPA 4DYZA 5JKLG 3SHXA 3QZ3A 2CN6A 3AK8A 3F38A 3KHKA 3WNWA 4CY9A 1Z6OM 1LB3A 3F34A 1S30A 2JD70 2FZFA 2OC5A 3F33A 1VELA 3NOZX 3JZ9A 5FFDA 4EVBA 3E1QA 4AM5A 3U90A 2JD60 1OTKA 2FKZA 1JI4A 3GE4A 2V2IA 4ZJKA 2XJNA 1RCCA 3HIUA 3GGYA 4ZL6A 5J8SA 3ES3A 3PVRA 1ZS3A 4LYXA 5LS9A 3PW1B 3KA4A 3Q4QA 1RYTA 5FFAA 1UVHA 4TOFA 1JYBA 2CF7A 1DATA 1XZ3A 3PW8A 3Q4NA 4W4LB 2CLUA 4KVQA 3UOIA 2BJYA 1XZ1A 2Y3QA 4IXKA 5CMRA 5E2DA 1SQ3A 1JIGA 5J8WA 4CVPA 5HU6D 1GWGA 3R2LA 2XJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X17 0;  3O7S A;  3UNO A;  3PWQ A;  3QB9 A;  3PWQ C;  3ERZ A;  3FVB A;  4REU A;  2FL0 A;  3E6S A;  2CLB A;  4DE6 A;  2V15 A;  2OH3 A;  2WLA A;  4P18 A;  3IS7 A;  5D8O A;  1DVB A;  4ZTT A;  4TOB A;  5GN8 B;  2FG8 A;  2BKC A;  3QD8 A;  2WLU A;  4RC7 A;  2V2S A;  1F33 A;  4KVS A;  1BG7 A;  3QVD A;  4MN9 A;  4KVR A;  5ERJ A;  4II4 A;  4PG1 A;  5GU3 X;  1KRQ A;  2ZA8 A;  3PWF A;  2ZA6 A;  4ZKH A;  5J9V A;  4M34 A;  3IQ1 A;  4DYX A;  5K52 A;  4DAS A;  1TK6 A;  2YJK A;  5GU2 X;  1HRS A;  3F32 A;  1YUZ A;  4TW3 A;  1B71 A;  2QQY A;  4RC6 A;  4ZL5 A;  3R2H A;  3RAV A;  4AM4 A;  3F35 A;  2ZA7 A;  4PGK A;  1VEQ A;  4LQV A;  3E6R A;  5ERK A;  1IER A;  3EGM A;  4M32 A;  3Q4O A;  4CVR A;  3F39 A;  3NP0 X;  4CVT A;  2W0O A;  3PVT A;  4LYU A;  4RC5 A;  4LPN A;  3Q4R A;  2C6R A;  3E1P A;  3F37 A;  4E6K A;  1J30 A;  4ISP A;  1VJX A;  2V2M A;  3BVF A;  5AXS A;  5D8S A;  2BK6 A;  2ZG9 X;  5JKM G;  3ISE A;  2ZG8 X;  4Z3B A;  3T9J A;  1LKP A;  3PVY A;  4XKU A;  4TOG A;  1JI5 A;  4ERU A;  4ML5 A;  3MPS A;  1TKP A;  2CHP A;  1MOJ A;  5CMQ A;  4ZKX A;  3EZU A;  2YW6 A;  4DZ0 A;  4LQN A;  5D8P A;  2C41 A;  3BKN A;  2CN7 A;  4TO9 A;  5K53 A;  4CYA A;  5GU0 X;  2QF9 A;  4DYU A;  1Z6O A;  1S3Q A;  3AF8 X;  5D8X A;  2FFX J;  3QHC A;  4TOA A;  4MUD A;  1L8I A;  3E1N A;  5FFE A;  3SE1 A;  3E1L A;  4DI0 A;  2G4H A;  1JKU A;  1NNQ A;  2C2J A;  2VXX A;  4MJY A;  4ZKW A;  1H96 A;  1QGH A;  3R2O A;  1YUX A;  3AF9 X;  4IWK A;  3RBC A;  4XGS A;  2IU2 A;  5LG2 A;  3PVR B;  4AM2 A;  5GOU A;  2IB0 A;  2GYQ A;  3SH6 A;  4Y08 A;  5E1U A;  1RCD A;  3TA8 A;  3FSE A;  2V2L A;  4MKU A;  1LKO A;  5FEJ A;  1R03 A;  2C2U A;  3KA3 A;  5JKL A;  2ITB A;  1RCE A;  3GVY A;  3R2M A;  3E1M A;  1BCF A;  1JTS A;  4XKS A;  5C6F A;  3ISF A;  2XGW A;  2Z5P A;  2BW1 A;  1F30 A;  5LG8 A;  1IES A;  1TJO A;  2F7N A;  5I4J A;  3AK9 A;  4M33 A;  1VLG A;  4ITW A;  3OJ5 A;  3SID A;  3WVW A;  4TOD A;  4Z5S A;  2CEI A;  3BVL A;  1NFV A;  2V2R A;  2HR5 A;  3PW1 A;  4CMY A;  1JRE A;  2GS4 A;  4CVS A;  4RC7 B;  3RGD A;  3KX9 A;  3AJO A;  1Z4A A;  4A25 A;  3NP2 X;  1EUM A;  2ZG7 X;  3F36 A;  1N1Q A;  1L8H A;  4IWJ A;  5JAC A;  1QYB A;  1NF6 A;  2XJM A;  4II4 B;  4PGI A;  4TOH A;  4ZLW A;  5GU1 X;  3E1J A;  3OGH A;  4ETR A;  3RD0 A;  3WVV A;  1O9R A;  1MFR A;  3EZ0 A;  4CMY V;  2HTN A;  2FHA A;  2VZB A;  4PG0 A;  5LBH A;  3PZA A;  4QUW A;  4TOC A;  3A68 A;  2CHI A;  4RC6 B;  3QHB A;  4LPJ A;  1NF4 A;  3IS8 A;  3AF7 X;  1TKO A;  4DYY A;  2D5K A;  5IX6 A;  1ZUJ A;  1YV1 A;  2RBD A;  5GN8 A;  4EVD A;  3AJP A;  3R2R A;  3FI6 A;  4ZMC A;  2FG4 A;  2CIH A;  2V2O A;  1UMN A;  4CYB A;  3R2K A;  3PVT B;  4MY7 A;  1JKV A;  4RC5 B;  1FHA A;  2WTL A;  1JGC A;  3H7G A;  3O7R A;  5HJF A;  3BVI A;  4YKH A;  2V2N A;  3PW8 C;  2Z5Q A;  1RCI A;  4XKT A;  3KA8 A;  4EVC A;  3BVK A;  5CZU A;  5FFB A;  5HQO A;  3KWO A;  4TOE A;  2YW7 A;  3WVU A;  1SOF A;  2Z5R A;  2Z90 A;  3PVY B;  2V2J A;  5HJH A;  4LPM A;  3UOF A;  1BFR A;  3VNX A;  2PYB A;  3E2C A;  3A9Q A;  4U3G A;  3KXU A;  4EVE A;  2XKQ A;  3RE7 A;  2C2F A;  3AJQ A;  3E1O A;  5FFC A;  4R42 A;  4OYN A;  1DPS A;  4RC8 A;  5D8Y A;  2JD8 0;  2UX1 A;  2V2P A;  4M35 A;  2GYD A;  3BVE A;  1S2Z A;  5JKM A;  5J93 A;  3KA6 A;  2VXI A;  2ZUR X;  2IY4 A;  2YJJ A;  1RCG A;  3R2S A;  3GHQ A;  5D8Q A;  4ITT A;  3BT5 A;  4ISM A;  3KA9 A;  5D8R A;  4LQH A;  3HL1 A;  2Z6M A;  1O9I A;  2FJC A;  4LQJ A;  1VEI A;  1LKM A;  1AEW A;  4DYZ A;  5JKL G;  3SHX A;  3QZ3 A;  2CN6 A;  3AK8 A;  3F38 A;  3WNW A;  4CY9 A;  1Z6O M;  1LB3 A;  3F34 A;  1S30 A;  2JD7 0;  2FZF A;  2OC5 A;  3F33 A;  1VEL A;  3NOZ X;  5FFD A;  4EVB A;  3E1Q A;  4AM5 A;  3U90 A;  2JD6 0;  1OTK A;  2FKZ A;  1JI4 A;  3GE4 A;  2V2I A;  4ZJK A;  2XJN A;  1RCC A;  3HIU A;  4ZL6 A;  5J8S A;  3ES3 A;  3PVR A;  1ZS3 A;  4LYX A;  5LS9 A;  3PW1 B;  3KA4 A;  3Q4Q A;  1RYT A;  5FFA A;  1UVH A;  4TOF A;  1JYB A;  2CF7 A;  1DAT A;  1XZ3 A;  3PW8 A;  3Q4N A;  2CLU A;  4KVQ A;  3UOI A;  2BJY A;  1XZ1 A;  2Y3Q A;  4IXK A;  5CMR A;  5E2D A;  1SQ3 A;  1JIG A;  5J8W A;  4CVP A;  1GWG A;  3R2L A;  2XJO A; 
#chains in the Genus database with same CATH topology
 2X17 0;  3V3K B;  3O7S A;  3UNO A;  3PWQ A;  3QB9 A;  3PWQ C;  3ERZ A;  3FVB A;  4REU A;  2FL0 A;  3E6S A;  2CLB A;  4DE6 A;  2V15 A;  2OH3 A;  2WLA A;  4P18 A;  3IS7 A;  5D8O A;  1DVB A;  4ZTT A;  4TOB A;  5GN8 B;  2FG8 A;  2BKC A;  3QD8 A;  2WLU A;  4RC7 A;  2V2S A;  1F33 A;  4KVS A;  1BG7 A;  2OKC A;  3QVD A;  4MN9 A;  4KVR A;  5ERJ A;  4II4 A;  4PG1 A;  5GU3 X;  1KRQ A;  2ZA8 A;  3PWF A;  2ZA6 A;  4ZKH A;  5J9V A;  4M34 A;  3IQ1 A;  4DYX A;  2Y44 A;  5K52 A;  4DAS A;  1TK6 A;  2YJK A;  5GU2 X;  4KXR B;  1HRS A;  3F32 A;  1YUZ A;  4TW3 A;  3JZA B;  1B71 A;  2QQY A;  4RC6 A;  4ZL5 A;  3R2H A;  3RAV A;  4AM4 A;  3W54 A;  3F35 A;  2ZA7 A;  4PGK A;  1VEQ A;  3C23 A;  4W4K B;  4LQV A;  3E6R A;  5ERK A;  1IER A;  3EGM A;  4M32 A;  3Q4O A;  4CVR A;  3F39 A;  3NP0 X;  4CVT A;  2W0O A;  3PVT A;  4LYU A;  4RC5 A;  2G38 B;  4LPN A;  4YVZ A;  3Q4R A;  2C6R A;  3E1P A;  3F37 A;  4E6K A;  1J30 A;  3LKD A;  4ISP A;  3C1Y A;  1VJX A;  2V2M A;  3BVF A;  5AXS A;  3N6O A;  5D8S A;  2BK6 A;  2ZG9 X;  5JKM G;  2AR0 A;  3ISE A;  2ZG8 X;  4Z3B A;  3T9J A;  1LKP A;  4YXM A;  3PVY A;  5JDO A;  4XKU A;  4TOG A;  1JI5 A;  4ERU A;  4ML5 A;  3MPS A;  1TKP A;  2CHP A;  1MOJ A;  4E40 A;  5CMQ A;  4ZKX A;  3EZU A;  2YW6 A;  4DZ0 A;  4LQN A;  5D8P A;  3GGZ A;  2C41 A;  3BKN A;  2CN7 A;  4TO9 A;  5K53 A;  4CYA A;  5GU0 X;  2QF9 A;  4DYU A;  1Z6O A;  1S3Q A;  3AF8 X;  5D8X A;  2FFX J;  3QHC A;  4TOA A;  4MUD A;  1L8I A;  3E1N A;  5FFE A;  3SE1 A;  3E1L A;  4DI0 A;  2G4H A;  1JKU A;  1NNQ A;  2C2J A;  2VXX A;  4MJY A;  4ZKW A;  1H96 A;  1QGH A;  3R2O A;  1YUX A;  3AF9 X;  4IWK A;  3RBC A;  4XGS A;  2IU2 A;  5LG2 A;  3PVR B;  4AM2 A;  5GOU A;  2IB0 A;  2GYQ A;  3SH6 A;  4Y08 A;  5E1U A;  1RCD A;  3TA8 A;  3FSE A;  2V2L A;  4MKU A;  1LKO A;  2V8T A;  5FEJ A;  1R03 A;  2CWL A;  2C2U A;  3KA3 A;  5JKL A;  2ITB A;  1RCE A;  3GVY A;  3R2M A;  3E1M A;  1BCF A;  1JTS A;  4XKS A;  5C6F A;  3ISF A;  2XGW A;  2Z5P A;  2BW1 A;  1F30 A;  5LG8 A;  1IES A;  1TJO A;  2F7N A;  5I4J A;  3AK9 A;  3DBY A;  4M33 A;  1VLG A;  4ITW A;  3OJ5 A;  3SID A;  3WVW A;  4TOD A;  4Z5S A;  2CEI A;  3BVL A;  3C1Z A;  1NFV A;  2V2R A;  2HR5 A;  3PW1 A;  4CMY A;  1JRE A;  2GS4 A;  4YXJ A;  4CVS A;  4RC7 B;  3RGD A;  3KX9 A;  3AJO A;  1Z4A A;  4A25 A;  3NP2 X;  1EUM A;  3L0M A;  2ZG7 X;  3F36 A;  1N1Q A;  1L8H A;  4IWJ A;  5JAC A;  1QYB A;  1NF6 A;  2XJM A;  4II4 B;  3KDQ A;  4PGI A;  4TOH A;  4ZLW A;  5GU1 X;  3E1J A;  3OGH A;  4ETR A;  3RD0 A;  3WVV A;  1O9R A;  1MFR A;  3EZ0 A;  4CMY V;  2HTN A;  2FHA A;  2VZB A;  4PG0 A;  5LBH A;  3PZA A;  4QUW A;  4TOC A;  2V8U A;  3A68 A;  2CHI A;  4RC6 B;  3FRR A;  3QHB A;  4LPJ A;  1NF4 A;  3VV9 A;  3IS8 A;  3AF7 X;  1TKO A;  4DYY A;  2D5K A;  5IX6 A;  1ZUJ A;  1YV1 A;  2RBD A;  5GN8 A;  4EVD A;  3AJP A;  3R2R A;  3FI6 A;  4ZMC A;  2FG4 A;  2CIH A;  2V2O A;  1UMN A;  4CYB A;  3R2K A;  3PVT B;  4MY7 A;  1JKV A;  4RC5 B;  1FHA A;  2WTL A;  1JGC A;  3H7G A;  3O7R A;  5HJF A;  3BVI A;  4YKH A;  2V2N A;  3PW8 C;  2Z5Q A;  1RCI A;  3FRS A;  4XKT A;  3KA8 A;  4EVC A;  3BVK A;  5CZU A;  5FFB A;  5HQO A;  3KWO A;  4TOE A;  2YW7 A;  3WVU A;  1SOF A;  3VVA A;  2Z5R A;  2Z90 A;  3PVY B;  5JDO B;  2V2J A;  5HJH A;  4LPM A;  3UOF A;  4WJG 4;  2N02 A;  1BFR A;  3VNX A;  2PYB A;  3E2C A;  3A9Q A;  4U3G A;  3KXU A;  4EVE A;  3D19 A;  3UFB A;  2XKQ A;  2MGY A;  2C2F A;  3RE7 A;  3AJQ A;  3E1O A;  5FFC A;  4R42 A;  4OYN A;  1DPS A;  4RC8 A;  5D8Y A;  2JD8 0;  2UX1 A;  2V2P A;  4M35 A;  2GYD A;  3BVE A;  1S2Z A;  5JKM A;  5J93 A;  3KA6 A;  2VXI A;  2ZUR X;  2WWX B;  2IY4 A;  2YJJ A;  1RCG A;  3R2S A;  3GHQ A;  5D8Q A;  3C21 A;  4ITT A;  3BT5 A;  4ISM A;  3KA9 A;  5D8R A;  3M6J A;  4LQH A;  3HL1 A;  2Z6M A;  4X0J A;  1O9I A;  2FJC A;  4LQJ A;  1VEI A;  1LKM A;  1AEW A;  4MXP A;  4DYZ A;  5JKL G;  3SHX A;  3QZ3 A;  2CN6 A;  3AK8 A;  3F38 A;  3KHK A;  3WNW A;  4CY9 A;  1Z6O M;  1LB3 A;  3F34 A;  1S30 A;  2JD7 0;  2FZF A;  2OC5 A;  3F33 A;  1VEL A;  3NOZ X;  3JZ9 A;  5FFD A;  4EVB A;  3E1Q A;  4AM5 A;  3U90 A;  2JD6 0;  1OTK A;  2FKZ A;  1JI4 A;  3GE4 A;  2V2I A;  4ZJK A;  2XJN A;  1RCC A;  3HIU A;  3GGY A;  4ZL6 A;  5J8S A;  3ES3 A;  3PVR A;  1ZS3 A;  4LYX A;  5LS9 A;  3PW1 B;  3KA4 A;  3Q4Q A;  1RYT A;  5FFA A;  1UVH A;  4TOF A;  1JYB A;  2CF7 A;  1DAT A;  1XZ3 A;  3PW8 A;  3Q4N A;  4W4L B;  2CLU A;  4KVQ A;  3UOI A;  2BJY A;  1XZ1 A;  2Y3Q A;  4IXK A;  5CMR A;  5E2D A;  1SQ3 A;  1JIG A;  5J8W A;  4CVP A;  5HU6 D;  1GWG A;  3R2L A;  2XJO A; 
#chains in the Genus database with same CATH homology
 2X17 0;  3V3K B;  3O7S A;  3UNO A;  3PWQ A;  3QB9 A;  3PWQ C;  3ERZ A;  3FVB A;  4REU A;  2FL0 A;  3E6S A;  2CLB A;  4DE6 A;  2V15 A;  2OH3 A;  2WLA A;  4P18 A;  3IS7 A;  5D8O A;  1DVB A;  4ZTT A;  4TOB A;  5GN8 B;  2FG8 A;  2BKC A;  3QD8 A;  2WLU A;  4RC7 A;  2V2S A;  1F33 A;  4KVS A;  1BG7 A;  2OKC A;  3QVD A;  4MN9 A;  4KVR A;  5ERJ A;  4II4 A;  4PG1 A;  5GU3 X;  1KRQ A;  2ZA8 A;  3PWF A;  2ZA6 A;  4ZKH A;  5J9V A;  4M34 A;  3IQ1 A;  4DYX A;  2Y44 A;  5K52 A;  4DAS A;  1TK6 A;  2YJK A;  5GU2 X;  4KXR B;  1HRS A;  3F32 A;  1YUZ A;  4TW3 A;  3JZA B;  1B71 A;  2QQY A;  4RC6 A;  4ZL5 A;  3R2H A;  3RAV A;  4AM4 A;  3W54 A;  3F35 A;  2ZA7 A;  4PGK A;  1VEQ A;  3C23 A;  4W4K B;  4LQV A;  3E6R A;  5ERK A;  1IER A;  3EGM A;  4M32 A;  3Q4O A;  4CVR A;  3F39 A;  3NP0 X;  4CVT A;  2W0O A;  3PVT A;  4LYU A;  4RC5 A;  2G38 B;  4LPN A;  4YVZ A;  3Q4R A;  2C6R A;  3E1P A;  3F37 A;  4E6K A;  1J30 A;  3LKD A;  4ISP A;  3C1Y A;  1VJX A;  2V2M A;  3BVF A;  5AXS A;  3N6O A;  5D8S A;  2BK6 A;  2ZG9 X;  5JKM G;  2AR0 A;  3ISE A;  2ZG8 X;  4Z3B A;  3T9J A;  1LKP A;  4YXM A;  3PVY A;  5JDO A;  4XKU A;  4TOG A;  1JI5 A;  4ERU A;  4ML5 A;  3MPS A;  1TKP A;  2CHP A;  1MOJ A;  4E40 A;  5CMQ A;  4ZKX A;  3EZU A;  2YW6 A;  4DZ0 A;  4LQN A;  5D8P A;  3GGZ A;  2C41 A;  3BKN A;  2CN7 A;  4TO9 A;  5K53 A;  4CYA A;  5GU0 X;  2QF9 A;  4DYU A;  1Z6O A;  1S3Q A;  3AF8 X;  5D8X A;  2FFX J;  3QHC A;  4TOA A;  4MUD A;  1L8I A;  3E1N A;  5FFE A;  3SE1 A;  3E1L A;  4DI0 A;  2G4H A;  1JKU A;  1NNQ A;  2C2J A;  2VXX A;  4MJY A;  4ZKW A;  1H96 A;  1QGH A;  3R2O A;  1YUX A;  3AF9 X;  4IWK A;  3RBC A;  4XGS A;  2IU2 A;  5LG2 A;  3PVR B;  4AM2 A;  5GOU A;  2IB0 A;  2GYQ A;  3SH6 A;  4Y08 A;  5E1U A;  1RCD A;  3TA8 A;  3FSE A;  2V2L A;  4MKU A;  1LKO A;  2V8T A;  5FEJ A;  1R03 A;  2CWL A;  2C2U A;  3KA3 A;  5JKL A;  2ITB A;  1RCE A;  3GVY A;  3R2M A;  3E1M A;  1BCF A;  1JTS A;  4XKS A;  5C6F A;  3ISF A;  2XGW A;  2Z5P A;  2BW1 A;  1F30 A;  5LG8 A;  1IES A;  1TJO A;  2F7N A;  5I4J A;  3AK9 A;  3DBY A;  4M33 A;  1VLG A;  4ITW A;  3OJ5 A;  3SID A;  3WVW A;  4TOD A;  4Z5S A;  2CEI A;  3BVL A;  3C1Z A;  1NFV A;  2V2R A;  2HR5 A;  3PW1 A;  4CMY A;  1JRE A;  2GS4 A;  4YXJ A;  4CVS A;  4RC7 B;  3RGD A;  3KX9 A;  3AJO A;  1Z4A A;  4A25 A;  3NP2 X;  1EUM A;  3L0M A;  2ZG7 X;  3F36 A;  1N1Q A;  1L8H A;  4IWJ A;  5JAC A;  1QYB A;  1NF6 A;  2XJM A;  4II4 B;  3KDQ A;  4PGI A;  4TOH A;  4ZLW A;  5GU1 X;  3E1J A;  3OGH A;  4ETR A;  3RD0 A;  3WVV A;  1O9R A;  1MFR A;  3EZ0 A;  4CMY V;  2HTN A;  2FHA A;  2VZB A;  4PG0 A;  5LBH A;  3PZA A;  4QUW A;  4TOC A;  2V8U A;  3A68 A;  2CHI A;  4RC6 B;  3FRR A;  3QHB A;  4LPJ A;  1NF4 A;  3VV9 A;  3IS8 A;  3AF7 X;  1TKO A;  4DYY A;  2D5K A;  5IX6 A;  1ZUJ A;  1YV1 A;  2RBD A;  5GN8 A;  4EVD A;  3AJP A;  3R2R A;  3FI6 A;  4ZMC A;  2FG4 A;  2CIH A;  2V2O A;  1UMN A;  4CYB A;  3R2K A;  3PVT B;  4MY7 A;  1JKV A;  4RC5 B;  1FHA A;  2WTL A;  1JGC A;  3H7G A;  3O7R A;  5HJF A;  3BVI A;  4YKH A;  2V2N A;  3PW8 C;  2Z5Q A;  1RCI A;  3FRS A;  4XKT A;  3KA8 A;  4EVC A;  3BVK A;  5CZU A;  5FFB A;  5HQO A;  3KWO A;  4TOE A;  2YW7 A;  3WVU A;  1SOF A;  3VVA A;  2Z5R A;  2Z90 A;  3PVY B;  5JDO B;  2V2J A;  5HJH A;  4LPM A;  3UOF A;  4WJG 4;  2N02 A;  1BFR A;  3VNX A;  2PYB A;  3E2C A;  3A9Q A;  4U3G A;  3KXU A;  4EVE A;  3D19 A;  3UFB A;  2XKQ A;  2MGY A;  2C2F A;  3RE7 A;  3AJQ A;  3E1O A;  5FFC A;  4R42 A;  4OYN A;  1DPS A;  4RC8 A;  5D8Y A;  2JD8 0;  2UX1 A;  2V2P A;  4M35 A;  2GYD A;  3BVE A;  1S2Z A;  5JKM A;  5J93 A;  3KA6 A;  2VXI A;  2ZUR X;  2WWX B;  2IY4 A;  2YJJ A;  1RCG A;  3R2S A;  3GHQ A;  5D8Q A;  3C21 A;  4ITT A;  3BT5 A;  4ISM A;  3KA9 A;  5D8R A;  3M6J A;  4LQH A;  3HL1 A;  2Z6M A;  4X0J A;  1O9I A;  2FJC A;  4LQJ A;  1VEI A;  1LKM A;  1AEW A;  4MXP A;  4DYZ A;  5JKL G;  3SHX A;  3QZ3 A;  2CN6 A;  3AK8 A;  3F38 A;  3KHK A;  3WNW A;  4CY9 A;  1Z6O M;  1LB3 A;  3F34 A;  1S30 A;  2JD7 0;  2FZF A;  2OC5 A;  3F33 A;  1VEL A;  3NOZ X;  3JZ9 A;  5FFD A;  4EVB A;  3E1Q A;  4AM5 A;  3U90 A;  2JD6 0;  1OTK A;  2FKZ A;  1JI4 A;  3GE4 A;  2V2I A;  4ZJK A;  2XJN A;  1RCC A;  3HIU A;  3GGY A;  4ZL6 A;  5J8S A;  3ES3 A;  3PVR A;  1ZS3 A;  4LYX A;  5LS9 A;  3PW1 B;  3KA4 A;  3Q4Q A;  1RYT A;  5FFA A;  1UVH A;  4TOF A;  1JYB A;  2CF7 A;  1DAT A;  1XZ3 A;  3PW8 A;  3Q4N A;  4W4L B;  2CLU A;  4KVQ A;  3UOI A;  2BJY A;  1XZ1 A;  2Y3Q A;  4IXK A;  5CMR A;  5E2D A;  1SQ3 A;  1JIG A;  5J8W A;  4CVP A;  5HU6 D;  1GWG A;  3R2L A;  2XJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...