1YV1A

Fully reduced state of nigerythrin (all ferrous)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
202
structure length
202
Chain Sequence
MKVRAQVPTVKNATNFNMVADSKTSVGSTLENLKAAIAGETGAHAKYTAFAKAAREQGYEQIARLFEATAAAELIHIGLEYALVAEMEPGYEKPTVAAPSAYSCDLNLISGANGEIYETSDMYPAFIRKAQEEGNSKAVHVFTRAKLAESVHAERYLAAYNDIDAPDDDKFHLCPICGYIHKGEDFEKCPICFRPKDTFTAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nigerythrin
publication title High-resolution crystal structures of Desulfovibrio vulgaris (Hildenborough) nigerythrin: facile, redox-dependent iron movement, domain interface variability, and peroxidase activity in the rubrerythrins.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris
total genus 69
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1yv1A01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1yv1A02
3TA8A 4DASA 5GU0X 2CIHA 3RE7A 3QB9A 5JKMA 4LYUA 1YUXA 5D8OA 3SE1A 2QF9A 1TKPA 2ZA6A 4M34A 4REUA 3PVRB 2FFXJ 1DVBA 4ZKXA 4ZL6A 1RDVA 2KKDA 2V15A 3IS7A 3PWQC 4LPMA 4PG1A 3E6SA 1GWGA 4AM5A 2DSXA 5D8XA 3F37A 1T9QA 1H7VA 2XJOA 5CMRA 3UOIA 2Z90A 5JKMG 1NF4A 5LBHA 4ZKHA 1DATA 4LQVA 1LKOA 2CEIA 1RYTA 5FFEA 3UNOA 3GE4A 3AF7X 3ISEA 4AR4A 3A9QA 2V2SA 1JI4A 3SS2A 3RAVA 3KA8A 3AK9A 1S30A 4LPNA 4LQHA 4AM4A 5GN8A 4DYXA 4YWLA 2Z6MA 2RBDA 4TOCA 5AI2A 3EZUA 5J93A 1BFYA 5IY0A 2YJJA 3VNXA 3Q4QA 1JGCA 3ES3A 1LTLA 2WTLA 3R2SA 2D5KA 1RCEA 3EGMA 4LQJA 3AF8X 3RZTA 3PWQA 4ITTA 5AI3A 5D8SA 3R2KA 4CYAA 3KYYA 3KX9A 2OC5A 3SHXA 5ERJA 2F7NA 3R2RA 2K2DA 2X170 2Z5PA 2ZG7X 3UOFA 3R2HA 1Z6OA 2GYQA 4XKTA 3A44A 1L8HA 4QUWA 3KA9A 4PG0A 3KXUA 3F36A 2PVXA 5D8PA 1T9OA 4TOEA 1IU6A 1AEWA 4RC7A 2ZA8A 4M33A 2ZG9X 3AK8A 2FJCA 1R03A 3AJOA 2CHPA 4ZL5A 4LPJA 2HTNA 1JKUA 2OH3A 4AM2A 4DE6A 3NP0X 2KN9A 4IWKA 1MFRA 3E1LA 3HL1A 2C2UA 4DYYA 4POFA 1SMUA 1KRQA 1NNQA 1DPSA 3RYGA 4YWMA 2VXIA 1VJXA 4U3GA 3KA4A 2CF7A 4MY7A 1S24A 1R0GA 5D8RA 3BVIA 4R42A 1VLGA 1JI5A 5GN8B 4ISMA 3E1JA 3F34A 3KA6A 4PGIA 1SQ3A 2XJMA 5FFBA 1N1QA 5GU2X 2IB0A 4ERUA 4TOGA 2ITBA 5LG2A 2RDVA 5FEJA 3KWOA 5GU3X 4RC6A 4XKUA 3AF9X 1BCFA 1BG7A 1CADA 4AR6A 1IESA 3PVTB 1RWDA 4CVSA 4A25A 1ZUJA 5K52A 3F32A 5AXSA 3E1PA 2PYBA 3PW1A 4XGSA 2CLUA 1TKOA 2GYDA 5E1UA 1R0FA 4K9FA 1TJOA 4E6KA 2W0OA 3PW8C 2QL0A 1ZRPA 1XZ1A 3O7RA 2IY4A 4RC5A 1YK5A 2PVEA 2FHAA 1H96A 3RBCA 1RCCA 1E8JA 4CVRA 4POGA 1EUMA 4MKUA 1S3QA 4RC7B 3E1MA 5J8WA 3QZ3A 1RB9A 8RXNA 3ERZA 4TOBA 3PVYB 1SMWA 5GOUA 2WLAA 2GS4A 2VZBA 2CLBA 1IERA 4KVRA 3PZAA 1YK4A 4CY9A 3AJPA 1QYBA 3BVKA 3E1OA 3F35A 5CMQA 5LG8A 3RZ6A 5FFDA 1RDGA 5FFCA 1BQ8A 1RCDA 3EZ0A 4ITWA 5IX6A 4IXKA 1RCIA 1LKMA 1B2JA 5JACA 2V2PA 4EVDA 4CVTA 3WVWA 1VCXA 4AR5A 3AJQA 4ZMCA 3ISFA 4LQNA 4ME3A 6RXNA 3BVEA 2C41A 4MUDA 4Z5SA 4ISPA 1T9PA 2V2RA 1FHMA 1ZS3A 1BRFA 4EVBA 4Y08A 3E2CA 4LYXA 3H7GA 3PW8A 1JIGA 2JD70 3F38A 1UMNA 2BJYA 1Z4AA 4CMYA 5C6FA 3WVVA 2YJKA 3PW1B 2VXXA 4II4A 4KVSA 4MN9A 3WNWA 1Z6OM 1OTKA 1IU5A 2ZG8X 3Q4NA 5HQOA 2QQYA 3GHQA 1J30A 1NFVA 2XGWA 1SOFA 3KYXA 1NF6A 1C09A 1YUZA 4KVQA 3E6RA 2Z5RA 3GVYA 2ZA7A 4TODA 4YKHA 2WLUA 4MJYA 4P18A 4ZKWA 4DYUA 4CVPA 3MPSA 1F30A 3IQ1A 1QGHA 1RCGA 4CMYV 1VEQA 4ZLWA 2CN6A 2XKQA 4TPUA 1LB3A 3KYUA 1R0IA 4ZJKA 3O7SA 1YV1A 2IU2A 3Q4OA 2FG8A 2YW6A 2JD60 1BE7A 5K53A 3SIDA 1L8IA 3Q4RA 1DX8A 2V3BB 1FHAA 2V2NA 5D8YA 5LS9A 3BKNA 3KA3A 1LKPA 2PYAA 2G4HA 1TK6A 4OYNA 3QHBA 4Z3BA 3RGDA 4PGKA 1XZ3A 4DZ0A 5RXNA 2HR5A 5D8QA 4DYZA 3E1NA 3FVBA 1HRSA 3IS8A 1VEIA 2V2OA 1UVHA 1SMMA 3KYWA 3QVDA 2FG4A 2Z5QA 5J8SA 4ZTTA 5GU1X 2V2LA 4CYBA 2VL6A 2V2JA 2Y3QA 1F33A 3OJ5A 2C2FA 1B2OA 1FHHA 4TOFA 4RC8A 5JKLA 2BW1A 2ZURX 4II4B 3PVRA 5I4JA 4IWJA 1B13A 4ML5A 1QCVA 2BKCA 4TW3A 4XKSA 3NOZX 4RXNA 2MS3A 7RXNA 3F33A 1B71A 4AR3A 4EVEA 4TOHA 2FZFA 3F39A 1JYBA 2GMGA 5E2DA 1R0HA 2CN7A 1JREA 1O9RA 2BK6A 3PVTA 5HJFA 1IRNA 1CAAA 2C6RA 5JKLG 3OGHA 1S2ZA 1BFRA 3R2OA 2CHIA 2XJNA 4RC6B 3WVUA 4EVCA 3QHCA 5FFAA 4DI0A 5CZUA 1JKVA 5HJHA 2UX1A 4TO9A 3A68A 2M4YA 5ERKA 1MOJA 3BVFA 3SH6A 1JTSA 3RD0A 1BQ9A 3FI6A 2C2JA 3BT5A 1O9IA 3R2LA 2FL0A 1VELA 4M32A 2FKZA 2V2IA 4ETRA 3PWFA 3T9JA 3HIUA 3PVYA 4RC5B 3E1QA 3NP2X 2V2MA 2YW7A 4TOAA 3R2MA 3KYVA 1R0JA 2JD80 4M35A 3FSEA 2LCQA 3QD8A 3U90A 3BVLA 1IROA 5J9VA
chains in the Genus database with same CATH superfamily
3GTOL 4A3KL 3TA8A 4DASA 5GU0X 3DBYA 2XJPA 4U671 3HOYL 2CIHA 3RE7A 4AHWA 3QB9A 5JKMA 2PSMC 4LYUA 1YUXA 2AQCA 5D8OA 3SE1A 5M3ML 2QF9A 3LPEB 1P7PA 1TKPA 2ZA6A 5C3EL 4M34A 4REUA 3PVRB 2WWXB 2FFXJ 3C21A 3C1ZA 1DVBA 4ZKXA 3UFBA 2CKAA 4ZL6A 2M4VA 1RDVA 1RYQA 2KKDA 2V15A 2V0FA 3IS7A 5JVH1 3PWQC 4LPMA 4PG1A 3WWLA 1I6HL 3E6SA 3VV9A 1GWGA 4AM5A 2DSXA 5D8XA 3GTLL 3F37A 1T9QA 1H7VA 1VZIA 2XJOA 5CMRA 3UOIA 2NVYL 2Z90A 5JKMG 4C3HL 1NF4A 5LBHA 2XJUA 4ZKHA 1DATA 4LQVA 3HKZP 3WWNB 3M3YL 1LKOA 2CEIA 1RYTA 3KDQA 5FFEA 3UNOA 4BBSL 3GE4A 3AF7X 3ISEA 4YVZA 4AR4A 3A9QA 2AR0A 1JI4A 2V2SA 3SS2A 1PFUA 3RAVA 3KA8A 5H1Sc 3P8BA 4E6YA 3AK9A 5JDOA 1S30A 5EIOC 2OKCA 1SFOL 4LPNA 4LQHA 4AM4A 3LWOB 4WJG4 3CQZL 5GN8A 4DYXA 4YWLA 1Z92B 2Z6MA 3GTML 1OWCA 2RBDA 4TOCA 5AI2A 3EZUA 5J93A 4ZN1B 1BFYA 4QIWP 4BY7L 5IY0A 2YJJA 2H12A 2NYDA 3VNXA 4MXPA 3Q4QA 1JGCA 3ES3A 4XXBB 2NVXL 3HOVL 1LTLA 2WTLA 3R2SA 2D5KA 1RCEA 4AHZA 3QQCE 5GADc 3EGMA 5GAGc 4JADA 3H9BA 2XJSA 4LQJA 4W4KB 3AF8X 4X0JA 3RZTA 3PWQA 3D19A 4ITTA 5AI3A 5D8SA 4A3GL 3R2KA 4CYAA 3KYYA 3KX9A 2OC5A 3SHXA 5ERJA 2F7NA 3R2RA 2K2DA 2X170 2Z5PA 2XJVA 2ZG7X 3UOFA 3R2HA 2E2JL 4A3LL 1Z6OA 2GYQA 4XKTA 4E40A 1L8HA 3A44A 3H0GL 3H9CA 4Y52L 5GAEc 2E2IL 1F4LA 2Y0SP 4QUWA 1TWFL 1WCML 4AHXA 2XJTA 5DM71 3C23A 3KA9A 4PG0A 4A3FL 3KXUA 3F36A 2PVXA 5D8PA 1T9OA 3H97A 4TOEA 1IU6A 1AEWA 4RC7A 2ZA8A 4M33A 2ZG9X 3AK8A 2FJCA 1R03A 3N6OA 3AJOA 2CHPA 4ZL5A 4LPJA 2HTNA 1JKUA 2OH3A 4AM2A 3NFPI 4DE6A 3NP0X 2KN9A 2Y44A 4IWKA 1MFRA 3E1LA 3HL1A 2C2UA 4X6AL 3LNLA 4DYYA 5MFPA 2JA6L 3GGYA 4POFA 1SMUA 3M6JA 1KRQA 2VUML 1NNQA 1DPSA 1NXEA 1VZGA 3RYGA 5JDOB 4YWMA 2VXIA 3S1RL 1VJXA 4U3GA 3KA4A 3PIO1 2CF7A 4MY7A 1S24A 1R0GA 5M5YL 5D8RA 3BVIA 4R42A 1VLGA 1JI5A 5GN8B 4ISMA 3FKIL 3J7Y1 3E1JA 2A68D 3MQKB 3PO2L 3F34A 1TWHL 3S2HL 4A3DL 3KA6A 4PGIA 1SQ3A 2XJMA 5FFBA 1N1QA 5GU2X 2XJRA 4WFN1 3L0MA 2IB0A 4ERUA 4TOGA 2ITBA 5LG2A 2RDVA 3HJYB 5FEJA 1PFVA 1TWAL 5GAHc 3LWQB 3KWOA 5GU3X 3LWPB 4RC6A 4XKUA 5C4JL 1Y1VL 3AF9X 2J9UB 2R92L 1BCFA 4GS7D 1BG7A 1CADA 4AR6A 2YU9L 1IESA 3PVTB 1RWDA 4CVSA 3GTKL 3I4ML 2RFKB 4A25A 5FJ8L 4A93L 1ZUJA 5M3FL 5K52A 4Y7NL 3F32A 5AXSA 3E1PA 3VVAA 3PO3L 3C1YA 2PYBA 3PW1A 4XGSA 2M6OA 2JA7L 2CLUA 1TKOA 3H99A 3RZOL 2GYDA 5E1UA 1R0FA 4K9FA 1TJOA 5IP7L 5FLML 2JA5L 3J7Z1 4E6KA 4XGHA 2W0OA 3PW8C 2QL0A 1ZRPA 2PPTA 1XZ1A 3O7RA 4A3BL 2IY4A 4RC5A 4BY1L 1YK5A 2PVEA 2FHAA 5DM61 1H96A 3RBCA 1RCCA 1E8JA 1OWBA 4C2M1 4CVRA 2A6HD 3HJWB 1I3QL 4POGA 3K35A 2EY4E 1EUMA 2A6ED 4MKUA 3MSUA 1S3QA 4RC7B 3E1MA 5J8WA 3QZ3A 3W54A 1RB9A 2N02A 8RXNA 2AUSB 3ERZA 4TOBA 3PVYB 1SMWA 5GOUA 2WLAA 2GS4A 2VZBA 2CLBA 1IERA 4V196 4KVRA 5AN9H 3PZAA 1YK4A 3H3VM 4CY9A 3AJPA 1QYBA 2WAQP 3BVKA 3E1OA 3F35A 5CMQA 4G6BA 3LKDA 5LG8A 3RZ6A 5FFDA 1RDGA 4YXMA 5FFCA 1BQ8A 2MGYA 3HOUL 1RCDA 3EZ0A 4ITWA 2PMZP 5IX6A 4IXKA 2AYJA 1RCIA 1R9TL 1LKMA 1B2JA 5JACA 2V2PA 4EVDA 4CVTA 3WVWA 1VCXA 4AR5A 4AYBP 3AJQA 4ZMCA 5HU6D 3PKJA 3ISFA 4C3IL 4LQNA 4ME3A 6RXNA 1WJVA 3BVEA 2C41A 4MUDA 3S2DL 4AI1A 4Z5SA 4LHNA 4ISPA 1T9PA 2V2RA 3RZDL 3S1NL 1FHMA 1ZS3A 1BRFA 4EVBA 4Y08A 3HAXC 3PKIA 3E2CA 4LYXA 3FDJA 4AI2A 3H7GA 3PW8A 1JIGA 4JAFA 3LWRB 2JD70 3F38A 4ZN3B 2V8TA 1UMNA 2BE5D 2BJYA 4BXXL 1PFWA 4A3IL 1Z4AA 3S16L 4CMYA 2ERJA 5C6FA 3WVVA 1QQTA 2YJKA 5MF6A 3PW1B 2WB1P 4B8CD 2VXXA 4II4A 4KVSA 3S1QL 2CWLA 4MN9A 3WNWA 1Z6OM 1OTKA 1IU5A 2ZG8X 2XJQA 4AI3A 3Q4NA 5HQOA 2C6AA 2QQYA 3I4NL 3FRRA 3GHQA 1J30A 1NFVA 2XGWA 1SOFA 2G38B 3KYXA 5EINC 1NF6A 1C09A 1YUZA 4KVQA 1PFYA 3E6RA 2Z5RA 3GVYA 2ZA7A 4TODA 4YKHA 2WLUA 4MJYA 4P18A 4ZKWA 3ZG6A 2APOB 2A69D 4DYUA 1Y1WL 4CVPA 1K83L 3MPSA 2CKCA 1F30A 3IQ1A 4A3ML 4A3JL 4KXRB 1QGHA 1RCGA 4CMYV 1VEQA 4ZLWA 4AI0A 4TVMA 2CN6A 2XKQA 3P2AA 4TPUA 3FRSA 1LB3A 3KYUA 1R0IA 4ZJKA 2L0ZA 4A3CL 3O7SA 1YV1A 2IU2A 1PZXA 3Q4OA 2B5ID 2FG8A 2YW6A 4W4LB 4JAGA 2JD60 1BE7A 3GGZA 5IYBL 5K53A 5K2ME 3KHKA 3SIDA 1L8IA 3Q4RA 1DX8A 2V3BB 2E2HL 1FHAA 2V2NA 5D8YA 5LS9A 3BKNA 3KA3A 1LKPA 2PYAA 5IP9L 2G4HA 2HVYC 1TK6A 4OYNA 3QHBA 4Z3BA 3RGDA 4PGKA 1XZ3A 4DZ0A 5RXNA 2HR5A 2R93L 5D8QA 4DYZA 3E1NA 3FVBA 1HRSA 3IS8A 1VEIA 5MLC3 2V2OA 1UVHA 3S15L 1SMMA 5C44L 3IU3I 3KYWA 3PL5A 3QVDA 2FG4A 2Z5QA 5J8SA 1TWGL 4ZTTA 4LHLA 5GU1X 2V2LA 4CYBA 2VL6A 2V2JA 2Y3QA 1F33A 3OJ5A 2C2FA 4C3JL 1B2OA 2JI3A 5IYCL 2NVQL 3GTPL 3JZ9A 1FHHA 4TOFA 4RC8A 5JKLA 2BW1A 2ZURX 4II4B 3PVRA 3GTQL 3S14L 5I4JA 3B08B 4IWJA 1B13A 4ML5A 1QCVA 2V8UA 2BKCA 2R7ZL 4TW3A 4XKSA 3NOZX 2Z3QB 2JI2A 2CR8A 4RXNA 4A3EL 1ODHA 2MS3A 2V0EA 7RXNA 3F33A 1B71A 4AR3A 4EVEA 2ZIXA 4TOHA 3VPBE 4UY81 3HOWL 2FZFA 3F39A 1JYBA 2GMGA 5E2DA 1R0HA 2CN7A 1JREA 1O9RA 2BK6A 3PVTA 5HJFA 1IRNA 1CAAA 2C6RA 2JI1A 5JKLG 3OGHA 5IYDL 5M5WL 3S1ML 2C6BA 3M4OL 1S2ZA 1BFRA 2JA8L 2Z3RB 3R2OA 3PIP1 2CHIA 3B0AB 5JVG1 2XJNA 4RC6B 4AHYA 3WVUA 2B63L 4EVCA 3QHCA 5FFAA 4DI0A 2ERSA 5CZUA 1JKVA 5HJHA 2UX1A 4TO9A 1IW7D 3V3KB 3A68A 2M4YA 5ERKA 1MOJA 3BVFA 3SH6A 5MGNA 1JTSA 3RD0A 1BQ9A 3FI6A 3JZAB 5C4XL 2C2JA 1NXGA 3JR7A 3LWVB 3BT5A 3K7AL 2NVTL 1O9IA 3R2LA 2FL0A 1VELA 4M32A 2FKZA 3GTGL 2V2IA 4ETRA 4BBRL 1TWCL 4JAEA 3PWFA 1I50L 3T9JA 3HIUA 3PVYA 4RC5B 3E1QA 2M6PA 3NP2X 2V2MA 2YW7A 4TOAA 3R2MA 3KYVA 1R0JA 3GTJL 2JD80 4M35A 3FSEA 1VZHA 3S17L 3HOZL 5M5XL 2O5JD 2LCQA 3QD8A 3U90A 5MFZA 3BVLA 1IROA 4YXJA 5J9VA 3HOXL
chains in the Genus database with same CATH topology
3TA8A 4DASA 5GU0X 3DBYA 2XJPA 4U671 2CIHA 3RE7A 4AHWA 3QB9A 5JKMA 2PSMC 4LYUA 1YUXA 5D8OA 3SE1A 2QF9A 3LPEB 1TKPA 2ZA6A 4M34A 4REUA 3PVRB 2WWXB 2FFXJ 3C21A 3C1ZA 1DVBA 4ZKXA 3UFBA 2CKAA 4ZL6A 2M4VA 1RDVA 1RYQA 2KKDA 2V15A 2V0FA 3IS7A 5JVH1 3PWQC 4LPMA 4PG1A 3WWLA 3E6SA 3VV9A 1GWGA 4AM5A 2DSXA 5D8XA 3F37A 1T9QA 1H7VA 1VZIA 2XJOA 5CMRA 3UOIA 2Z90A 5JKMG 1NF4A 5LBHA 2XJUA 4ZKHA 1DATA 4LQVA 3WWNB 1LKOA 2CEIA 1RYTA 3KDQA 5FFEA 3UNOA 3GE4A 3AF7X 3ISEA 4YVZA 4AR4A 3A9QA 2AR0A 1JI4A 2V2SA 3SS2A 3RAVA 3KA8A 5H1Sc 3P8BA 4E6YA 3AK9A 5JDOA 1S30A 5EIOC 2OKCA 4LPNA 4LQHA 4AM4A 4WJG4 5GN8A 4DYXA 4YWLA 1Z92B 2Z6MA 1OWCA 2RBDA 4TOCA 5AI2A 3EZUA 5J93A 4ZN1B 1BFYA 5IY0A 2YJJA 2H12A 2NYDA 3VNXA 4MXPA 3Q4QA 1JGCA 3ES3A 4XXBB 1LTLA 2WTLA 3R2SA 2D5KA 1RCEA 4AHZA 3QQCE 5GADc 3EGMA 5GAGc 4JADA 2XJSA 4LQJA 4W4KB 3AF8X 4X0JA 3RZTA 3PWQA 3D19A 4ITTA 5AI3A 5D8SA 3R2KA 4CYAA 3KYYA 3KX9A 2OC5A 3SHXA 5ERJA 2F7NA 3R2RA 2K2DA 2X170 2Z5PA 2XJVA 2ZG7X 3UOFA 3R2HA 1Z6OA 2GYQA 4XKTA 4E40A 1L8HA 3A44A 5GAEc 4QUWA 4AHXA 2XJTA 5DM71 3C23A 3KA9A 4PG0A 3KXUA 3F36A 2PVXA 5D8PA 1T9OA 4TOEA 1IU6A 1AEWA 4RC7A 2ZA8A 4M33A 2ZG9X 3AK8A 2FJCA 1R03A 3N6OA 3AJOA 2CHPA 4ZL5A 4LPJA 2HTNA 1JKUA 2OH3A 4AM2A 3NFPI 4DE6A 3NP0X 2KN9A 2Y44A 4IWKA 1MFRA 3E1LA 3HL1A 2C2UA 3LNLA 4DYYA 5MFPA 3GGYA 4POFA 1SMUA 3M6JA 1KRQA 1NNQA 1DPSA 1NXEA 1VZGA 3RYGA 5JDOB 4YWMA 2VXIA 1VJXA 4U3GA 3KA4A 3PIO1 2CF7A 4MY7A 1S24A 1R0GA 5D8RA 3BVIA 4R42A 1VLGA 1JI5A 5GN8B 4ISMA 3J7Y1 3E1JA 2A68D 3F34A 3KA6A 4PGIA 1SQ3A 2XJMA 5FFBA 1N1QA 5GU2X 2XJRA 4WFN1 3L0MA 2IB0A 4ERUA 4TOGA 2ITBA 5LG2A 2RDVA 5FEJA 5GAHc 3KWOA 5GU3X 4RC6A 4XKUA 2J9UB 3AF9X 1BCFA 4GS7D 1BG7A 1CADA 4AR6A 1IESA 3PVTB 1RWDA 4CVSA 4A25A 1ZUJA 5K52A 3F32A 5AXSA 3E1PA 3VVAA 3C1YA 2PYBA 3PW1A 4XGSA 2M6OA 2CLUA 1TKOA 2GYDA 5E1UA 1R0FA 4K9FA 1TJOA 3J7Z1 4E6KA 4XGHA 2W0OA 3PW8C 2QL0A 1ZRPA 2PPTA 1XZ1A 3O7RA 2IY4A 4RC5A 1YK5A 2PVEA 2FHAA 5DM61 1H96A 3RBCA 1RCCA 1E8JA 1OWBA 4CVRA 2A6HD 4POGA 3K35A 1EUMA 2A6ED 4MKUA 3MSUA 1S3QA 4RC7B 3E1MA 5J8WA 3QZ3A 3W54A 1RB9A 2N02A 8RXNA 3ERZA 4TOBA 3PVYB 1SMWA 5GOUA 2WLAA 2GS4A 2VZBA 2CLBA 1IERA 4V196 4KVRA 5AN9H 3PZAA 1YK4A 4CY9A 3AJPA 1QYBA 3BVKA 3E1OA 3F35A 5CMQA 4G6BA 3LKDA 5LG8A 3RZ6A 5FFDA 1RDGA 4YXMA 5FFCA 1BQ8A 2MGYA 1RCDA 3EZ0A 4ITWA 5IX6A 4IXKA 2AYJA 1RCIA 1LKMA 1B2JA 5JACA 2V2PA 4EVDA 4CVTA 3WVWA 1VCXA 4AR5A 3AJQA 4ZMCA 5HU6D 3PKJA 3ISFA 4LQNA 4ME3A 6RXNA 1WJVA 3BVEA 2C41A 4MUDA 4AI1A 4Z5SA 4LHNA 4ISPA 1T9PA 2V2RA 1FHMA 1ZS3A 1BRFA 4EVBA 4Y08A 3PKIA 3E2CA 4LYXA 4AI2A 3H7GA 3PW8A 1JIGA 4JAFA 2JD70 3F38A 4ZN3B 2V8TA 1UMNA 2BE5D 2BJYA 1Z4AA 4CMYA 2ERJA 5C6FA 3WVVA 2YJKA 5MF6A 3PW1B 4B8CD 2VXXA 4II4A 4KVSA 2CWLA 4MN9A 3WNWA 1Z6OM 1OTKA 1IU5A 2ZG8X 2XJQA 4AI3A 3Q4NA 5HQOA 2C6AA 2QQYA 3FRRA 3GHQA 1J30A 1NFVA 2XGWA 1SOFA 2G38B 3KYXA 5EINC 1NF6A 1C09A 1YUZA 4KVQA 3E6RA 2Z5RA 3GVYA 2ZA7A 4TODA 4YKHA 2WLUA 4MJYA 4P18A 4ZKWA 3ZG6A 2A69D 4DYUA 4CVPA 3MPSA 2CKCA 1F30A 3IQ1A 4KXRB 1QGHA 1RCGA 4CMYV 1VEQA 4ZLWA 4AI0A 4TVMA 2CN6A 2XKQA 3P2AA 4TPUA 3FRSA 1LB3A 3KYUA 1R0IA 4ZJKA 2L0ZA 3O7SA 1YV1A 2IU2A 3Q4OA 2B5ID 2FG8A 2YW6A 4W4LB 4JAGA 2JD60 1BE7A 3GGZA 5K53A 5K2ME 3KHKA 3SIDA 1L8IA 3Q4RA 1DX8A 2V3BB 1FHAA 2V2NA 5D8YA 5LS9A 3BKNA 3KA3A 1LKPA 2PYAA 2G4HA 1TK6A 4OYNA 3QHBA 4Z3BA 3RGDA 4PGKA 1XZ3A 4DZ0A 5RXNA 2HR5A 5D8QA 4DYZA 3E1NA 3FVBA 1HRSA 3IS8A 1VEIA 5MLC3 2V2OA 1UVHA 1SMMA 3IU3I 3KYWA 3QVDA 2FG4A 2Z5QA 5J8SA 4ZTTA 4LHLA 5GU1X 2V2LA 4CYBA 2VL6A 2V2JA 2Y3QA 1F33A 3OJ5A 2C2FA 1B2OA 2JI3A 3JZ9A 1FHHA 4TOFA 4RC8A 5JKLA 2BW1A 2ZURX 4II4B 3PVRA 5I4JA 3B08B 4IWJA 1B13A 4ML5A 1QCVA 2V8UA 2BKCA 4TW3A 4XKSA 3NOZX 2Z3QB 2JI2A 2CR8A 4RXNA 1ODHA 2MS3A 2V0EA 7RXNA 3F33A 1B71A 4AR3A 4EVEA 2ZIXA 4TOHA 3VPBE 4UY81 2FZFA 3F39A 1JYBA 2GMGA 5E2DA 1R0HA 2CN7A 1JREA 1O9RA 2BK6A 3PVTA 5HJFA 1IRNA 1CAAA 2C6RA 2JI1A 5JKLG 3OGHA 2C6BA 1S2ZA 1BFRA 2Z3RB 3R2OA 3PIP1 2CHIA 3B0AB 5JVG1 2XJNA 4RC6B 4AHYA 3WVUA 4EVCA 3QHCA 5FFAA 4DI0A 2ERSA 5CZUA 1JKVA 5HJHA 2UX1A 4TO9A 1IW7D 3V3KB 3A68A 2M4YA 5ERKA 1MOJA 3BVFA 3SH6A 5MGNA 1JTSA 3RD0A 1BQ9A 3FI6A 3JZAB 2C2JA 1NXGA 3BT5A 1O9IA 3R2LA 2FL0A 1VELA 4M32A 2FKZA 2V2IA 4ETRA 4JAEA 3PWFA 3T9JA 3HIUA 3PVYA 4RC5B 3E1QA 2M6PA 3NP2X 2V2MA 2YW7A 4TOAA 3R2MA 3KYVA 1R0JA 2JD80 4M35A 3FSEA 1VZHA 2O5JD 2LCQA 3QD8A 3U90A 5MFZA 3BVLA 1IROA 4YXJA 5J9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TA8 A;  4DAS A;  5GU0 X;  2CIH A;  3RE7 A;  3QB9 A;  5JKM A;  4LYU A;  1YUX A;  5D8O A;  3SE1 A;  2QF9 A;  1TKP A;  2ZA6 A;  4M34 A;  4REU A;  3PVR B;  2FFX J;  1DVB A;  4ZKX A;  4ZL6 A;  1RDV A;  2KKD A;  2V15 A;  3IS7 A;  3PWQ C;  4LPM A;  4PG1 A;  3E6S A;  1GWG A;  4AM5 A;  2DSX A;  5D8X A;  3F37 A;  1T9Q A;  1H7V A;  2XJO A;  5CMR A;  3UOI A;  2Z90 A;  5JKM G;  1NF4 A;  5LBH A;  4ZKH A;  1DAT A;  4LQV A;  1LKO A;  2CEI A;  1RYT A;  5FFE A;  3UNO A;  3GE4 A;  3AF7 X;  3ISE A;  4AR4 A;  3A9Q A;  2V2S A;  1JI4 A;  3SS2 A;  3RAV A;  3KA8 A;  3AK9 A;  1S30 A;  4LPN A;  4LQH A;  4AM4 A;  5GN8 A;  4DYX A;  4YWL A;  2Z6M A;  2RBD A;  4TOC A;  5AI2 A;  3EZU A;  5J93 A;  1BFY A;  5IY0 A;  2YJJ A;  3VNX A;  3Q4Q A;  1JGC A;  3ES3 A;  1LTL A;  2WTL A;  3R2S A;  2D5K A;  1RCE A;  3EGM A;  4LQJ A;  3AF8 X;  3RZT A;  3PWQ A;  4ITT A;  5AI3 A;  5D8S A;  3R2K A;  4CYA A;  3KYY A;  3KX9 A;  2OC5 A;  3SHX A;  5ERJ A;  2F7N A;  3R2R A;  2K2D A;  2X17 0;  2Z5P A;  2ZG7 X;  3UOF A;  3R2H A;  1Z6O A;  2GYQ A;  4XKT A;  3A44 A;  1L8H A;  4QUW A;  3KA9 A;  4PG0 A;  3KXU A;  3F36 A;  2PVX A;  5D8P A;  1T9O A;  4TOE A;  1IU6 A;  1AEW A;  4RC7 A;  2ZA8 A;  4M33 A;  2ZG9 X;  3AK8 A;  2FJC A;  1R03 A;  3AJO A;  2CHP A;  4ZL5 A;  4LPJ A;  2HTN A;  1JKU A;  2OH3 A;  4AM2 A;  4DE6 A;  3NP0 X;  2KN9 A;  4IWK A;  1MFR A;  3E1L A;  3HL1 A;  2C2U A;  4DYY A;  4POF A;  1SMU A;  1KRQ A;  1NNQ A;  1DPS A;  3RYG A;  4YWM A;  2VXI A;  1VJX A;  4U3G A;  3KA4 A;  2CF7 A;  4MY7 A;  1S24 A;  1R0G A;  5D8R A;  3BVI A;  4R42 A;  1VLG A;  1JI5 A;  5GN8 B;  4ISM A;  3E1J A;  3F34 A;  3KA6 A;  4PGI A;  1SQ3 A;  2XJM A;  5FFB A;  1N1Q A;  5GU2 X;  2IB0 A;  4ERU A;  4TOG A;  2ITB A;  5LG2 A;  2RDV A;  5FEJ A;  3KWO A;  5GU3 X;  4RC6 A;  4XKU A;  3AF9 X;  1BCF A;  1BG7 A;  1CAD A;  4AR6 A;  1IES A;  3PVT B;  1RWD A;  4CVS A;  4A25 A;  1ZUJ A;  5K52 A;  3F32 A;  5AXS A;  3E1P A;  2PYB A;  3PW1 A;  4XGS A;  2CLU A;  1TKO A;  2GYD A;  5E1U A;  1R0F A;  4K9F A;  1TJO A;  4E6K A;  2W0O A;  3PW8 C;  2QL0 A;  1ZRP A;  1XZ1 A;  3O7R A;  2IY4 A;  4RC5 A;  1YK5 A;  2PVE A;  2FHA A;  1H96 A;  3RBC A;  1RCC A;  1E8J A;  4CVR A;  4POG A;  1EUM A;  4MKU A;  1S3Q A;  4RC7 B;  3E1M A;  5J8W A;  3QZ3 A;  1RB9 A;  8RXN A;  3ERZ A;  4TOB A;  3PVY B;  1SMW A;  5GOU A;  2WLA A;  2GS4 A;  2VZB A;  2CLB A;  1IER A;  4KVR A;  3PZA A;  1YK4 A;  4CY9 A;  3AJP A;  1QYB A;  3BVK A;  3E1O A;  3F35 A;  5CMQ A;  5LG8 A;  3RZ6 A;  5FFD A;  1RDG A;  5FFC A;  1BQ8 A;  1RCD A;  3EZ0 A;  4ITW A;  5IX6 A;  4IXK A;  1RCI A;  1LKM A;  1B2J A;  5JAC A;  2V2P A;  4EVD A;  4CVT A;  3WVW A;  1VCX A;  4AR5 A;  3AJQ A;  4ZMC A;  3ISF A;  4LQN A;  4ME3 A;  6RXN A;  3BVE A;  2C41 A;  4MUD A;  4Z5S A;  4ISP A;  1T9P A;  2V2R A;  1FHM A;  1ZS3 A;  1BRF A;  4EVB A;  4Y08 A;  3E2C A;  4LYX A;  3H7G A;  3PW8 A;  1JIG A;  2JD7 0;  3F38 A;  1UMN A;  2BJY A;  1Z4A A;  4CMY A;  5C6F A;  3WVV A;  2YJK A;  3PW1 B;  2VXX A;  4II4 A;  4KVS A;  4MN9 A;  3WNW A;  1Z6O M;  1OTK A;  1IU5 A;  2ZG8 X;  3Q4N A;  5HQO A;  2QQY A;  3GHQ A;  1J30 A;  1NFV A;  2XGW A;  1SOF A;  3KYX A;  1NF6 A;  1C09 A;  1YUZ A;  4KVQ A;  3E6R A;  2Z5R A;  3GVY A;  2ZA7 A;  4TOD A;  4YKH A;  2WLU A;  4MJY A;  4P18 A;  4ZKW A;  4DYU A;  4CVP A;  3MPS A;  1F30 A;  3IQ1 A;  1QGH A;  1RCG A;  4CMY V;  1VEQ A;  4ZLW A;  2CN6 A;  2XKQ A;  4TPU A;  1LB3 A;  3KYU A;  1R0I A;  4ZJK A;  3O7S A;  1YV1 A;  2IU2 A;  3Q4O A;  2FG8 A;  2YW6 A;  2JD6 0;  1BE7 A;  5K53 A;  3SID A;  1L8I A;  3Q4R A;  1DX8 A;  2V3B B;  1FHA A;  2V2N A;  5D8Y A;  5LS9 A;  3BKN A;  3KA3 A;  1LKP A;  2PYA A;  2G4H A;  1TK6 A;  4OYN A;  3QHB A;  4Z3B A;  3RGD A;  4PGK A;  1XZ3 A;  4DZ0 A;  5RXN A;  2HR5 A;  5D8Q A;  4DYZ A;  3E1N A;  3FVB A;  1HRS A;  3IS8 A;  1VEI A;  2V2O A;  1UVH A;  1SMM A;  3KYW A;  3QVD A;  2FG4 A;  2Z5Q A;  5J8S A;  4ZTT A;  5GU1 X;  2V2L A;  4CYB A;  2VL6 A;  2V2J A;  2Y3Q A;  1F33 A;  3OJ5 A;  2C2F A;  1B2O A;  1FHH A;  4TOF A;  4RC8 A;  5JKL A;  2BW1 A;  2ZUR X;  4II4 B;  3PVR A;  5I4J A;  4IWJ A;  1B13 A;  4ML5 A;  1QCV A;  2BKC A;  4TW3 A;  4XKS A;  3NOZ X;  4RXN A;  2MS3 A;  7RXN A;  3F33 A;  1B71 A;  4AR3 A;  4EVE A;  4TOH A;  2FZF A;  3F39 A;  1JYB A;  2GMG A;  5E2D A;  1R0H A;  2CN7 A;  1JRE A;  1O9R A;  2BK6 A;  3PVT A;  5HJF A;  1IRN A;  1CAA A;  2C6R A;  5JKL G;  3OGH A;  1S2Z A;  1BFR A;  3R2O A;  2CHI A;  2XJN A;  4RC6 B;  3WVU A;  4EVC A;  3QHC A;  5FFA A;  4DI0 A;  5CZU A;  1JKV A;  5HJH A;  2UX1 A;  4TO9 A;  3A68 A;  2M4Y A;  5ERK A;  1MOJ A;  3BVF A;  3SH6 A;  1JTS A;  3RD0 A;  1BQ9 A;  3FI6 A;  2C2J A;  3BT5 A;  1O9I A;  3R2L A;  2FL0 A;  1VEL A;  4M32 A;  2FKZ A;  2V2I A;  4ETR A;  3PWF A;  3T9J A;  3HIU A;  3PVY A;  4RC5 B;  3E1Q A;  3NP2 X;  2V2M A;  2YW7 A;  4TOA A;  3R2M A;  3KYV A;  1R0J A;  2JD8 0;  4M35 A;  3FSE A;  2LCQ A;  3QD8 A;  3U90 A;  3BVL A;  1IRO A;  5J9V A; 
#chains in the Genus database with same CATH topology
 3GTO L;  4A3K L;  3TA8 A;  4DAS A;  5GU0 X;  3DBY A;  2XJP A;  4U67 1;  3HOY L;  2CIH A;  3RE7 A;  4AHW A;  3QB9 A;  5JKM A;  2PSM C;  4LYU A;  1YUX A;  2AQC A;  5D8O A;  3SE1 A;  5M3M L;  2QF9 A;  3LPE B;  1P7P A;  1TKP A;  2ZA6 A;  5C3E L;  4M34 A;  4REU A;  3PVR B;  2WWX B;  2FFX J;  3C21 A;  3C1Z A;  1DVB A;  4ZKX A;  3UFB A;  2CKA A;  4ZL6 A;  2M4V A;  1RDV A;  1RYQ A;  2KKD A;  2V15 A;  2V0F A;  3IS7 A;  5JVH 1;  3PWQ C;  4LPM A;  4PG1 A;  3WWL A;  1I6H L;  3E6S A;  3VV9 A;  1GWG A;  4AM5 A;  2DSX A;  5D8X A;  3GTL L;  3F37 A;  1T9Q A;  1H7V A;  1VZI A;  2XJO A;  5CMR A;  3UOI A;  2NVY L;  2Z90 A;  5JKM G;  4C3H L;  1NF4 A;  5LBH A;  2XJU A;  4ZKH A;  1DAT A;  4LQV A;  3HKZ P;  3WWN B;  3M3Y L;  1LKO A;  2CEI A;  1RYT A;  3KDQ A;  5FFE A;  3UNO A;  4BBS L;  3GE4 A;  3AF7 X;  3ISE A;  4YVZ A;  4AR4 A;  3A9Q A;  2AR0 A;  1JI4 A;  2V2S A;  3SS2 A;  1PFU A;  3RAV A;  3KA8 A;  5H1S c;  3P8B A;  4E6Y A;  3AK9 A;  5JDO A;  1S30 A;  5EIO C;  2OKC A;  1SFO L;  4LPN A;  4LQH A;  4AM4 A;  3LWO B;  4WJG 4;  3CQZ L;  5GN8 A;  4DYX A;  4YWL A;  1Z92 B;  2Z6M A;  3GTM L;  1OWC A;  2RBD A;  4TOC A;  5AI2 A;  3EZU A;  5J93 A;  4ZN1 B;  1BFY A;  4QIW P;  4BY7 L;  5IY0 A;  2YJJ A;  2H12 A;  2NYD A;  3VNX A;  4MXP A;  3Q4Q A;  1JGC A;  3ES3 A;  4XXB B;  2NVX L;  3HOV L;  1LTL A;  2WTL A;  3R2S A;  2D5K A;  1RCE A;  4AHZ A;  3QQC E;  5GAD c;  3EGM A;  5GAG c;  4JAD A;  3H9B A;  2XJS A;  4LQJ A;  4W4K B;  3AF8 X;  4X0J A;  3RZT A;  3PWQ A;  3D19 A;  4ITT A;  5AI3 A;  5D8S A;  4A3G L;  3R2K A;  4CYA A;  3KYY A;  3KX9 A;  2OC5 A;  3SHX A;  5ERJ A;  2F7N A;  3R2R A;  2K2D A;  2X17 0;  2Z5P A;  2XJV A;  2ZG7 X;  3UOF A;  3R2H A;  2E2J L;  4A3L L;  1Z6O A;  2GYQ A;  4XKT A;  4E40 A;  1L8H A;  3A44 A;  3H0G L;  3H9C A;  4Y52 L;  5GAE c;  2E2I L;  1F4L A;  2Y0S P;  4QUW A;  1TWF L;  1WCM L;  4AHX A;  2XJT A;  5DM7 1;  3C23 A;  3KA9 A;  4PG0 A;  4A3F L;  3KXU A;  3F36 A;  2PVX A;  5D8P A;  1T9O A;  3H97 A;  4TOE A;  1IU6 A;  1AEW A;  4RC7 A;  2ZA8 A;  4M33 A;  2ZG9 X;  3AK8 A;  2FJC A;  1R03 A;  3N6O A;  3AJO A;  2CHP A;  4ZL5 A;  4LPJ A;  2HTN A;  1JKU A;  2OH3 A;  4AM2 A;  3NFP I;  4DE6 A;  3NP0 X;  2KN9 A;  2Y44 A;  4IWK A;  1MFR A;  3E1L A;  3HL1 A;  2C2U A;  4X6A L;  3LNL A;  4DYY A;  5MFP A;  2JA6 L;  3GGY A;  4POF A;  1SMU A;  3M6J A;  1KRQ A;  2VUM L;  1NNQ A;  1DPS A;  1NXE A;  1VZG A;  3RYG A;  5JDO B;  4YWM A;  2VXI A;  3S1R L;  1VJX A;  4U3G A;  3KA4 A;  3PIO 1;  2CF7 A;  4MY7 A;  1S24 A;  1R0G A;  5M5Y L;  5D8R A;  3BVI A;  4R42 A;  1VLG A;  1JI5 A;  5GN8 B;  4ISM A;  3FKI L;  3J7Y 1;  3E1J A;  2A68 D;  3MQK B;  3PO2 L;  3F34 A;  1TWH L;  3S2H L;  4A3D L;  3KA6 A;  4PGI A;  1SQ3 A;  2XJM A;  5FFB A;  1N1Q A;  5GU2 X;  2XJR A;  4WFN 1;  3L0M A;  2IB0 A;  4ERU A;  4TOG A;  2ITB A;  5LG2 A;  2RDV A;  3HJY B;  5FEJ A;  1PFV A;  1TWA L;  5GAH c;  3LWQ B;  3KWO A;  5GU3 X;  3LWP B;  4RC6 A;  4XKU A;  5C4J L;  1Y1V L;  3AF9 X;  2J9U B;  2R92 L;  1BCF A;  4GS7 D;  1BG7 A;  1CAD A;  4AR6 A;  2YU9 L;  1IES A;  3PVT B;  1RWD A;  4CVS A;  3GTK L;  3I4M L;  2RFK B;  4A25 A;  5FJ8 L;  4A93 L;  1ZUJ A;  5M3F L;  5K52 A;  4Y7N L;  3F32 A;  5AXS A;  3E1P A;  3VVA A;  3PO3 L;  3C1Y A;  2PYB A;  3PW1 A;  4XGS A;  2M6O A;  2JA7 L;  2CLU A;  1TKO A;  3H99 A;  3RZO L;  2GYD A;  5E1U A;  1R0F A;  4K9F A;  1TJO A;  5IP7 L;  5FLM L;  2JA5 L;  3J7Z 1;  4E6K A;  4XGH A;  2W0O A;  3PW8 C;  2QL0 A;  1ZRP A;  2PPT A;  1XZ1 A;  3O7R A;  4A3B L;  2IY4 A;  4RC5 A;  4BY1 L;  1YK5 A;  2PVE A;  2FHA A;  5DM6 1;  1H96 A;  3RBC A;  1RCC A;  1E8J A;  1OWB A;  4C2M 1;  4CVR A;  2A6H D;  3HJW B;  1I3Q L;  4POG A;  3K35 A;  2EY4 E;  1EUM A;  2A6E D;  4MKU A;  3MSU A;  1S3Q A;  4RC7 B;  3E1M A;  5J8W A;  3QZ3 A;  3W54 A;  1RB9 A;  2N02 A;  8RXN A;  2AUS B;  3ERZ A;  4TOB A;  3PVY B;  1SMW A;  5GOU A;  2WLA A;  2GS4 A;  2VZB A;  2CLB A;  1IER A;  4V19 6;  4KVR A;  5AN9 H;  3PZA A;  1YK4 A;  3H3V M;  4CY9 A;  3AJP A;  1QYB A;  2WAQ P;  3BVK A;  3E1O A;  3F35 A;  5CMQ A;  4G6B A;  3LKD A;  5LG8 A;  3RZ6 A;  5FFD A;  1RDG A;  4YXM A;  5FFC A;  1BQ8 A;  2MGY A;  3HOU L;  1RCD A;  3EZ0 A;  4ITW A;  2PMZ P;  5IX6 A;  4IXK A;  2AYJ A;  1RCI A;  1R9T L;  1LKM A;  1B2J A;  5JAC A;  2V2P A;  4EVD A;  4CVT A;  3WVW A;  1VCX A;  4AR5 A;  4AYB P;  3AJQ A;  4ZMC A;  5HU6 D;  3PKJ A;  3ISF A;  4C3I L;  4LQN A;  4ME3 A;  6RXN A;  1WJV A;  3BVE A;  2C41 A;  4MUD A;  3S2D L;  4AI1 A;  4Z5S A;  4LHN A;  4ISP A;  1T9P A;  2V2R A;  3RZD L;  3S1N L;  1FHM A;  1ZS3 A;  1BRF A;  4EVB A;  4Y08 A;  3HAX C;  3PKI A;  3E2C A;  4LYX A;  3FDJ A;  4AI2 A;  3H7G A;  3PW8 A;  1JIG A;  4JAF A;  3LWR B;  2JD7 0;  3F38 A;  4ZN3 B;  2V8T A;  1UMN A;  2BE5 D;  2BJY A;  4BXX L;  1PFW A;  4A3I L;  1Z4A A;  3S16 L;  4CMY A;  2ERJ A;  5C6F A;  3WVV A;  1QQT A;  2YJK A;  5MF6 A;  3PW1 B;  2WB1 P;  4B8C D;  2VXX A;  4II4 A;  4KVS A;  3S1Q L;  2CWL A;  4MN9 A;  3WNW A;  1Z6O M;  1OTK A;  1IU5 A;  2ZG8 X;  2XJQ A;  4AI3 A;  3Q4N A;  5HQO A;  2C6A A;  2QQY A;  3I4N L;  3FRR A;  3GHQ A;  1J30 A;  1NFV A;  2XGW A;  1SOF A;  2G38 B;  3KYX A;  5EIN C;  1NF6 A;  1C09 A;  1YUZ A;  4KVQ A;  1PFY A;  3E6R A;  2Z5R A;  3GVY A;  2ZA7 A;  4TOD A;  4YKH A;  2WLU A;  4MJY A;  4P18 A;  4ZKW A;  3ZG6 A;  2APO B;  2A69 D;  4DYU A;  1Y1W L;  4CVP A;  1K83 L;  3MPS A;  2CKC A;  1F30 A;  3IQ1 A;  4A3M L;  4A3J L;  4KXR B;  1QGH A;  1RCG A;  4CMY V;  1VEQ A;  4ZLW A;  4AI0 A;  4TVM A;  2CN6 A;  2XKQ A;  3P2A A;  4TPU A;  3FRS A;  1LB3 A;  3KYU A;  1R0I A;  4ZJK A;  2L0Z A;  4A3C L;  3O7S A;  1YV1 A;  2IU2 A;  1PZX A;  3Q4O A;  2B5I D;  2FG8 A;  2YW6 A;  4W4L B;  4JAG A;  2JD6 0;  1BE7 A;  3GGZ A;  5IYB L;  5K53 A;  5K2M E;  3KHK A;  3SID A;  1L8I A;  3Q4R A;  1DX8 A;  2V3B B;  2E2H L;  1FHA A;  2V2N A;  5D8Y A;  5LS9 A;  3BKN A;  3KA3 A;  1LKP A;  2PYA A;  5IP9 L;  2G4H A;  2HVY C;  1TK6 A;  4OYN A;  3QHB A;  4Z3B A;  3RGD A;  4PGK A;  1XZ3 A;  4DZ0 A;  5RXN A;  2HR5 A;  2R93 L;  5D8Q A;  4DYZ A;  3E1N A;  3FVB A;  1HRS A;  3IS8 A;  1VEI A;  5MLC 3;  2V2O A;  1UVH A;  3S15 L;  1SMM A;  5C44 L;  3IU3 I;  3KYW A;  3PL5 A;  3QVD A;  2FG4 A;  2Z5Q A;  5J8S A;  1TWG L;  4ZTT A;  4LHL A;  5GU1 X;  2V2L A;  4CYB A;  2VL6 A;  2V2J A;  2Y3Q A;  1F33 A;  3OJ5 A;  2C2F A;  4C3J L;  1B2O A;  2JI3 A;  5IYC L;  2NVQ L;  3GTP L;  3JZ9 A;  1FHH A;  4TOF A;  4RC8 A;  5JKL A;  2BW1 A;  2ZUR X;  4II4 B;  3PVR A;  3GTQ L;  3S14 L;  5I4J A;  3B08 B;  4IWJ A;  1B13 A;  4ML5 A;  1QCV A;  2V8U A;  2BKC A;  2R7Z L;  4TW3 A;  4XKS A;  3NOZ X;  2Z3Q B;  2JI2 A;  2CR8 A;  4RXN A;  4A3E L;  1ODH A;  2MS3 A;  2V0E A;  7RXN A;  3F33 A;  1B71 A;  4AR3 A;  4EVE A;  2ZIX A;  4TOH A;  3VPB E;  4UY8 1;  3HOW L;  2FZF A;  3F39 A;  1JYB A;  2GMG A;  5E2D A;  1R0H A;  2CN7 A;  1JRE A;  1O9R A;  2BK6 A;  3PVT A;  5HJF A;  1IRN A;  1CAA A;  2C6R A;  2JI1 A;  5JKL G;  3OGH A;  5IYD L;  5M5W L;  3S1M L;  2C6B A;  3M4O L;  1S2Z A;  1BFR A;  2JA8 L;  2Z3R B;  3R2O A;  3PIP 1;  2CHI A;  3B0A B;  5JVG 1;  2XJN A;  4RC6 B;  4AHY A;  3WVU A;  2B63 L;  4EVC A;  3QHC A;  5FFA A;  4DI0 A;  2ERS A;  5CZU A;  1JKV A;  5HJH A;  2UX1 A;  4TO9 A;  1IW7 D;  3V3K B;  3A68 A;  2M4Y A;  5ERK A;  1MOJ A;  3BVF A;  3SH6 A;  5MGN A;  1JTS A;  3RD0 A;  1BQ9 A;  3FI6 A;  3JZA B;  5C4X L;  2C2J A;  1NXG A;  3JR7 A;  3LWV B;  3BT5 A;  3K7A L;  2NVT L;  1O9I A;  3R2L A;  2FL0 A;  1VEL A;  4M32 A;  2FKZ A;  3GTG L;  2V2I A;  4ETR A;  4BBR L;  1TWC L;  4JAE A;  3PWF A;  1I50 L;  3T9J A;  3HIU A;  3PVY A;  4RC5 B;  3E1Q A;  2M6P A;  3NP2 X;  2V2M A;  2YW7 A;  4TOA A;  3R2M A;  3KYV A;  1R0J A;  3GTJ L;  2JD8 0;  4M35 A;  3FSE A;  1VZH A;  3S17 L;  3HOZ L;  5M5X L;  2O5J D;  2LCQ A;  3QD8 A;  3U90 A;  5MFZ A;  3BVL A;  1IRO A;  4YXJ A;  5J9V A;  3HOX L; 
#chains in the Genus database with same CATH homology
 3TA8 A;  4DAS A;  5GU0 X;  3DBY A;  2XJP A;  4U67 1;  2CIH A;  3RE7 A;  4AHW A;  3QB9 A;  5JKM A;  2PSM C;  4LYU A;  1YUX A;  5D8O A;  3SE1 A;  2QF9 A;  3LPE B;  1TKP A;  2ZA6 A;  4M34 A;  4REU A;  3PVR B;  2WWX B;  2FFX J;  3C21 A;  3C1Z A;  1DVB A;  4ZKX A;  3UFB A;  2CKA A;  4ZL6 A;  2M4V A;  1RDV A;  1RYQ A;  2KKD A;  2V15 A;  2V0F A;  3IS7 A;  5JVH 1;  3PWQ C;  4LPM A;  4PG1 A;  3WWL A;  3E6S A;  3VV9 A;  1GWG A;  4AM5 A;  2DSX A;  5D8X A;  3F37 A;  1T9Q A;  1H7V A;  1VZI A;  2XJO A;  5CMR A;  3UOI A;  2Z90 A;  5JKM G;  1NF4 A;  5LBH A;  2XJU A;  4ZKH A;  1DAT A;  4LQV A;  3WWN B;  1LKO A;  2CEI A;  1RYT A;  3KDQ A;  5FFE A;  3UNO A;  3GE4 A;  3AF7 X;  3ISE A;  4YVZ A;  4AR4 A;  3A9Q A;  2AR0 A;  1JI4 A;  2V2S A;  3SS2 A;  3RAV A;  3KA8 A;  5H1S c;  3P8B A;  4E6Y A;  3AK9 A;  5JDO A;  1S30 A;  5EIO C;  2OKC A;  4LPN A;  4LQH A;  4AM4 A;  4WJG 4;  5GN8 A;  4DYX A;  4YWL A;  1Z92 B;  2Z6M A;  1OWC A;  2RBD A;  4TOC A;  5AI2 A;  3EZU A;  5J93 A;  4ZN1 B;  1BFY A;  5IY0 A;  2YJJ A;  2H12 A;  2NYD A;  3VNX A;  4MXP A;  3Q4Q A;  1JGC A;  3ES3 A;  4XXB B;  1LTL A;  2WTL A;  3R2S A;  2D5K A;  1RCE A;  4AHZ A;  3QQC E;  5GAD c;  3EGM A;  5GAG c;  4JAD A;  2XJS A;  4LQJ A;  4W4K B;  3AF8 X;  4X0J A;  3RZT A;  3PWQ A;  3D19 A;  4ITT A;  5AI3 A;  5D8S A;  3R2K A;  4CYA A;  3KYY A;  3KX9 A;  2OC5 A;  3SHX A;  5ERJ A;  2F7N A;  3R2R A;  2K2D A;  2X17 0;  2Z5P A;  2XJV A;  2ZG7 X;  3UOF A;  3R2H A;  1Z6O A;  2GYQ A;  4XKT A;  4E40 A;  1L8H A;  3A44 A;  5GAE c;  4QUW A;  4AHX A;  2XJT A;  5DM7 1;  3C23 A;  3KA9 A;  4PG0 A;  3KXU A;  3F36 A;  2PVX A;  5D8P A;  1T9O A;  4TOE A;  1IU6 A;  1AEW A;  4RC7 A;  2ZA8 A;  4M33 A;  2ZG9 X;  3AK8 A;  2FJC A;  1R03 A;  3N6O A;  3AJO A;  2CHP A;  4ZL5 A;  4LPJ A;  2HTN A;  1JKU A;  2OH3 A;  4AM2 A;  3NFP I;  4DE6 A;  3NP0 X;  2KN9 A;  2Y44 A;  4IWK A;  1MFR A;  3E1L A;  3HL1 A;  2C2U A;  3LNL A;  4DYY A;  5MFP A;  3GGY A;  4POF A;  1SMU A;  3M6J A;  1KRQ A;  1NNQ A;  1DPS A;  1NXE A;  1VZG A;  3RYG A;  5JDO B;  4YWM A;  2VXI A;  1VJX A;  4U3G A;  3KA4 A;  3PIO 1;  2CF7 A;  4MY7 A;  1S24 A;  1R0G A;  5D8R A;  3BVI A;  4R42 A;  1VLG A;  1JI5 A;  5GN8 B;  4ISM A;  3J7Y 1;  3E1J A;  2A68 D;  3F34 A;  3KA6 A;  4PGI A;  1SQ3 A;  2XJM A;  5FFB A;  1N1Q A;  5GU2 X;  2XJR A;  4WFN 1;  3L0M A;  2IB0 A;  4ERU A;  4TOG A;  2ITB A;  5LG2 A;  2RDV A;  5FEJ A;  5GAH c;  3KWO A;  5GU3 X;  4RC6 A;  4XKU A;  2J9U B;  3AF9 X;  1BCF A;  4GS7 D;  1BG7 A;  1CAD A;  4AR6 A;  1IES A;  3PVT B;  1RWD A;  4CVS A;  4A25 A;  1ZUJ A;  5K52 A;  3F32 A;  5AXS A;  3E1P A;  3VVA A;  3C1Y A;  2PYB A;  3PW1 A;  4XGS A;  2M6O A;  2CLU A;  1TKO A;  2GYD A;  5E1U A;  1R0F A;  4K9F A;  1TJO A;  3J7Z 1;  4E6K A;  4XGH A;  2W0O A;  3PW8 C;  2QL0 A;  1ZRP A;  2PPT A;  1XZ1 A;  3O7R A;  2IY4 A;  4RC5 A;  1YK5 A;  2PVE A;  2FHA A;  5DM6 1;  1H96 A;  3RBC A;  1RCC A;  1E8J A;  1OWB A;  4CVR A;  2A6H D;  4POG A;  3K35 A;  1EUM A;  2A6E D;  4MKU A;  3MSU A;  1S3Q A;  4RC7 B;  3E1M A;  5J8W A;  3QZ3 A;  3W54 A;  1RB9 A;  2N02 A;  8RXN A;  3ERZ A;  4TOB A;  3PVY B;  1SMW A;  5GOU A;  2WLA A;  2GS4 A;  2VZB A;  2CLB A;  1IER A;  4V19 6;  4KVR A;  5AN9 H;  3PZA A;  1YK4 A;  4CY9 A;  3AJP A;  1QYB A;  3BVK A;  3E1O A;  3F35 A;  5CMQ A;  4G6B A;  3LKD A;  5LG8 A;  3RZ6 A;  5FFD A;  1RDG A;  4YXM A;  5FFC A;  1BQ8 A;  2MGY A;  1RCD A;  3EZ0 A;  4ITW A;  5IX6 A;  4IXK A;  2AYJ A;  1RCI A;  1LKM A;  1B2J A;  5JAC A;  2V2P A;  4EVD A;  4CVT A;  3WVW A;  1VCX A;  4AR5 A;  3AJQ A;  4ZMC A;  5HU6 D;  3PKJ A;  3ISF A;  4LQN A;  4ME3 A;  6RXN A;  1WJV A;  3BVE A;  2C41 A;  4MUD A;  4AI1 A;  4Z5S A;  4LHN A;  4ISP A;  1T9P A;  2V2R A;  1FHM A;  1ZS3 A;  1BRF A;  4EVB A;  4Y08 A;  3PKI A;  3E2C A;  4LYX A;  4AI2 A;  3H7G A;  3PW8 A;  1JIG A;  4JAF A;  2JD7 0;  3F38 A;  4ZN3 B;  2V8T A;  1UMN A;  2BE5 D;  2BJY A;  1Z4A A;  4CMY A;  2ERJ A;  5C6F A;  3WVV A;  2YJK A;  5MF6 A;  3PW1 B;  4B8C D;  2VXX A;  4II4 A;  4KVS A;  2CWL A;  4MN9 A;  3WNW A;  1Z6O M;  1OTK A;  1IU5 A;  2ZG8 X;  2XJQ A;  4AI3 A;  3Q4N A;  5HQO A;  2C6A A;  2QQY A;  3FRR A;  3GHQ A;  1J30 A;  1NFV A;  2XGW A;  1SOF A;  2G38 B;  3KYX A;  5EIN C;  1NF6 A;  1C09 A;  1YUZ A;  4KVQ A;  3E6R A;  2Z5R A;  3GVY A;  2ZA7 A;  4TOD A;  4YKH A;  2WLU A;  4MJY A;  4P18 A;  4ZKW A;  3ZG6 A;  2A69 D;  4DYU A;  4CVP A;  3MPS A;  2CKC A;  1F30 A;  3IQ1 A;  4KXR B;  1QGH A;  1RCG A;  4CMY V;  1VEQ A;  4ZLW A;  4AI0 A;  4TVM A;  2CN6 A;  2XKQ A;  3P2A A;  4TPU A;  3FRS A;  1LB3 A;  3KYU A;  1R0I A;  4ZJK A;  2L0Z A;  3O7S A;  1YV1 A;  2IU2 A;  3Q4O A;  2B5I D;  2FG8 A;  2YW6 A;  4W4L B;  4JAG A;  2JD6 0;  1BE7 A;  3GGZ A;  5K53 A;  5K2M E;  3KHK A;  3SID A;  1L8I A;  3Q4R A;  1DX8 A;  2V3B B;  1FHA A;  2V2N A;  5D8Y A;  5LS9 A;  3BKN A;  3KA3 A;  1LKP A;  2PYA A;  2G4H A;  1TK6 A;  4OYN A;  3QHB A;  4Z3B A;  3RGD A;  4PGK A;  1XZ3 A;  4DZ0 A;  5RXN A;  2HR5 A;  5D8Q A;  4DYZ A;  3E1N A;  3FVB A;  1HRS A;  3IS8 A;  1VEI A;  5MLC 3;  2V2O A;  1UVH A;  1SMM A;  3IU3 I;  3KYW A;  3QVD A;  2FG4 A;  2Z5Q A;  5J8S A;  4ZTT A;  4LHL A;  5GU1 X;  2V2L A;  4CYB A;  2VL6 A;  2V2J A;  2Y3Q A;  1F33 A;  3OJ5 A;  2C2F A;  1B2O A;  2JI3 A;  3JZ9 A;  1FHH A;  4TOF A;  4RC8 A;  5JKL A;  2BW1 A;  2ZUR X;  4II4 B;  3PVR A;  5I4J A;  3B08 B;  4IWJ A;  1B13 A;  4ML5 A;  1QCV A;  2V8U A;  2BKC A;  4TW3 A;  4XKS A;  3NOZ X;  2Z3Q B;  2JI2 A;  2CR8 A;  4RXN A;  1ODH A;  2MS3 A;  2V0E A;  7RXN A;  3F33 A;  1B71 A;  4AR3 A;  4EVE A;  2ZIX A;  4TOH A;  3VPB E;  4UY8 1;  2FZF A;  3F39 A;  1JYB A;  2GMG A;  5E2D A;  1R0H A;  2CN7 A;  1JRE A;  1O9R A;  2BK6 A;  3PVT A;  5HJF A;  1IRN A;  1CAA A;  2C6R A;  2JI1 A;  5JKL G;  3OGH A;  2C6B A;  1S2Z A;  1BFR A;  2Z3R B;  3R2O A;  3PIP 1;  2CHI A;  3B0A B;  5JVG 1;  2XJN A;  4RC6 B;  4AHY A;  3WVU A;  4EVC A;  3QHC A;  5FFA A;  4DI0 A;  2ERS A;  5CZU A;  1JKV A;  5HJH A;  2UX1 A;  4TO9 A;  1IW7 D;  3V3K B;  3A68 A;  2M4Y A;  5ERK A;  1MOJ A;  3BVF A;  3SH6 A;  5MGN A;  1JTS A;  3RD0 A;  1BQ9 A;  3FI6 A;  3JZA B;  2C2J A;  1NXG A;  3BT5 A;  1O9I A;  3R2L A;  2FL0 A;  1VEL A;  4M32 A;  2FKZ A;  2V2I A;  4ETR A;  4JAE A;  3PWF A;  3T9J A;  3HIU A;  3PVY A;  4RC5 B;  3E1Q A;  2M6P A;  3NP2 X;  2V2M A;  2YW7 A;  4TOA A;  3R2M A;  3KYV A;  1R0J A;  2JD8 0;  4M35 A;  3FSE A;  1VZH A;  2O5J D;  2LCQ A;  3QD8 A;  3U90 A;  5MFZ A;  3BVL A;  1IRO A;  4YXJ A;  5J9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...