1YV1A

Fully reduced state of nigerythrin (all ferrous)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
202
structure length
202
Chain Sequence
b'MKVRAQVPTVKNATNFNMVADSKTSVGSTLENLKAAIAGETGAHAKYTAFAKAAREQGYEQIARLFEATAAAELIHIGLEYALVAEMEPGYEKPTVAAPSAYSCDLNLISGANGEIYETSDMYPAFIRKAQEEGNSKAVHVFTRAKLAESVHAERYLAAYNDIDAPDDDKFHLCPICGYIHKGEDFEKCPICFRPKDTFTAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nigerythrin
publication title High-resolution crystal structures of Desulfovibrio vulgaris (Hildenborough) nigerythrin: facile, redox-dependent iron movement, domain interface variability, and peroxidase activity in the rubrerythrins.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris
molecule tags Oxidoreductase
total genus 69
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1yv1A01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1yv1A02
4PG1A 4Z3BA 2CN6A 4TOGA 5GN8A 5J8WA 3PW8A 2CLBA 4POGA 4P18A 4ME3A 1YUXA 5JKMG 2V2LA 3F33A 4EVBA 1RCDA 1BFRA 1R0JA 3PVYA 4ZTTA 3BT5A 3KX9A 5AI2A 1VLGA 2Z5QA 1RDVA 3RZTA 1XZ3A 4ZKXA 3ISEA 4CY9A 2ZA7A 3QD8A 3SH6A 5RXNA 4ZL6A 3Q4QA 1B2JA 1R0HA 4CYAA 3WVVA 4PG0A 1IRNA 2RDVA 3MPSA 1RCIA 5CMRA 1IU6A 5GU3X 2CLUA 1BRFA 2BKCA 4ISPA 1CADA 1XZ1A 5K53A 5AXSA 4RC6B 3PVYB 1UMNA 2KN9A 5J9VA 2YW7A 4XKSA 1F33A 5HJHA 4KVRA 4LPJA 4LYXA 2V2NA 2YW6A 1DX8A 1TK6A 1S24A 5I4JA 3A9QA 3QVDA 4RC7A 2CN7A 2WLUA 2HTNA 2BK6A 2HR5A 3RGDA 4QUWA 4R42A 5D8QA 3R2MA 3FVBA 1KRQA 8RXNA 2C2UA 2WLAA 3KA8A 3TA8A 3PWQC 3RBCA 2JD60 4ZJKA 2QF9A 2WTLA 2V2JA 3AK9A 3F34A 5FEJA 5K52A 3GVYA 5LG2A 4YKHA 2V15A 1JTSA 2LCQA 5C6FA 4RC7B 3AF8X 1DATA 4EVDA 4AM5A 1C09A 5IY0A 4ITTA 4OYNA 1FHMA 3E6SA 3QHCA 4ZKHA 4LQVA 3KYYA 4PGKA 3KXUA 1RCCA 3E1NA 1MFRA 3FI6A 1JREA 3PVRB 1Z6OM 3BVIA 4ZLWA 1TKPA 4CVPA 1O9IA 4II4A 1NNQA 3UOFA 3F32A 1RB9A 2C2FA 3QB9A 1S3QA 1E8JA 3NP2X 3R2OA 2BW1A 4DYXA 1QGHA 4M33A 3UNOA 3RE7A 2ZURX 5LG8A 3Q4RA 2IU2A 1VEIA 2UX1A 4TOBA 1TKOA 3AJQA 1S30A 2YJKA 1T9QA 4YWLA 4Z5SA 4ZKWA 2FFXJ 4MJYA 4M32A 4TOFA 4II4B 5E2DA 1BE7A 1T9OA 6RXNA 2Z6MA 5FFDA 1YK5A 3RAVA 7RXNA 3Q4NA 4MKUA 3KWOA 4DZ0A 1YUZA 4IXKA 3T9JA 4K9FA 2GYDA 1H96A 2GYQA 4ZL5A 3PZAA 2ZA8A 5CMQA 2G4HA 3BVKA 4TOEA 5GN8B 3ERZA 1LKOA 2IY4A 1IU5A 4MUDA 3SHXA 2ZG7X 1R0IA 3O7RA 3OGHA 5FFEA 2Z5PA 2F7NA 5JKMA 2GMGA 2FHAA 1JI4A 4ETRA 4LPMA 3BVFA 1NF4A 5HQOA 5JKLG 3QZ3A 1S2ZA 4LQHA 5ERKA 1MOJA 1IESA 3H7GA 2KKDA 1F30A 2D5KA 3F38A 4MN9A 4DYZA 2V2IA 2FL0A 5J8SA 4AR3A 1JGCA 1N1QA 3VNXA 3HL1A 5FFCA 2PVXA 4IWJA 4ZMCA 4EVCA 1SQ3A 5HJFA 3SS2A 5GOUA 4CVSA 2C41A 2QL0A 4ISMA 5D8RA 1BCFA 4DYYA 4MY7A 3EGMA 1JI5A 3E1MA 2CEIA 3RZ6A 3NOZX 1TJOA 3PWQA 4CMYV 1L8IA 1SOFA 2XGWA 5GU0X 2C6RA 2CHIA 2ZG9X 4LYUA 4A25A 1SMUA 5JKLA 2MS3A 2Y3QA 4POFA 3AJOA 1OTKA 1UVHA 2XJMA 3KA6A 3E1OA 3ES3A 4YWMA 2M4YA 3RYGA 1ZUJA 1RCEA 4RC8A 3F39A 3IQ1A 3A44A 4AR5A 1T9PA 5JACA 1QYBA 3HIUA 1BFYA 2YJJA 2FG8A 2XKQA 5D8PA 5AI3A 4M35A 4ERUA 4CYBA 4KVQA 4DASA 1VJXA 1LKMA 3AF9X 1RWDA 2V2MA 2V2PA 4ITWA 2Z5RA 2ZA6A 1Z4AA 5LS9A 3IS7A 4LPNA 3PWFA 4TODA 4E6KA 2OC5A 1BQ9A 4CVRA 1RCGA 5CZUA 3FSEA 3PW8C 3EZUA 1HRSA 3KYXA 3KA4A 2XJOA 3Q4OA 4TW3A 4RC5A 5D8XA 4LQNA 1QCVA 1VELA 2VL6A 3KA3A 1BG7A 1DPSA 1SMWA 1GWGA 3AF7X 1B71A 2CHPA 3BVEA 3RD0A 2CIHA 1ZRPA 3GHQA 2ZG8X 5D8OA 3R2HA 3WVWA 4RC6A 4LQJA 4DI0A 4XGSA 2GS4A 3F36A 4TO9A 3E6RA 4CMYA 1BQ8A 2W0OA 2V3BB 2Z90A 3E2CA 2V2SA 1DVBA 4TOAA 4PGIA 1O9RA 2RBDA 4RC5B 1B2OA 2K2DA 2VXIA 3KYUA 1LTLA 3BKNA 3F37A 1RDGA 1JKVA 2ITBA 5D8SA 3GE4A 3R2RA 1VCXA 5E1UA 1VEQA 1L8HA 3R2LA 1NFVA 3ISFA 1LKPA 5FFBA 3WNWA 2PYBA 3EZ0A 3E1LA 1CAAA 1FHHA 3R2SA 5GU2X 1IROA 3PW1A 3BVLA 3QHBA 4AM4A 1RYTA 4TOHA 3A68A 2FG4A 3R2KA 2JD80 2OH3A 5D8YA 3KA9A 1LB3A 4XKUA 2DSXA 1AEWA 4TOCA 4CVTA 1H7VA 4TPUA 1JYBA 2FJCA 1EUMA 4AM2A 1B13A 3E1QA 3PVRA 3AJPA 3E1JA 3PVTA 5GU1X 3PW1B 4DYUA 5FFAA 4AR4A 5J93A 2PVEA 4XKTA 2PYAA 4ML5A 4U3GA 5ERJA 2CF7A 4DE6A 3WVUA 2XJNA 3E1PA 1ZS3A 4KVSA 4IWKA 4EVEA 2QQYA 3SE1A 2FZFA 2IB0A 3KYVA 1R0FA 3UOIA 2C2JA 4RXNA 4AR6A 5IX6A 1NF6A 3O7SA 1YV1A 2VXXA 1J30A 3NP0X 1Z6OA 2JD70 1JIGA 1FHAA 2FKZA 3SIDA 1JKUA 3U90A 1R0GA 1R03A 3PVTB 4M34A 2X170 4REUA 5LBHA 2VZBA 2V2OA 1YK4A 3OJ5A 2V2RA 3IS8A 3F35A 2BJYA 1SMMA 3KYWA 1IERA 4Y08A 3AK8A
chains in the Genus database with same CATH superfamily
2WAQP 1IW7D 4A3BL 4MXPA 3B0AB 4PG1A 4Z3BA 2AQCA 3GTKL 2CN6A 4TOGA 5GN8A 5J8WA 1Y1WL 1RYQA 3PW8A 2CR8A 2CLBA 1QQTA 4POGA 4P18A 1TWHL 4ME3A 1YUXA 5JKMG 2V2LA 3F33A 3S16L 4E6YA 4EVBA 1RCDA 1BFRA 1R0JA 3PVYA 4ZTTA 3PO3L 3BT5A 3KX9A 5AI2A 5H1Sc 1VLGA 2Z5QA 1RDVA 3RZTA 4AHWA 2R7ZL 1XZ3A 4ZKXA 3ISEA 4CY9A 2ZA7A 2XJTA 3QD8A 3SH6A 1PFVA 3CQZL 5RXNA 3GTOL 2V0FA 4ZL6A 3Q4QA 1B2JA 2XJSA 1R0HA 4CYAA 3WVVA 3JZ9A 3HOVL 4PG0A 1IRNA 2RDVA 3I4NL 3MPSA 1RCIA 5CMRA 4WFN1 1IU6A 5GU3X 3MQKB 2CLUA 1BRFA 2BKCA 4ISPA 1CADA 1XZ1A 5K53A 5AXSA 4RC6B 3PVYB 5C4JL 1UMNA 4AHYA 3LKDA 3HAXC 2KN9A 1TWAL 5J9VA 2YW7A 4XKSA 1F33A 3GTGL 5HJHA 1TWGL 4KVRA 1PZXA 4LPJA 4LYXA 3VVAA 2V2NA 2YW6A 2R92L 1DX8A 1TK6A 2N02A 2E2HL 4GS7D 1S24A 5IYBL 4X6AL 5I4JA 3A9QA 5EIOC 3QVDA 2ERSA 4RC7A 2V8UA 4X0JA 2CN7A 2WLUA 2HTNA 5GADc 2BK6A 1TWFL 2HR5A 3RGDA 3HJYB 4QUWA 4R42A 3S1ML 2XJRA 4BBRL 3LWOB 5D8QA 3RZDL 3R2MA 3FVBA 3MSUA 1KRQA 8RXNA 2JI1A 2C2UA 2L0ZA 2WLAA 3HKZP 3KA8A 3TA8A 3PWQC 3FRRA 3HOWL 3L0MA 3RBCA 2JD60 4ZJKA 4TVMA 2QF9A 2WTLA 2V2JA 3AK9A 3F34A 3HOUL 5FEJA 5K52A 1Z92B 4JAEA 3GVYA 5LG2A 3H99A 4YKHA 2V15A 1JTSA 2LCQA 2PMZP 5C6FA 3HOXL 4RC7B 3AF8X 3HOYL 1DATA 3H9BA 3J7Z1 4EVDA 3LWPB 3ZG6A 3LPEB 4AM5A 1C09A 5IY0A 4ITTA 5HU6D 4OYNA 1FHMA 3E6SA 5MF6A 3QHCA 4ZKHA 2A69D 4LQVA 3KYYA 4PGKA 2NVYL 3KXUA 1RCCA 3E1NA 1MFRA 3FI6A 2AUSB 1JREA 3PVRB 1Z6OM 3BVIA 2BE5D 4ZLWA 5AN9H 1TKPA 4CVPA 5GAGc 3LNLA 1O9IA 4II4A 4JADA 2YU9L 3S14L 1NNQA 3UOFA 2Z3RB 3HJWB 2PSMC 3F32A 1RB9A 2C2FA 5C44L 4A3KL 3QB9A 1S3QA 2NVQL 1E8JA 3NP2X 3R2OA 2BW1A 4DYXA 1QGHA 5K2ME 5C4XL 3H0GL 4M33A 3UNOA 3RE7A 2M4VA 2ZURX 5LG8A 3Q4RA 3H9CA 2M6OA 5DM61 2IU2A 1VEIA 3S2DL 2UX1A 4TOBA 1TKOA 3V3KB 4C3IL 2WWXB 3K35A 3AJQA 1S30A 2YJKA 1T9QA 4YWLA 5MGNA 4Z5SA 4ZKWA 2FFXJ 4MJYA 4M32A 4AYBP 4TOFA 4II4B 5IYCL 5E2DA 2RFKB 5GAHc 1BE7A 1T9OA 6RXNA 4A3EL 4B8CD 3M4OL 2Z6MA 5FFDA 1YK5A 4AI1A 3RAVA 4BBSL 7RXNA 2E2JL 3Q4NA 4W4KB 4MKUA 1K83L 4AHZA 3KWOA 4DZ0A 1YUZA 4U671 4IXKA 3T9JA 4K9FA 2G38B 2GYDA 1H96A 3S15L 2GYQA 4ZL5A 3PZAA 2ZA8A 5CMQA 2B63L 2G4HA 3BVKA 4TOEA 5GN8B 2Y0SP 3ERZA 1LKOA 2IY4A 4KXRB 4MUDA 3SHXA 1IU5A 2JA5L 4ZN1B 2ZG7X 1R0IA 1TWCL 3O7RA 3S17L 3DBYA 3QQCE 3OGHA 5FFEA 2Z5PA 2F7NA 5JKMA 2GMGA 2FHAA 3GTQL 3JR7A 5IP9L 1JI4A 4W4LB 4ETRA 4LPMA 4LHLA 3BVFA 2CKCA 4C2M1 1NF4A 5HQOA 2A6ED 5JKLG 3C21A 3QZ3A 1VZHA 1S2ZA 4LQHA 5ERKA 1MOJA 1IESA 3H7GA 2KKDA 1F30A 2D5KA 4C3HL 2Y44A 2JI3A 3F38A 4MN9A 4DYZA 2V2IA 3P2AA 2FL0A 3M6JA 3S2HL 4A3JL 5J8SA 4G6BA 4AR3A 1JGCA 1N1QA 3VNXA 3HL1A 5FFCA 4YVZA 2PVXA 4IWJA 4ZMCA 4EVCA 3GGYA 2VUML 1SQ3A 5HJFA 3SS2A 5GOUA 2HVYC 5FJ8L 4CVSA 2C41A 2QL0A 4ISMA 5D8RA 1Y1VL 1BCFA 4DYYA 4MY7A 3GTLL 3M3YL 3EGMA 1JI5A 3E1MA 2CEIA 2APOB 3S1RL 3RZ6A 3PL5A 3NOZX 2XJQA 1TJOA 3C1ZA 3PWQA 1VZIA 4CMYV 1L8IA 2OKCA 1WCML 2JA6L 1SOFA 2XGWA 5GU0X 2C6RA 2CHIA 2ZG9X 4LYUA 4A25A 1SMUA 5JKLA 5M5XL 2MS3A 2Y3QA 4POFA 3S1NL 3AJOA 1OTKA 1UVHA 4WJG4 3NFPI 2EY4E 2XJMA 3KA6A 3E1OA 4C3JL 3LWRB 3ES3A 4YWMA 2M4YA 5JDOA 2M6PA 3RYGA 1ZUJA 4AI3A 1RCEA 4RC8A 3F39A 3IQ1A 3A44A 4LHNA 4AR5A 2V8TA 1T9PA 1NXGA 2B5ID 3KDQA 1QYBA 3HIUA 5JACA 1BFYA 2YJJA 4BXXL 2FG8A 4A3IL 2A68D 2XKQA 5D8PA 5AI3A 3P8BA 2R93L 4M35A 4ERUA 3GTPL 4CYBA 3IU3I 4KVQA 4DASA 3J7Y1 1VJXA 1LKMA 3AF9X 1RWDA 2V2MA 3I4ML 2V2PA 5EINC 4ITWA 2Z5RA 2ZA6A 1OWBA 3PIO1 1Z4AA 5LS9A 3IS7A 4LPNA 5JVG1 2A6HD 1PFUA 3PWFA 4TODA 4E6KA 2OC5A 1BQ9A 5JDOB 4CVRA 3GTML 4A3FL 1RCGA 5CZUA 3FSEA 3C23A 3PW8C 5IYDL 3EZUA 1HRSA 3KYXA 3KA4A 2XJOA 3Q4OA 4TW3A 4RC5A 5D8XA 4LQNA 1QCVA 3D19A 1VELA 2VL6A 4JAFA 1OWCA 3HOZL 3KA3A 1BG7A 1DPSA 3JZAB 1SMWA 3H3VM 1GWGA 3AF7X 1B71A 2CHPA 3BVEA 3RD0A 2JI2A 2CIHA 4A3DL 1ZRPA 3GHQA 2MGYA 2ZG8X 5D8OA 1I50L 5FLML 1I6HL 3R2HA 4Y7NL 5M3ML 3WVWA 2C6BA 4AI0A 3FRSA 4RC6A 4LQJA 2E2IL 3UFBA 4DI0A 3W54A 4XGSA 2GS4A 3F36A 4TO9A 3GGZA 2JA7L 1NXEA 2C6AA 3WWLA 3E6RA 4CMYA 1BQ8A 2W0OA 2V3BB 2Z90A 4BY7L 2J9UB 3E2CA 5M3FL 4QIWP 2V2SA 2Z3QB 1DVBA 4TOAA 4PGIA 1O9RA 5MFPA 3PKJA 5M5WL 2RBDA 5C3EL 4RC5B 3LWVB 1R9TL 1B2OA 3VV9A 2K2DA 2VXIA 3PO2L 3KYUA 1LTLA 3BKNA 3F37A 1RDGA 1JKVA 5DM71 3B08B 4YXMA 2ITBA 5D8SA 3GE4A 3R2RA 2PPTA 2V0EA 1VCXA 5E1UA 3N6OA 1VEQA 1L8HA 3R2LA 1NFVA 3ISFA 1LKPA 5FFBA 4A3CL 3WNWA 4BY1L 2PYBA 3EZ0A 3E1LA 1CAAA 3K7AL 3GTJL 1FHHA 2XJVA 3R2SA 5GU2X 1IROA 3PW1A 3BVLA 3QHBA 3FKIL 1VZGA 4AM4A 1RYTA 2AYJA 4A93L 4TOHA 1PFYA 4ZN3B 3A68A 2FG4A 3R2KA 2JD80 2OH3A 4AI2A 1PFWA 2WB1P 5D8YA 3KA9A 4A3LL 4A3ML 1LB3A 4XKUA 3S1QL 2DSXA 1AEWA 4TOCA 4CVTA 4XGHA 3PIP1 1H7VA 3KHKA 3FDJA 5MLC3 4Y52L 4YXJA 1ODHA 4TPUA 1JYBA 2FJCA 1EUMA 4AM2A 1B13A 1P7PA 3E1QA 1WJVA 3PVRA 2CKAA 5M5YL 1SFOL 3AJPA 5IP7L 3E1JA 3PVTA 5MFZA 3C1YA 5GU1X 3PW1B 4DYUA 5FFAA 4AR4A 5J93A 2PVEA 4XKTA 1F4LA 3RZOL 2PYAA 4ML5A 4U3GA 5ERJA 2CF7A 4DE6A 2ZIXA 2CWLA 3WVUA 3LWQB 2XJNA 3E1PA 1ZS3A 4KVSA 2O5JD 4IWKA 4EVEA 2QQYA 3SE1A 3WWNB 2FZFA 2IB0A 3KYVA 1R0FA 2AR0A 4UY81 3UOIA 4E40A 2C2JA 4RXNA 2XJUA 2XJPA 4JAGA 5IX6A 4AR6A 1NF6A 3H97A 5JVH1 2JA8L 3O7SA 1YV1A 2VXXA 1J30A 3NP0X 1Z6OA 2JD70 1JIGA 4A3GL 1FHAA 2FKZA 3SIDA 1JKUA 4AHXA 2NVXL 3U90A 2H12A 1R0GA 4XXBB 1R03A 3PVTB 4M34A 2X170 3PKIA 2NVTL 4REUA 5LBHA 2VZBA 1I3QL 2V2OA 1YK4A 3VPBE 3OJ5A 2V2RA 3IS8A 3F35A 2BJYA 1SMMA 3KYWA 2ERJA 1IERA 4V196 2NYDA 5GAEc 4Y08A 3AK8A
chains in the Genus database with same CATH topology
1IW7D 4MXPA 3B0AB 4PG1A 4Z3BA 2CN6A 4TOGA 5GN8A 5J8WA 1RYQA 3PW8A 2CR8A 2CLBA 4POGA 4P18A 4ME3A 1YUXA 5JKMG 2V2LA 3F33A 4E6YA 4EVBA 1RCDA 1BFRA 1R0JA 3PVYA 4ZTTA 3BT5A 3KX9A 5AI2A 5H1Sc 1VLGA 2Z5QA 1RDVA 3RZTA 4AHWA 1XZ3A 4ZKXA 3ISEA 4CY9A 2ZA7A 2XJTA 3QD8A 3SH6A 5RXNA 2V0FA 4ZL6A 3Q4QA 1B2JA 2XJSA 1R0HA 4CYAA 3WVVA 3JZ9A 4PG0A 1IRNA 2RDVA 3MPSA 1RCIA 5CMRA 4WFN1 1IU6A 5GU3X 2CLUA 1BRFA 2BKCA 4ISPA 1CADA 1XZ1A 5K53A 5AXSA 4RC6B 3PVYB 1UMNA 4AHYA 3LKDA 2KN9A 5J9VA 2YW7A 4XKSA 1F33A 5HJHA 4KVRA 4LPJA 4LYXA 3VVAA 2V2NA 2YW6A 1DX8A 1TK6A 2N02A 4GS7D 1S24A 5I4JA 3A9QA 5EIOC 3QVDA 2ERSA 4RC7A 2V8UA 4X0JA 2CN7A 2WLUA 2HTNA 5GADc 2BK6A 2HR5A 3RGDA 4QUWA 4R42A 2XJRA 5D8QA 3R2MA 3FVBA 3MSUA 1KRQA 8RXNA 2JI1A 2C2UA 2L0ZA 2WLAA 3KA8A 3TA8A 3PWQC 3FRRA 3L0MA 3RBCA 2JD60 4ZJKA 4TVMA 2QF9A 2WTLA 2V2JA 3AK9A 3F34A 5FEJA 5K52A 1Z92B 4JAEA 3GVYA 5LG2A 4YKHA 2V15A 1JTSA 2LCQA 5C6FA 4RC7B 3AF8X 1DATA 3J7Z1 4EVDA 3ZG6A 3LPEB 4AM5A 1C09A 5IY0A 4ITTA 5HU6D 4OYNA 1FHMA 3E6SA 5MF6A 3QHCA 4ZKHA 2A69D 4LQVA 3KYYA 4PGKA 3KXUA 1RCCA 3E1NA 1MFRA 3FI6A 1JREA 3PVRB 1Z6OM 3BVIA 2BE5D 4ZLWA 5AN9H 1TKPA 4CVPA 5GAGc 3LNLA 1O9IA 4II4A 4JADA 1NNQA 3UOFA 2Z3RB 2PSMC 3F32A 1RB9A 2C2FA 3QB9A 1S3QA 1E8JA 3NP2X 3R2OA 2BW1A 4DYXA 1QGHA 5K2ME 4M33A 3UNOA 3RE7A 2M4VA 2ZURX 5LG8A 3Q4RA 2M6OA 5DM61 2IU2A 1VEIA 2UX1A 4TOBA 1TKOA 3V3KB 2WWXB 3K35A 3AJQA 1S30A 2YJKA 1T9QA 4YWLA 5MGNA 4Z5SA 4ZKWA 2FFXJ 4MJYA 4M32A 4TOFA 4II4B 5E2DA 5GAHc 1BE7A 1T9OA 6RXNA 4B8CD 2Z6MA 5FFDA 1YK5A 4AI1A 3RAVA 7RXNA 3Q4NA 4W4KB 4MKUA 4AHZA 4U671 3KWOA 4DZ0A 1YUZA 4IXKA 3T9JA 4K9FA 2G38B 2GYDA 1H96A 2GYQA 4ZL5A 3PZAA 2ZA8A 5CMQA 2G4HA 3BVKA 4TOEA 5GN8B 3ERZA 1LKOA 2IY4A 4KXRB 4MUDA 3SHXA 1IU5A 4ZN1B 2ZG7X 1R0IA 3O7RA 3DBYA 3QQCE 3OGHA 5FFEA 2Z5PA 2F7NA 5JKMA 2GMGA 2FHAA 1JI4A 4W4LB 4ETRA 4LPMA 4LHLA 3BVFA 2CKCA 1NF4A 5HQOA 2A6ED 5JKLG 3C21A 3QZ3A 1VZHA 1S2ZA 4LQHA 5ERKA 1MOJA 1IESA 3H7GA 2KKDA 1F30A 2D5KA 2Y44A 2JI3A 3F38A 4MN9A 4DYZA 2V2IA 3P2AA 2FL0A 3M6JA 5J8SA 4G6BA 4AR3A 1JGCA 1N1QA 3VNXA 3HL1A 5FFCA 4YVZA 2PVXA 4IWJA 4ZMCA 4EVCA 3GGYA 1SQ3A 5HJFA 3SS2A 5GOUA 4CVSA 2C41A 2QL0A 4ISMA 5D8RA 1BCFA 4DYYA 4MY7A 3EGMA 1JI5A 3E1MA 2CEIA 3RZ6A 3NOZX 2XJQA 1TJOA 3C1ZA 3PWQA 1VZIA 4CMYV 1L8IA 2OKCA 1SOFA 2XGWA 5GU0X 2C6RA 2CHIA 2ZG9X 4LYUA 4A25A 1SMUA 5JKLA 2MS3A 2Y3QA 4POFA 3AJOA 1OTKA 1UVHA 4WJG4 3NFPI 2XJMA 3KA6A 3E1OA 3ES3A 4YWMA 2M4YA 5JDOA 2M6PA 3RYGA 1ZUJA 4AI3A 1RCEA 4RC8A 3F39A 3IQ1A 3A44A 4LHNA 4AR5A 2V8TA 1T9PA 1NXGA 2B5ID 3KDQA 1QYBA 3HIUA 5JACA 1BFYA 2YJJA 2FG8A 2A68D 2XKQA 5D8PA 5AI3A 3P8BA 4M35A 4ERUA 4CYBA 3IU3I 4KVQA 4DASA 3J7Y1 1VJXA 1LKMA 3AF9X 1RWDA 2V2MA 2V2PA 5EINC 4ITWA 2Z5RA 2ZA6A 1OWBA 3PIO1 1Z4AA 5LS9A 3IS7A 4LPNA 5JVG1 2A6HD 3PWFA 4TODA 4E6KA 2OC5A 1BQ9A 5JDOB 4CVRA 1RCGA 5CZUA 3FSEA 3C23A 3PW8C 3EZUA 1HRSA 3KYXA 3KA4A 2XJOA 3Q4OA 4TW3A 4RC5A 5D8XA 4LQNA 1QCVA 3D19A 1VELA 2VL6A 4JAFA 1OWCA 3KA3A 1BG7A 1DPSA 3JZAB 1SMWA 1GWGA 3AF7X 1B71A 2CHPA 3BVEA 3RD0A 2JI2A 2CIHA 1ZRPA 3GHQA 2MGYA 2ZG8X 5D8OA 3R2HA 3WVWA 2C6BA 4AI0A 3FRSA 4RC6A 4LQJA 3UFBA 4DI0A 3W54A 4XGSA 2GS4A 3F36A 4TO9A 3GGZA 1NXEA 2C6AA 3WWLA 3E6RA 4CMYA 1BQ8A 2W0OA 2V3BB 2Z90A 2J9UB 3E2CA 2V2SA 2Z3QB 1DVBA 4TOAA 4PGIA 1O9RA 5MFPA 3PKJA 2RBDA 4RC5B 1B2OA 3VV9A 2K2DA 2VXIA 3KYUA 1LTLA 3BKNA 3F37A 1RDGA 1JKVA 5DM71 3B08B 4YXMA 2ITBA 5D8SA 3GE4A 3R2RA 2PPTA 2V0EA 1VCXA 5E1UA 3N6OA 1VEQA 1L8HA 3R2LA 1NFVA 3ISFA 1LKPA 5FFBA 3WNWA 2PYBA 3EZ0A 3E1LA 1CAAA 1FHHA 2XJVA 3R2SA 5GU2X 1IROA 3PW1A 3BVLA 3QHBA 1VZGA 4AM4A 1RYTA 2AYJA 4TOHA 4ZN3B 3A68A 2FG4A 3R2KA 2JD80 2OH3A 4AI2A 5D8YA 3KA9A 1LB3A 4XKUA 2DSXA 1AEWA 4TOCA 4CVTA 4XGHA 3PIP1 1H7VA 3KHKA 5MLC3 4YXJA 1ODHA 4TPUA 1JYBA 2FJCA 1EUMA 4AM2A 1B13A 3E1QA 1WJVA 3PVRA 2CKAA 3AJPA 3E1JA 3PVTA 5MFZA 3C1YA 5GU1X 3PW1B 4DYUA 5FFAA 4AR4A 5J93A 2PVEA 4XKTA 2PYAA 4ML5A 4U3GA 5ERJA 2CF7A 4DE6A 2ZIXA 2CWLA 3WVUA 2XJNA 3E1PA 1ZS3A 4KVSA 2O5JD 4IWKA 4EVEA 2QQYA 3SE1A 3WWNB 2FZFA 2IB0A 3KYVA 1R0FA 2AR0A 4UY81 3UOIA 4E40A 2C2JA 4RXNA 2XJUA 2XJPA 4JAGA 5IX6A 4AR6A 1NF6A 5JVH1 3O7SA 1YV1A 2VXXA 1J30A 3NP0X 1Z6OA 2JD70 1JIGA 1FHAA 2FKZA 3SIDA 1JKUA 4AHXA 3U90A 2H12A 1R0GA 4XXBB 1R03A 3PVTB 4M34A 2X170 3PKIA 4REUA 5LBHA 2VZBA 2V2OA 1YK4A 3VPBE 3OJ5A 2V2RA 3IS8A 3F35A 2BJYA 1SMMA 3KYWA 2ERJA 1IERA 4V196 2NYDA 5GAEc 4Y08A 3AK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PG1 A;  4Z3B A;  2CN6 A;  4TOG A;  5GN8 A;  5J8W A;  3PW8 A;  2CLB A;  4POG A;  4P18 A;  4ME3 A;  1YUX A;  5JKM G;  2V2L A;  3F33 A;  4EVB A;  1RCD A;  1BFR A;  1R0J A;  3PVY A;  4ZTT A;  3BT5 A;  3KX9 A;  5AI2 A;  1VLG A;  2Z5Q A;  1RDV A;  3RZT A;  1XZ3 A;  4ZKX A;  3ISE A;  4CY9 A;  2ZA7 A;  3QD8 A;  3SH6 A;  5RXN A;  4ZL6 A;  3Q4Q A;  1B2J A;  1R0H A;  4CYA A;  3WVV A;  4PG0 A;  1IRN A;  2RDV A;  3MPS A;  1RCI A;  5CMR A;  1IU6 A;  5GU3 X;  2CLU A;  1BRF A;  2BKC A;  4ISP A;  1CAD A;  1XZ1 A;  5K53 A;  5AXS A;  4RC6 B;  3PVY B;  1UMN A;  2KN9 A;  5J9V A;  2YW7 A;  4XKS A;  1F33 A;  5HJH A;  4KVR A;  4LPJ A;  4LYX A;  2V2N A;  2YW6 A;  1DX8 A;  1TK6 A;  1S24 A;  5I4J A;  3A9Q A;  3QVD A;  4RC7 A;  2CN7 A;  2WLU A;  2HTN A;  2BK6 A;  2HR5 A;  3RGD A;  4QUW A;  4R42 A;  5D8Q A;  3R2M A;  3FVB A;  1KRQ A;  8RXN A;  2C2U A;  2WLA A;  3KA8 A;  3TA8 A;  3PWQ C;  3RBC A;  2JD6 0;  4ZJK A;  2QF9 A;  2WTL A;  2V2J A;  3AK9 A;  3F34 A;  5FEJ A;  5K52 A;  3GVY A;  5LG2 A;  4YKH A;  2V15 A;  1JTS A;  2LCQ A;  5C6F A;  4RC7 B;  3AF8 X;  1DAT A;  4EVD A;  4AM5 A;  1C09 A;  5IY0 A;  4ITT A;  4OYN A;  1FHM A;  3E6S A;  3QHC A;  4ZKH A;  4LQV A;  3KYY A;  4PGK A;  3KXU A;  1RCC A;  3E1N A;  1MFR A;  3FI6 A;  1JRE A;  3PVR B;  1Z6O M;  3BVI A;  4ZLW A;  1TKP A;  4CVP A;  1O9I A;  4II4 A;  1NNQ A;  3UOF A;  3F32 A;  1RB9 A;  2C2F A;  3QB9 A;  1S3Q A;  1E8J A;  3NP2 X;  3R2O A;  2BW1 A;  4DYX A;  1QGH A;  4M33 A;  3UNO A;  3RE7 A;  2ZUR X;  5LG8 A;  3Q4R A;  2IU2 A;  1VEI A;  2UX1 A;  4TOB A;  1TKO A;  3AJQ A;  1S30 A;  2YJK A;  1T9Q A;  4YWL A;  4Z5S A;  4ZKW A;  2FFX J;  4MJY A;  4M32 A;  4TOF A;  4II4 B;  5E2D A;  1BE7 A;  1T9O A;  6RXN A;  2Z6M A;  5FFD A;  1YK5 A;  3RAV A;  7RXN A;  3Q4N A;  4MKU A;  3KWO A;  4DZ0 A;  1YUZ A;  4IXK A;  3T9J A;  4K9F A;  2GYD A;  1H96 A;  2GYQ A;  4ZL5 A;  3PZA A;  2ZA8 A;  5CMQ A;  2G4H A;  3BVK A;  4TOE A;  5GN8 B;  3ERZ A;  1LKO A;  2IY4 A;  1IU5 A;  4MUD A;  3SHX A;  2ZG7 X;  1R0I A;  3O7R A;  3OGH A;  5FFE A;  2Z5P A;  2F7N A;  5JKM A;  2GMG A;  2FHA A;  1JI4 A;  4ETR A;  4LPM A;  3BVF A;  1NF4 A;  5HQO A;  5JKL G;  3QZ3 A;  1S2Z A;  4LQH A;  5ERK A;  1MOJ A;  1IES A;  3H7G A;  2KKD A;  1F30 A;  2D5K A;  3F38 A;  4MN9 A;  4DYZ A;  2V2I A;  2FL0 A;  5J8S A;  4AR3 A;  1JGC A;  1N1Q A;  3VNX A;  3HL1 A;  5FFC A;  2PVX A;  4IWJ A;  4ZMC A;  4EVC A;  1SQ3 A;  5HJF A;  3SS2 A;  5GOU A;  4CVS A;  2C41 A;  2QL0 A;  4ISM A;  5D8R A;  1BCF A;  4DYY A;  4MY7 A;  3EGM A;  1JI5 A;  3E1M A;  2CEI A;  3RZ6 A;  3NOZ X;  1TJO A;  3PWQ A;  4CMY V;  1L8I A;  1SOF A;  2XGW A;  5GU0 X;  2C6R A;  2CHI A;  2ZG9 X;  4LYU A;  4A25 A;  1SMU A;  5JKL A;  2MS3 A;  2Y3Q A;  4POF A;  3AJO A;  1OTK A;  1UVH A;  2XJM A;  3KA6 A;  3E1O A;  3ES3 A;  4YWM A;  2M4Y A;  3RYG A;  1ZUJ A;  1RCE A;  4RC8 A;  3F39 A;  3IQ1 A;  3A44 A;  4AR5 A;  1T9P A;  5JAC A;  1QYB A;  3HIU A;  1BFY A;  2YJJ A;  2FG8 A;  2XKQ A;  5D8P A;  5AI3 A;  4M35 A;  4ERU A;  4CYB A;  4KVQ A;  4DAS A;  1VJX A;  1LKM A;  3AF9 X;  1RWD A;  2V2M A;  2V2P A;  4ITW A;  2Z5R A;  2ZA6 A;  1Z4A A;  5LS9 A;  3IS7 A;  4LPN A;  3PWF A;  4TOD A;  4E6K A;  2OC5 A;  1BQ9 A;  4CVR A;  1RCG A;  5CZU A;  3FSE A;  3PW8 C;  3EZU A;  1HRS A;  3KYX A;  3KA4 A;  2XJO A;  3Q4O A;  4TW3 A;  4RC5 A;  5D8X A;  4LQN A;  1QCV A;  1VEL A;  2VL6 A;  3KA3 A;  1BG7 A;  1DPS A;  1SMW A;  1GWG A;  3AF7 X;  1B71 A;  2CHP A;  3BVE A;  3RD0 A;  2CIH A;  1ZRP A;  3GHQ A;  2ZG8 X;  5D8O A;  3R2H A;  3WVW A;  4RC6 A;  4LQJ A;  4DI0 A;  4XGS A;  2GS4 A;  3F36 A;  4TO9 A;  3E6R A;  4CMY A;  1BQ8 A;  2W0O A;  2V3B B;  2Z90 A;  3E2C A;  2V2S A;  1DVB A;  4TOA A;  4PGI A;  1O9R A;  2RBD A;  4RC5 B;  1B2O A;  2K2D A;  2VXI A;  3KYU A;  1LTL A;  3BKN A;  3F37 A;  1RDG A;  1JKV A;  2ITB A;  5D8S A;  3GE4 A;  3R2R A;  1VCX A;  5E1U A;  1VEQ A;  1L8H A;  3R2L A;  1NFV A;  3ISF A;  1LKP A;  5FFB A;  3WNW A;  2PYB A;  3EZ0 A;  3E1L A;  1CAA A;  1FHH A;  3R2S A;  5GU2 X;  1IRO A;  3PW1 A;  3BVL A;  3QHB A;  4AM4 A;  1RYT A;  4TOH A;  3A68 A;  2FG4 A;  3R2K A;  2JD8 0;  2OH3 A;  5D8Y A;  3KA9 A;  1LB3 A;  4XKU A;  2DSX A;  1AEW A;  4TOC A;  4CVT A;  1H7V A;  4TPU A;  1JYB A;  2FJC A;  1EUM A;  4AM2 A;  1B13 A;  3E1Q A;  3PVR A;  3AJP A;  3E1J A;  3PVT A;  5GU1 X;  3PW1 B;  4DYU A;  5FFA A;  4AR4 A;  5J93 A;  2PVE A;  4XKT A;  2PYA A;  4ML5 A;  4U3G A;  5ERJ A;  2CF7 A;  4DE6 A;  3WVU A;  2XJN A;  3E1P A;  1ZS3 A;  4KVS A;  4IWK A;  4EVE A;  2QQY A;  3SE1 A;  2FZF A;  2IB0 A;  3KYV A;  1R0F A;  3UOI A;  2C2J A;  4RXN A;  4AR6 A;  5IX6 A;  1NF6 A;  3O7S A;  1YV1 A;  2VXX A;  1J30 A;  3NP0 X;  1Z6O A;  2JD7 0;  1JIG A;  1FHA A;  2FKZ A;  3SID A;  1JKU A;  3U90 A;  1R0G A;  1R03 A;  3PVT B;  4M34 A;  2X17 0;  4REU A;  5LBH A;  2VZB A;  2V2O A;  1YK4 A;  3OJ5 A;  2V2R A;  3IS8 A;  3F35 A;  2BJY A;  1SMM A;  3KYW A;  1IER A;  4Y08 A;  3AK8 A; 
#chains in the Genus database with same CATH topology
 2WAQ P;  1IW7 D;  4A3B L;  4MXP A;  3B0A B;  4PG1 A;  4Z3B A;  2AQC A;  3GTK L;  2CN6 A;  4TOG A;  5GN8 A;  5J8W A;  1Y1W L;  1RYQ A;  3PW8 A;  2CR8 A;  2CLB A;  1QQT A;  4POG A;  4P18 A;  1TWH L;  4ME3 A;  1YUX A;  5JKM G;  2V2L A;  3F33 A;  3S16 L;  4E6Y A;  4EVB A;  1RCD A;  1BFR A;  1R0J A;  3PVY A;  4ZTT A;  3PO3 L;  3BT5 A;  3KX9 A;  5AI2 A;  5H1S c;  1VLG A;  2Z5Q A;  1RDV A;  3RZT A;  4AHW A;  2R7Z L;  1XZ3 A;  4ZKX A;  3ISE A;  4CY9 A;  2ZA7 A;  2XJT A;  3QD8 A;  3SH6 A;  1PFV A;  3CQZ L;  5RXN A;  3GTO L;  2V0F A;  4ZL6 A;  3Q4Q A;  1B2J A;  2XJS A;  1R0H A;  4CYA A;  3WVV A;  3JZ9 A;  3HOV L;  4PG0 A;  1IRN A;  2RDV A;  3I4N L;  3MPS A;  1RCI A;  5CMR A;  4WFN 1;  1IU6 A;  5GU3 X;  3MQK B;  2CLU A;  1BRF A;  2BKC A;  4ISP A;  1CAD A;  1XZ1 A;  5K53 A;  5AXS A;  4RC6 B;  3PVY B;  5C4J L;  1UMN A;  4AHY A;  3LKD A;  3HAX C;  2KN9 A;  1TWA L;  5J9V A;  2YW7 A;  4XKS A;  1F33 A;  3GTG L;  5HJH A;  1TWG L;  4KVR A;  1PZX A;  4LPJ A;  4LYX A;  3VVA A;  2V2N A;  2YW6 A;  2R92 L;  1DX8 A;  1TK6 A;  2N02 A;  2E2H L;  4GS7 D;  1S24 A;  5IYB L;  4X6A L;  5I4J A;  3A9Q A;  5EIO C;  3QVD A;  2ERS A;  4RC7 A;  2V8U A;  4X0J A;  2CN7 A;  2WLU A;  2HTN A;  5GAD c;  2BK6 A;  1TWF L;  2HR5 A;  3RGD A;  3HJY B;  4QUW A;  4R42 A;  3S1M L;  2XJR A;  4BBR L;  3LWO B;  5D8Q A;  3RZD L;  3R2M A;  3FVB A;  3MSU A;  1KRQ A;  8RXN A;  2JI1 A;  2C2U A;  2L0Z A;  2WLA A;  3HKZ P;  3KA8 A;  3TA8 A;  3PWQ C;  3FRR A;  3HOW L;  3L0M A;  3RBC A;  2JD6 0;  4ZJK A;  4TVM A;  2QF9 A;  2WTL A;  2V2J A;  3AK9 A;  3F34 A;  3HOU L;  5FEJ A;  5K52 A;  1Z92 B;  4JAE A;  3GVY A;  5LG2 A;  3H99 A;  4YKH A;  2V15 A;  1JTS A;  2LCQ A;  2PMZ P;  5C6F A;  3HOX L;  4RC7 B;  3AF8 X;  3HOY L;  1DAT A;  3H9B A;  3J7Z 1;  4EVD A;  3LWP B;  3ZG6 A;  3LPE B;  4AM5 A;  1C09 A;  5IY0 A;  4ITT A;  5HU6 D;  4OYN A;  1FHM A;  3E6S A;  5MF6 A;  3QHC A;  4ZKH A;  2A69 D;  4LQV A;  3KYY A;  4PGK A;  2NVY L;  3KXU A;  1RCC A;  3E1N A;  1MFR A;  3FI6 A;  2AUS B;  1JRE A;  3PVR B;  1Z6O M;  3BVI A;  2BE5 D;  4ZLW A;  5AN9 H;  1TKP A;  4CVP A;  5GAG c;  3LNL A;  1O9I A;  4II4 A;  4JAD A;  2YU9 L;  3S14 L;  1NNQ A;  3UOF A;  2Z3R B;  3HJW B;  2PSM C;  3F32 A;  1RB9 A;  2C2F A;  5C44 L;  4A3K L;  3QB9 A;  1S3Q A;  2NVQ L;  1E8J A;  3NP2 X;  3R2O A;  2BW1 A;  4DYX A;  1QGH A;  5K2M E;  5C4X L;  3H0G L;  4M33 A;  3UNO A;  3RE7 A;  2M4V A;  2ZUR X;  5LG8 A;  3Q4R A;  3H9C A;  2M6O A;  5DM6 1;  2IU2 A;  1VEI A;  3S2D L;  2UX1 A;  4TOB A;  1TKO A;  3V3K B;  4C3I L;  2WWX B;  3K35 A;  3AJQ A;  1S30 A;  2YJK A;  1T9Q A;  4YWL A;  5MGN A;  4Z5S A;  4ZKW A;  2FFX J;  4MJY A;  4M32 A;  4AYB P;  4TOF A;  4II4 B;  5IYC L;  5E2D A;  2RFK B;  5GAH c;  1BE7 A;  1T9O A;  6RXN A;  4A3E L;  4B8C D;  3M4O L;  2Z6M A;  5FFD A;  1YK5 A;  4AI1 A;  3RAV A;  4BBS L;  7RXN A;  2E2J L;  3Q4N A;  4W4K B;  4MKU A;  1K83 L;  4AHZ A;  3KWO A;  4DZ0 A;  1YUZ A;  4U67 1;  4IXK A;  3T9J A;  4K9F A;  2G38 B;  2GYD A;  1H96 A;  3S15 L;  2GYQ A;  4ZL5 A;  3PZA A;  2ZA8 A;  5CMQ A;  2B63 L;  2G4H A;  3BVK A;  4TOE A;  5GN8 B;  2Y0S P;  3ERZ A;  1LKO A;  2IY4 A;  4KXR B;  4MUD A;  3SHX A;  1IU5 A;  2JA5 L;  4ZN1 B;  2ZG7 X;  1R0I A;  1TWC L;  3O7R A;  3S17 L;  3DBY A;  3QQC E;  3OGH A;  5FFE A;  2Z5P A;  2F7N A;  5JKM A;  2GMG A;  2FHA A;  3GTQ L;  3JR7 A;  5IP9 L;  1JI4 A;  4W4L B;  4ETR A;  4LPM A;  4LHL A;  3BVF A;  2CKC A;  4C2M 1;  1NF4 A;  5HQO A;  2A6E D;  5JKL G;  3C21 A;  3QZ3 A;  1VZH A;  1S2Z A;  4LQH A;  5ERK A;  1MOJ A;  1IES A;  3H7G A;  2KKD A;  1F30 A;  2D5K A;  4C3H L;  2Y44 A;  2JI3 A;  3F38 A;  4MN9 A;  4DYZ A;  2V2I A;  3P2A A;  2FL0 A;  3M6J A;  3S2H L;  4A3J L;  5J8S A;  4G6B A;  4AR3 A;  1JGC A;  1N1Q A;  3VNX A;  3HL1 A;  5FFC A;  4YVZ A;  2PVX A;  4IWJ A;  4ZMC A;  4EVC A;  3GGY A;  2VUM L;  1SQ3 A;  5HJF A;  3SS2 A;  5GOU A;  2HVY C;  5FJ8 L;  4CVS A;  2C41 A;  2QL0 A;  4ISM A;  5D8R A;  1Y1V L;  1BCF A;  4DYY A;  4MY7 A;  3GTL L;  3M3Y L;  3EGM A;  1JI5 A;  3E1M A;  2CEI A;  2APO B;  3S1R L;  3RZ6 A;  3PL5 A;  3NOZ X;  2XJQ A;  1TJO A;  3C1Z A;  3PWQ A;  1VZI A;  4CMY V;  1L8I A;  2OKC A;  1WCM L;  2JA6 L;  1SOF A;  2XGW A;  5GU0 X;  2C6R A;  2CHI A;  2ZG9 X;  4LYU A;  4A25 A;  1SMU A;  5JKL A;  5M5X L;  2MS3 A;  2Y3Q A;  4POF A;  3S1N L;  3AJO A;  1OTK A;  1UVH A;  4WJG 4;  3NFP I;  2EY4 E;  2XJM A;  3KA6 A;  3E1O A;  4C3J L;  3LWR B;  3ES3 A;  4YWM A;  2M4Y A;  5JDO A;  2M6P A;  3RYG A;  1ZUJ A;  4AI3 A;  1RCE A;  4RC8 A;  3F39 A;  3IQ1 A;  3A44 A;  4LHN A;  4AR5 A;  2V8T A;  1T9P A;  1NXG A;  2B5I D;  3KDQ A;  1QYB A;  3HIU A;  5JAC A;  1BFY A;  2YJJ A;  4BXX L;  2FG8 A;  4A3I L;  2A68 D;  2XKQ A;  5D8P A;  5AI3 A;  3P8B A;  2R93 L;  4M35 A;  4ERU A;  3GTP L;  4CYB A;  3IU3 I;  4KVQ A;  4DAS A;  3J7Y 1;  1VJX A;  1LKM A;  3AF9 X;  1RWD A;  2V2M A;  3I4M L;  2V2P A;  5EIN C;  4ITW A;  2Z5R A;  2ZA6 A;  1OWB A;  3PIO 1;  1Z4A A;  5LS9 A;  3IS7 A;  4LPN A;  5JVG 1;  2A6H D;  1PFU A;  3PWF A;  4TOD A;  4E6K A;  2OC5 A;  1BQ9 A;  5JDO B;  4CVR A;  3GTM L;  4A3F L;  1RCG A;  5CZU A;  3FSE A;  3C23 A;  3PW8 C;  5IYD L;  3EZU A;  1HRS A;  3KYX A;  3KA4 A;  2XJO A;  3Q4O A;  4TW3 A;  4RC5 A;  5D8X A;  4LQN A;  1QCV A;  3D19 A;  1VEL A;  2VL6 A;  4JAF A;  1OWC A;  3HOZ L;  3KA3 A;  1BG7 A;  1DPS A;  3JZA B;  1SMW A;  3H3V M;  1GWG A;  3AF7 X;  1B71 A;  2CHP A;  3BVE A;  3RD0 A;  2JI2 A;  2CIH A;  4A3D L;  1ZRP A;  3GHQ A;  2MGY A;  2ZG8 X;  5D8O A;  1I50 L;  5FLM L;  1I6H L;  3R2H A;  4Y7N L;  5M3M L;  3WVW A;  2C6B A;  4AI0 A;  3FRS A;  4RC6 A;  4LQJ A;  2E2I L;  3UFB A;  4DI0 A;  3W54 A;  4XGS A;  2GS4 A;  3F36 A;  4TO9 A;  3GGZ A;  2JA7 L;  1NXE A;  2C6A A;  3WWL A;  3E6R A;  4CMY A;  1BQ8 A;  2W0O A;  2V3B B;  2Z90 A;  4BY7 L;  2J9U B;  3E2C A;  5M3F L;  4QIW P;  2V2S A;  2Z3Q B;  1DVB A;  4TOA A;  4PGI A;  1O9R A;  5MFP A;  3PKJ A;  5M5W L;  2RBD A;  5C3E L;  4RC5 B;  3LWV B;  1R9T L;  1B2O A;  3VV9 A;  2K2D A;  2VXI A;  3PO2 L;  3KYU A;  1LTL A;  3BKN A;  3F37 A;  1RDG A;  1JKV A;  5DM7 1;  3B08 B;  4YXM A;  2ITB A;  5D8S A;  3GE4 A;  3R2R A;  2PPT A;  2V0E A;  1VCX A;  5E1U A;  3N6O A;  1VEQ A;  1L8H A;  3R2L A;  1NFV A;  3ISF A;  1LKP A;  5FFB A;  4A3C L;  3WNW A;  4BY1 L;  2PYB A;  3EZ0 A;  3E1L A;  1CAA A;  3K7A L;  3GTJ L;  1FHH A;  2XJV A;  3R2S A;  5GU2 X;  1IRO A;  3PW1 A;  3BVL A;  3QHB A;  3FKI L;  1VZG A;  4AM4 A;  1RYT A;  2AYJ A;  4A93 L;  4TOH A;  1PFY A;  4ZN3 B;  3A68 A;  2FG4 A;  3R2K A;  2JD8 0;  2OH3 A;  4AI2 A;  1PFW A;  2WB1 P;  5D8Y A;  3KA9 A;  4A3L L;  4A3M L;  1LB3 A;  4XKU A;  3S1Q L;  2DSX A;  1AEW A;  4TOC A;  4CVT A;  4XGH A;  3PIP 1;  1H7V A;  3KHK A;  3FDJ A;  5MLC 3;  4Y52 L;  4YXJ A;  1ODH A;  4TPU A;  1JYB A;  2FJC A;  1EUM A;  4AM2 A;  1B13 A;  1P7P A;  3E1Q A;  1WJV A;  3PVR A;  2CKA A;  5M5Y L;  1SFO L;  3AJP A;  5IP7 L;  3E1J A;  3PVT A;  5MFZ A;  3C1Y A;  5GU1 X;  3PW1 B;  4DYU A;  5FFA A;  4AR4 A;  5J93 A;  2PVE A;  4XKT A;  1F4L A;  3RZO L;  2PYA A;  4ML5 A;  4U3G A;  5ERJ A;  2CF7 A;  4DE6 A;  2ZIX A;  2CWL A;  3WVU A;  3LWQ B;  2XJN A;  3E1P A;  1ZS3 A;  4KVS A;  2O5J D;  4IWK A;  4EVE A;  2QQY A;  3SE1 A;  3WWN B;  2FZF A;  2IB0 A;  3KYV A;  1R0F A;  2AR0 A;  4UY8 1;  3UOI A;  4E40 A;  2C2J A;  4RXN A;  2XJU A;  2XJP A;  4JAG A;  5IX6 A;  4AR6 A;  1NF6 A;  3H97 A;  5JVH 1;  2JA8 L;  3O7S A;  1YV1 A;  2VXX A;  1J30 A;  3NP0 X;  1Z6O A;  2JD7 0;  1JIG A;  4A3G L;  1FHA A;  2FKZ A;  3SID A;  1JKU A;  4AHX A;  2NVX L;  3U90 A;  2H12 A;  1R0G A;  4XXB B;  1R03 A;  3PVT B;  4M34 A;  2X17 0;  3PKI A;  2NVT L;  4REU A;  5LBH A;  2VZB A;  1I3Q L;  2V2O A;  1YK4 A;  3VPB E;  3OJ5 A;  2V2R A;  3IS8 A;  3F35 A;  2BJY A;  1SMM A;  3KYW A;  2ERJ A;  1IER A;  4V19 6;  2NYD A;  5GAE c;  4Y08 A;  3AK8 A; 
#chains in the Genus database with same CATH homology
 1IW7 D;  4MXP A;  3B0A B;  4PG1 A;  4Z3B A;  2CN6 A;  4TOG A;  5GN8 A;  5J8W A;  1RYQ A;  3PW8 A;  2CR8 A;  2CLB A;  4POG A;  4P18 A;  4ME3 A;  1YUX A;  5JKM G;  2V2L A;  3F33 A;  4E6Y A;  4EVB A;  1RCD A;  1BFR A;  1R0J A;  3PVY A;  4ZTT A;  3BT5 A;  3KX9 A;  5AI2 A;  5H1S c;  1VLG A;  2Z5Q A;  1RDV A;  3RZT A;  4AHW A;  1XZ3 A;  4ZKX A;  3ISE A;  4CY9 A;  2ZA7 A;  2XJT A;  3QD8 A;  3SH6 A;  5RXN A;  2V0F A;  4ZL6 A;  3Q4Q A;  1B2J A;  2XJS A;  1R0H A;  4CYA A;  3WVV A;  3JZ9 A;  4PG0 A;  1IRN A;  2RDV A;  3MPS A;  1RCI A;  5CMR A;  4WFN 1;  1IU6 A;  5GU3 X;  2CLU A;  1BRF A;  2BKC A;  4ISP A;  1CAD A;  1XZ1 A;  5K53 A;  5AXS A;  4RC6 B;  3PVY B;  1UMN A;  4AHY A;  3LKD A;  2KN9 A;  5J9V A;  2YW7 A;  4XKS A;  1F33 A;  5HJH A;  4KVR A;  4LPJ A;  4LYX A;  3VVA A;  2V2N A;  2YW6 A;  1DX8 A;  1TK6 A;  2N02 A;  4GS7 D;  1S24 A;  5I4J A;  3A9Q A;  5EIO C;  3QVD A;  2ERS A;  4RC7 A;  2V8U A;  4X0J A;  2CN7 A;  2WLU A;  2HTN A;  5GAD c;  2BK6 A;  2HR5 A;  3RGD A;  4QUW A;  4R42 A;  2XJR A;  5D8Q A;  3R2M A;  3FVB A;  3MSU A;  1KRQ A;  8RXN A;  2JI1 A;  2C2U A;  2L0Z A;  2WLA A;  3KA8 A;  3TA8 A;  3PWQ C;  3FRR A;  3L0M A;  3RBC A;  2JD6 0;  4ZJK A;  4TVM A;  2QF9 A;  2WTL A;  2V2J A;  3AK9 A;  3F34 A;  5FEJ A;  5K52 A;  1Z92 B;  4JAE A;  3GVY A;  5LG2 A;  4YKH A;  2V15 A;  1JTS A;  2LCQ A;  5C6F A;  4RC7 B;  3AF8 X;  1DAT A;  3J7Z 1;  4EVD A;  3ZG6 A;  3LPE B;  4AM5 A;  1C09 A;  5IY0 A;  4ITT A;  5HU6 D;  4OYN A;  1FHM A;  3E6S A;  5MF6 A;  3QHC A;  4ZKH A;  2A69 D;  4LQV A;  3KYY A;  4PGK A;  3KXU A;  1RCC A;  3E1N A;  1MFR A;  3FI6 A;  1JRE A;  3PVR B;  1Z6O M;  3BVI A;  2BE5 D;  4ZLW A;  5AN9 H;  1TKP A;  4CVP A;  5GAG c;  3LNL A;  1O9I A;  4II4 A;  4JAD A;  1NNQ A;  3UOF A;  2Z3R B;  2PSM C;  3F32 A;  1RB9 A;  2C2F A;  3QB9 A;  1S3Q A;  1E8J A;  3NP2 X;  3R2O A;  2BW1 A;  4DYX A;  1QGH A;  5K2M E;  4M33 A;  3UNO A;  3RE7 A;  2M4V A;  2ZUR X;  5LG8 A;  3Q4R A;  2M6O A;  5DM6 1;  2IU2 A;  1VEI A;  2UX1 A;  4TOB A;  1TKO A;  3V3K B;  2WWX B;  3K35 A;  3AJQ A;  1S30 A;  2YJK A;  1T9Q A;  4YWL A;  5MGN A;  4Z5S A;  4ZKW A;  2FFX J;  4MJY A;  4M32 A;  4TOF A;  4II4 B;  5E2D A;  5GAH c;  1BE7 A;  1T9O A;  6RXN A;  4B8C D;  2Z6M A;  5FFD A;  1YK5 A;  4AI1 A;  3RAV A;  7RXN A;  3Q4N A;  4W4K B;  4MKU A;  4AHZ A;  4U67 1;  3KWO A;  4DZ0 A;  1YUZ A;  4IXK A;  3T9J A;  4K9F A;  2G38 B;  2GYD A;  1H96 A;  2GYQ A;  4ZL5 A;  3PZA A;  2ZA8 A;  5CMQ A;  2G4H A;  3BVK A;  4TOE A;  5GN8 B;  3ERZ A;  1LKO A;  2IY4 A;  4KXR B;  4MUD A;  3SHX A;  1IU5 A;  4ZN1 B;  2ZG7 X;  1R0I A;  3O7R A;  3DBY A;  3QQC E;  3OGH A;  5FFE A;  2Z5P A;  2F7N A;  5JKM A;  2GMG A;  2FHA A;  1JI4 A;  4W4L B;  4ETR A;  4LPM A;  4LHL A;  3BVF A;  2CKC A;  1NF4 A;  5HQO A;  2A6E D;  5JKL G;  3C21 A;  3QZ3 A;  1VZH A;  1S2Z A;  4LQH A;  5ERK A;  1MOJ A;  1IES A;  3H7G A;  2KKD A;  1F30 A;  2D5K A;  2Y44 A;  2JI3 A;  3F38 A;  4MN9 A;  4DYZ A;  2V2I A;  3P2A A;  2FL0 A;  3M6J A;  5J8S A;  4G6B A;  4AR3 A;  1JGC A;  1N1Q A;  3VNX A;  3HL1 A;  5FFC A;  4YVZ A;  2PVX A;  4IWJ A;  4ZMC A;  4EVC A;  3GGY A;  1SQ3 A;  5HJF A;  3SS2 A;  5GOU A;  4CVS A;  2C41 A;  2QL0 A;  4ISM A;  5D8R A;  1BCF A;  4DYY A;  4MY7 A;  3EGM A;  1JI5 A;  3E1M A;  2CEI A;  3RZ6 A;  3NOZ X;  2XJQ A;  1TJO A;  3C1Z A;  3PWQ A;  1VZI A;  4CMY V;  1L8I A;  2OKC A;  1SOF A;  2XGW A;  5GU0 X;  2C6R A;  2CHI A;  2ZG9 X;  4LYU A;  4A25 A;  1SMU A;  5JKL A;  2MS3 A;  2Y3Q A;  4POF A;  3AJO A;  1OTK A;  1UVH A;  4WJG 4;  3NFP I;  2XJM A;  3KA6 A;  3E1O A;  3ES3 A;  4YWM A;  2M4Y A;  5JDO A;  2M6P A;  3RYG A;  1ZUJ A;  4AI3 A;  1RCE A;  4RC8 A;  3F39 A;  3IQ1 A;  3A44 A;  4LHN A;  4AR5 A;  2V8T A;  1T9P A;  1NXG A;  2B5I D;  3KDQ A;  1QYB A;  3HIU A;  5JAC A;  1BFY A;  2YJJ A;  2FG8 A;  2A68 D;  2XKQ A;  5D8P A;  5AI3 A;  3P8B A;  4M35 A;  4ERU A;  4CYB A;  3IU3 I;  4KVQ A;  4DAS A;  3J7Y 1;  1VJX A;  1LKM A;  3AF9 X;  1RWD A;  2V2M A;  2V2P A;  5EIN C;  4ITW A;  2Z5R A;  2ZA6 A;  1OWB A;  3PIO 1;  1Z4A A;  5LS9 A;  3IS7 A;  4LPN A;  5JVG 1;  2A6H D;  3PWF A;  4TOD A;  4E6K A;  2OC5 A;  1BQ9 A;  5JDO B;  4CVR A;  1RCG A;  5CZU A;  3FSE A;  3C23 A;  3PW8 C;  3EZU A;  1HRS A;  3KYX A;  3KA4 A;  2XJO A;  3Q4O A;  4TW3 A;  4RC5 A;  5D8X A;  4LQN A;  1QCV A;  3D19 A;  1VEL A;  2VL6 A;  4JAF A;  1OWC A;  3KA3 A;  1BG7 A;  1DPS A;  3JZA B;  1SMW A;  1GWG A;  3AF7 X;  1B71 A;  2CHP A;  3BVE A;  3RD0 A;  2JI2 A;  2CIH A;  1ZRP A;  3GHQ A;  2MGY A;  2ZG8 X;  5D8O A;  3R2H A;  3WVW A;  2C6B A;  4AI0 A;  3FRS A;  4RC6 A;  4LQJ A;  3UFB A;  4DI0 A;  3W54 A;  4XGS A;  2GS4 A;  3F36 A;  4TO9 A;  3GGZ A;  1NXE A;  2C6A A;  3WWL A;  3E6R A;  4CMY A;  1BQ8 A;  2W0O A;  2V3B B;  2Z90 A;  2J9U B;  3E2C A;  2V2S A;  2Z3Q B;  1DVB A;  4TOA A;  4PGI A;  1O9R A;  5MFP A;  3PKJ A;  2RBD A;  4RC5 B;  1B2O A;  3VV9 A;  2K2D A;  2VXI A;  3KYU A;  1LTL A;  3BKN A;  3F37 A;  1RDG A;  1JKV A;  5DM7 1;  3B08 B;  4YXM A;  2ITB A;  5D8S A;  3GE4 A;  3R2R A;  2PPT A;  2V0E A;  1VCX A;  5E1U A;  3N6O A;  1VEQ A;  1L8H A;  3R2L A;  1NFV A;  3ISF A;  1LKP A;  5FFB A;  3WNW A;  2PYB A;  3EZ0 A;  3E1L A;  1CAA A;  1FHH A;  2XJV A;  3R2S A;  5GU2 X;  1IRO A;  3PW1 A;  3BVL A;  3QHB A;  1VZG A;  4AM4 A;  1RYT A;  2AYJ A;  4TOH A;  4ZN3 B;  3A68 A;  2FG4 A;  3R2K A;  2JD8 0;  2OH3 A;  4AI2 A;  5D8Y A;  3KA9 A;  1LB3 A;  4XKU A;  2DSX A;  1AEW A;  4TOC A;  4CVT A;  4XGH A;  3PIP 1;  1H7V A;  3KHK A;  5MLC 3;  4YXJ A;  1ODH A;  4TPU A;  1JYB A;  2FJC A;  1EUM A;  4AM2 A;  1B13 A;  3E1Q A;  1WJV A;  3PVR A;  2CKA A;  3AJP A;  3E1J A;  3PVT A;  5MFZ A;  3C1Y A;  5GU1 X;  3PW1 B;  4DYU A;  5FFA A;  4AR4 A;  5J93 A;  2PVE A;  4XKT A;  2PYA A;  4ML5 A;  4U3G A;  5ERJ A;  2CF7 A;  4DE6 A;  2ZIX A;  2CWL A;  3WVU A;  2XJN A;  3E1P A;  1ZS3 A;  4KVS A;  2O5J D;  4IWK A;  4EVE A;  2QQY A;  3SE1 A;  3WWN B;  2FZF A;  2IB0 A;  3KYV A;  1R0F A;  2AR0 A;  4UY8 1;  3UOI A;  4E40 A;  2C2J A;  4RXN A;  2XJU A;  2XJP A;  4JAG A;  5IX6 A;  4AR6 A;  1NF6 A;  5JVH 1;  3O7S A;  1YV1 A;  2VXX A;  1J30 A;  3NP0 X;  1Z6O A;  2JD7 0;  1JIG A;  1FHA A;  2FKZ A;  3SID A;  1JKU A;  4AHX A;  3U90 A;  2H12 A;  1R0G A;  4XXB B;  1R03 A;  3PVT B;  4M34 A;  2X17 0;  3PKI A;  4REU A;  5LBH A;  2VZB A;  2V2O A;  1YK4 A;  3VPB E;  3OJ5 A;  2V2R A;  3IS8 A;  3F35 A;  2BJY A;  1SMM A;  3KYW A;  2ERJ A;  1IER A;  4V19 6;  2NYD A;  5GAE c;  4Y08 A;  3AK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...