1YV1A

Fully reduced state of nigerythrin (all ferrous)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
202
structure length
202
Chain Sequence
MKVRAQVPTVKNATNFNMVADSKTSVGSTLENLKAAIAGETGAHAKYTAFAKAAREQGYEQIARLFEATAAAELIHIGLEYALVAEMEPGYEKPTVAAPSAYSCDLNLISGANGEIYETSDMYPAFIRKAQEEGNSKAVHVFTRAKLAESVHAERYLAAYNDIDAPDDDKFHLCPICGYIHKGEDFEKCPICFRPKDTFTAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nigerythrin
publication title High-resolution crystal structures of Desulfovibrio vulgaris (Hildenborough) nigerythrin: facile, redox-dependent iron movement, domain interface variability, and peroxidase activity in the rubrerythrins.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris
molecule tags Oxidoreductase
total genus 69
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1yv1A01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1yv1A02
4YKHA 1EUMA 4CVSA 1XZ1A 2IU2A 1JREA 2WLUA 4MN9A 3QHCA 3F37A 4PGKA 4DYXA 1N1QA 1FHHA 5J8WA 3SHXA 3O7RA 4P18A 5LG8A 4DZ0A 4RC6A 1BG7A 1R0IA 2G4HA 1UMNA 4YWMA 4QUWA 3QB9A 3AK8A 1RWDA 1FHAA 4TOHA 1YUZA 4ML5A 4TW3A 8RXNA 3PZAA 4ZJKA 4XKTA 3BVIA 5JKLG 3F34A 4TOCA 3KA6A 4TOAA 2CHIA 2IB0A 1NF6A 2LCQA 5K52A 4XKSA 1Z4AA 2QF9A 1JYBA 2HR5A 1NNQA 2YJJA 1O9IA 3MPSA 2W0OA 3AK9A 3UOIA 2KKDA 4AR6A 3E1PA 4CMYA 3QD8A 2FG8A 2XJMA 5ERJA 4LQJA 1Z6OM 4ITWA 3H7GA 3TA8A 2C2JA 4CY9A 2PVEA 4LQHA 3R2SA 3FVBA 4AR4A 3BKNA 5JKMA 3NOZX 4IWKA 4DASA 3E1MA 4TOGA 2RDVA 5GU3X 2OH3A 1JI5A 2C41A 1QYBA 2WLAA 3KXUA 1BE7A 3R2HA 2DSXA 3EZUA 2Z90A 4LPNA 4RC5A 3R2OA 3F33A 4PGIA 4RC7B 3KX9A 2UX1A 3E1LA 3E2CA 2GYDA 3KA3A 3PWQC 3F38A 1JKUA 3GVYA 4ZKWA 1S30A 3NP0X 3WVUA 2M4YA 4Y08A 1RB9A 3VNXA 1JI4A 4AM4A 5K53A 3AF7X 2ZA8A 4TOEA 4R42A 4II4A 1RYTA 4ZL6A 3EGMA 1GWGA 3E1JA 4RC6B 1E8JA 5CMQA 2JD60 2JD80 1QCVA 4POFA 3RD0A 1DVBA 1R0FA 1NF4A 2D5KA 1F33A 4PG0A 3AJPA 1VCXA 5D8SA 1TKOA 3PWQA 4U3GA 2OC5A 2CN6A 2CIHA 5GOUA 4RC7A 4XGSA 3R2MA 2V2IA 2GS4A 5FFDA 4CMYV 3EZ0A 4ETRA 1CADA 1VELA 3PVRB 2V2JA 2FHAA 4LPMA 2MS3A 3A44A 3RZ6A 2VL6A 2VZBA 4ZMCA 2GMGA 3KA9A 3Q4QA 1IRNA 2V2NA 1LB3A 2CHPA 2JD70 1YUXA 4ME3A 1NFVA 2C2UA 4LYXA 6RXNA 3R2RA 2PVXA 5C6FA 2FL0A 2VXIA 4TPUA 1DATA 4ZKHA 1B2OA 5GU2X 1KRQA 2FG4A 3WVWA 1L8IA 4CVTA 4RC5B 4ISPA 3PVRA 1VJXA 2ZG7X 2X170 4DYZA 4AM2A 3GHQA 1JGCA 3E6SA 4ITTA 3KYXA 5D8OA 1ZUJA 3PVTA 1YK4A 1RCCA 1L8HA 1ZS3A 3F36A 5JKMG 5CMRA 4E6KA 1JKVA 1S3QA 4II4B 2QL0A 2ZG8X 5LBHA 5FFBA 1R03A 1VEIA 5J8SA 3ERZA 4LQVA 2XGWA 1ZRPA 5D8RA 4CVRA 1SMWA 3PW8C 4EVDA 3T9JA 5D8PA 4M33A 3KWOA 5FEJA 5JACA 1T9PA 5LG2A 3BVFA 2ZURX 1B2JA 1BFRA 1RDVA 1Z6OA 1VLGA 3QZ3A 5AXSA 1XZ3A 3BVKA 1LKMA 4AR5A 4POGA 4TODA 4Z3BA 3F32A 3E1OA 4MY7A 3RZTA 3F35A 3OGHA 4LQNA 3U90A 2RBDA 4DYUA 3PW8A 4K9FA 5D8YA 1VEQA 3KYYA 2CEIA 4ZL5A 2BK6A 2YW6A 3KA4A 4TO9A 2QQYA 3AJQA 5ERKA 5GU0X 1J30A 1RCDA 3Q4RA 1SOFA 3RBCA 2V2LA 5CZUA 4EVCA 3ISFA 3F39A 2V2MA 3HIUA 3O7SA 4IXKA 1UVHA 2FFXJ 1DPSA 2VXXA 2CN7A 2V15A 2V2OA 2FZFA 3OJ5A 2XJNA 4ZLWA 1SQ3A 1IERA 3AF8X 4YWLA 3HL1A 3RGDA 5J93A 2Z6MA 3R2KA 3PVTB 4DI0A 5J9VA 4DYYA 3PW1A 4M34A 3BVEA 2F7NA 1RCIA 1RCGA 5GN8A 3KA8A 4CYAA 3KYVA 1TKPA 1BQ8A 2K2DA 3WVVA 1B13A 3RAVA 4TOBA 3BT5A 2YJKA 4RC8A 1CAAA 1LKOA 1AEWA 4RXNA 1IROA 2Z5PA 3Q4OA 1QGHA 5AI3A 1BQ9A 2HTNA 5FFAA 1JTSA 3IS7A 1SMMA 1IESA 5LS9A 4LPJA 3FI6A 4A25A 4ISMA 1O9RA 3FSEA 2CLUA 4XKUA 3SIDA 4DE6A 1BCFA 1T9OA 2BJYA 2Z5QA 4MKUA 4M32A 5D8QA 1R0JA 5IY0A 1TJOA 1IU6A 3KYUA 4AR3A 5JKLA 5FFEA 1S24A 5IX6A 2ITBA 5I4JA 3NP2X 4Z5SA 5E2DA 3AF9X 1JIGA 4MUDA 2XJOA 2V2PA 4EVBA 2ZA7A 2PYBA 3E6RA 5AI2A 2PYAA 1RDGA 1YK5A 2BKCA 2C2FA 4OYNA 3RE7A 1TK6A 4ERUA 3SE1A 1YV1A 3UOFA 2C6RA 5HJFA 1MFRA 2BW1A 1F30A 4EVEA 3PVYB 1B71A 3AJOA 2XKQA 3Q4NA 4KVQA 3E1NA 5HJHA 1C09A 5D8XA 3SH6A 4CVPA 1BRFA 3KYWA 1LKPA 2GYQA 3UNOA 3SS2A 5RXNA 3A68A 4TOFA 2CF7A 1FHMA 2Y3QA 1RCEA 1MOJA 4LYUA 2IY4A 1HRSA 3QHBA 4ZTTA 2V2SA 1R0HA 1S2ZA 3PW1B 4M35A 5GN8B 2FKZA 4PG1A 3E1QA 1R0GA 3ISEA 5E1UA 4REUA 2V3BB 2KN9A 2ZG9X 3RYGA 1H7VA 2V2RA 3GE4A 4ZKXA 3R2LA 1BFYA 1DX8A 3QVDA 4IWJA 3PVYA 3ES3A 4KVSA 4AM5A 1H96A 3A9QA 5FFCA 3PWFA 3IQ1A 1T9QA 4CYBA 3BVLA 4KVRA 3WNWA 2FJCA 2Z5RA 7RXNA 5HQOA 4MJYA 2YW7A 1IU5A 5GU1X 1LTLA 1SMUA 1OTKA 2WTLA 2ZA6A 3IS8A 2CLBA
chains in the Genus database with same CATH superfamily
4YKHA 1EUMA 4CVSA 3HJWB 1XZ1A 2IU2A 1JREA 2WLUA 3PIP1 1RYQA 3HAXC 4MN9A 3QHCA 3F37A 4PGKA 3S2DL 2ERSA 4DYXA 1N1QA 1FHHA 2Z3QB 5MLC3 5J8WA 2ZIXA 3SHXA 3O7RA 4P18A 2XJVA 2NVQL 5LG8A 4DZ0A 4RC6A 4AI0A 3LWPB 1BG7A 1R0IA 3VV9A 2G4HA 1UMNA 4YWMA 4QUWA 3QB9A 5EINC 3AK8A 3PO2L 2BE5D 1RWDA 3HOXL 2AUSB 3S16L 4A3FL 1FHAA 4TOHA 3RZOL 1YUZA 4ML5A 4TW3A 3GTQL 8RXNA 4WJG4 2H12A 3PZAA 4ZJKA 4XKTA 3BVIA 5JKLG 4MXPA 1VZGA 3F34A 4TOCA 3KA6A 4TOAA 2CHIA 1WCML 4Y7NL 3PIO1 4Y52L 2IB0A 1NF6A 2LCQA 2R92L 5K52A 4XKSA 1Z4AA 2QF9A 1JYBA 2HR5A 1NNQA 2YJJA 4KXRB 1O9IA 3MPSA 3GTPL 3FRSA 5JDOB 2V0EA 2W0OA 2B5ID 3AK9A 4JAGA 1OWCA 3UOIA 2CKCA 1PZXA 3PL5A 2KKDA 4AR6A 3E1PA 2PMZP 4CMYA 3QD8A 2FG8A 2XJMA 5ERJA 3DBYA 1F4LA 4QIWP 4LQJA 3HKZP 4TVMA 1Z6OM 4ITWA 3H7GA 3TA8A 2WAQP 2C2JA 4CY9A 3S1ML 3JZ9A 2PVEA 4LQHA 2ERJA 3R2SA 2JI1A 3FVBA 3M6JA 4BBRL 5IP7L 4AR4A 3BKNA 3N6OA 3GGYA 5JKMA 1TWCL 2OKCA 1Y1WL 3NOZX 4IWKA 4DASA 1I50L 3E1MA 4TOGA 2RDVA 3PKIA 2NVXL 5GU3X 2Y44A 2CKAA 2OH3A 3S2HL 1JI5A 4B8CD 2C41A 4ZN3B 1QYBA 2HVYC 2WLAA 3LPEB 5M3FL 3KXUA 1BE7A 3R2HA 1PFYA 2DSXA 2M4VA 5IP9L 3EZUA 2Z90A 4LPNA 4RC5A 3R2OA 4X0JA 3F33A 4PGIA 4RC7B 2L0ZA 4C3IL 3KX9A 4XXBB 2UX1A 3E1LA 3E2CA 2GYDA 3KA3A 3PWQC 3F38A 1IW7D 4A93L 1JKUA 3GVYA 4ZKWA 1S30A 3NP0X 3WVUA 5MGNA 2M4YA 4Y08A 1RB9A 2AR0A 3GTJL 3VNXA 1JI4A 5C3EL 4AM4A 5K53A 3PKJA 3AF7X 2G38B 2ZA8A 1PFWA 4TOEA 4R42A 2E2JL 4II4A 1RYTA 4ZL6A 3EGMA 1GWGA 3E1JA 4RC6B 4E40A 2XJRA 1E8JA 5CMQA 3B08B 2JD60 2M6OA 4A3ML 2JD80 1QCVA 4POFA 4W4KB 3RD0A 2M6PA 1DVBA 1R0FA 4A3IL 1NF4A 2D5KA 1F33A 3H99A 2C6BA 4PG0A 3AJPA 1VCXA 5D8SA 1TKOA 3PWQA 1ODHA 4U3GA 2OC5A 3KHKA 2YU9L 2CN6A 2CIHA 4A3GL 2PPTA 5GOUA 4RC7A 1TWHL 4XGSA 4JAFA 5HU6D 3C1YA 1P7PA 3GTML 3R2MA 2V2IA 2GS4A 5FFDA 4CMYV 3EZ0A 5C44L 4ETRA 2AQCA 3S1NL 1CADA 1VELA 3PVRB 2V2JA 5AN9H 2FHAA 4LPMA 2MS3A 4AHXA 3A44A 3RZ6A 2VL6A 3GTOL 2VZBA 3S1QL 5EIOC 5DM71 4ZMCA 2GMGA 3KA9A 3Q4QA 1IRNA 3KDQA 2A68D 2V2NA 1LB3A 4C3HL 2CHPA 2JD70 1YUXA 4ME3A 1NFVA 2C2UA 4LYXA 6RXNA 4A3DL 3R2RA 3FKIL 4V196 2VUML 4X6AL 2PVXA 5C6FA 3K35A 2R7ZL 2V8TA 2FL0A 2VXIA 1TWAL 4TPUA 4A3BL 1DATA 4ZKHA 1B2OA 2E2HL 3H9BA 5H1Sc 5GU2X 3S15L 3GTGL 1KRQA 4BXXL 2FG4A 3WVWA 1L8IA 4CVTA 1NXEA 4RC5B 3ZG6A 4ISPA 3PVRA 1VJXA 2ZG7X 1OWBA 2X170 4DYZA 4AM2A 2XJQA 3GHQA 5C4XL 1JGCA 3E6SA 4ITTA 3KYXA 5C4JL 1K83L 5D8OA 3B0AB 1ZUJA 3PVTA 1YK4A 1RCCA 2AYJA 1L8HA 1NXGA 1ZS3A 2V8UA 3F36A 5JKMG 4LHLA 5CMRA 4E6KA 1JKVA 3WWNB 2CWLA 1S3QA 2JI2A 2N02A 4II4B 2QL0A 5GADc 2ZG8X 5LBHA 4UY81 2WB1P 5FFBA 1R03A 1VEIA 5J8SA 3ERZA 4A3KL 3S17L 4LQVA 2XGWA 1ZRPA 2V0FA 3LWQB 5D8RA 1VZHA 4CVRA 1SMWA 3PW8C 4EVDA 3T9JA 2WWXB 5D8PA 4M33A 3KWOA 5FEJA 5JACA 1T9PA 5LG2A 3BVFA 4A3CL 2ZURX 2Z3RB 3VVAA 1B2JA 1BFRA 3FRRA 1RDVA 2APOB 3NFPI 4AHYA 1Z6OA 1VLGA 3QZ3A 2Y0SP 3V3KB 5MFPA 5AXSA 2C6AA 1XZ3A 3BVKA 5GAEc 1LKMA 4AR5A 4POGA 3S14L 4TODA 4Z3BA 3F32A 3E1OA 2EY4E 4MY7A 3RZTA 3F35A 3OGHA 5IYCL 4AI3A 4LQNA 3GGZA 3U90A 5JVG1 2RBDA 4DYUA 4AI1A 3PW8A 2A69D 4K9FA 5D8YA 3HOUL 1VEQA 2A6HD 3KYYA 3GTKL 2CEIA 3LWRB 4ZL5A 4A3EL 2BK6A 2YW6A 3KA4A 4TO9A 2QQYA 1I3QL 3AJQA 5ERKA 5GU0X 1J30A 1RCDA 3Q4RA 1SOFA 3RBCA 3M4OL 4BBSL 3M3YL 4LHNA 2V2LA 1R9TL 1WJVA 4E6YA 5CZUA 5DM61 4EVCA 3ISFA 1PFVA 2XJUA 4A3JL 4BY7L 3F39A 4AHWA 2V2MA 3HIUA 3L0MA 4YVZA 3O7SA 4IXKA 1UVHA 2FFXJ 1DPSA 1TWFL 3HOYL 2VXXA 2CN7A 2V15A 2V2OA 5M3ML 2JA5L 2FZFA 3OJ5A 2XJPA 2XJNA 3K7AL 4ZLWA 1SQ3A 3C23A 5IYBL 5IYDL 1IERA 3AF8X 4YWLA 3HL1A 3RGDA 5J93A 2Z6MA 3R2KA 2J9UB 3PVTB 4DI0A 5J9VA 4DYYA 3H9CA 2A6ED 3PW1A 4M34A 3BVEA 4AYBP 4BY1L 2F7NA 2CR8A 1I6HL 1RCIA 1RCGA 5GN8A 3KA8A 4CYAA 3KYVA 2R93L 3MQKB 1TKPA 1BQ8A 2K2DA 3WVVA 5M5YL 1B13A 3RAVA 4TOBA 3FDJA 3BT5A 2YJKA 4RC8A 5K2ME 1CAAA 1LKOA 1AEWA 4RXNA 1IROA 3H3VM 2Z5PA 3Q4OA 1QGHA 5AI3A 3I4NL 1BQ9A 2HTNA 5FFAA 1JTSA 3IS7A 1SMMA 1IESA 5LS9A 1SFOL 4LPJA 3JZAB 3FI6A 5GAGc 4A25A 1VZIA 5MFZA 4ISMA 3H97A 1O9RA 3FSEA 4YXMA 2CLUA 4XKUA 3SIDA 4DE6A 1BCFA 1T9OA 1PFUA 2BJYA 2NYDA 2Z5QA 4JADA 4ZN1B 4MKUA 4M32A 4YXJA 2JA6L 5D8QA 5MF6A 3LNLA 1R0JA 5IY0A 1TJOA 1IU6A 3C21A 3P2AA 3KYUA 4AR3A 5JKLA 3LKDA 5FFEA 1S24A 5IX6A 3LWOB 2ITBA 5I4JA 2RFKB 3NP2X 3RZDL 4Z5SA 2XJTA 3QQCE 5E2DA 3AF9X 1JIGA 4MUDA 5M5XL 3S1RL 2XJOA 2V2PA 4EVBA 2ZA7A 2PYBA 3E6RA 3H0GL 5AI2A 3HJYB 2PYAA 1RDGA 1YK5A 3J7Z1 3D19A 2BKCA 2C2FA 4OYNA 3RE7A 3JR7A 2JI3A 4U671 1TK6A 2B63L 5M5WL 4GS7D 4ERUA 3PO3L 2JA7L 3SE1A 3HOVL 1YV1A 3UOFA 2NVYL 5JVH1 2C6RA 2O5JD 5HJFA 4XGHA 1MFRA 2BW1A 1F30A 4EVEA 3PVYB 1B71A 3AJOA 2XKQA 3Q4NA 4KVQA 3E1NA 5HJHA 1C09A 5D8XA 1QQTA 3SH6A 4G6BA 4CVPA 1BRFA 3WWLA 2MGYA 3KYWA 4AHZA 3I4ML 4A3LL 1LKPA 4C2M1 2GYQA 3UNOA 3J7Y1 5GAHc 2JA8L 3SS2A 5RXNA 3A68A 3UFBA 4TOFA 2CF7A 1FHMA 2Y3QA 1RCEA 5FJ8L 1MOJA 3C1ZA 4LYUA 2IY4A 1HRSA 3QHBA 4ZTTA 2V2SA 1R0HA 4AI2A 5JDOA 1S2ZA 3PW1B 4M35A 3W54A 5GN8B 2FKZA 4PG1A 2E2IL 4C3JL 3E1QA 1R0GA 4W4LB 3ISEA 5E1UA 4REUA 2V3BB 2KN9A 2ZG9X 3RYGA 1Y1VL 1H7VA 3HOZL 2V2RA 1Z92B 3GE4A 4ZKXA 3R2LA 1BFYA 1DX8A 2NVTL 3QVDA 3VPBE 4IWJA 3P8BA 3PVYA 3ES3A 5FLML 4KVSA 3HOWL 4AM5A 2PSMC 1H96A 3A9QA 5FFCA 3PWFA 3CQZL 3IQ1A 1T9QA 4CYBA 4JAEA 4WFN1 3BVLA 4KVRA 3WNWA 3GTLL 2FJCA 3LWVB 2Z5RA 7RXNA 5HQOA 4MJYA 2YW7A 3IU3I 1IU5A 2XJSA 3MSUA 1TWGL 5GU1X 1LTLA 1SMUA 1OTKA 2WTLA 2ZA6A 3IS8A 2CLBA
chains in the Genus database with same CATH topology
4YKHA 1EUMA 4CVSA 1XZ1A 2IU2A 1JREA 2WLUA 3PIP1 1RYQA 4MN9A 3QHCA 3F37A 4PGKA 2ERSA 4DYXA 1N1QA 1FHHA 2Z3QB 5MLC3 5J8WA 2ZIXA 3SHXA 3O7RA 4P18A 2XJVA 5LG8A 4DZ0A 4RC6A 4AI0A 1BG7A 1R0IA 3VV9A 2G4HA 1UMNA 4YWMA 4QUWA 3QB9A 5EINC 3AK8A 2BE5D 1RWDA 1FHAA 4TOHA 1YUZA 4ML5A 4TW3A 8RXNA 4WJG4 2H12A 3PZAA 4ZJKA 4XKTA 3BVIA 5JKLG 4MXPA 1VZGA 3F34A 4TOCA 3KA6A 4TOAA 2CHIA 3PIO1 2IB0A 1NF6A 2LCQA 5K52A 4XKSA 1Z4AA 2QF9A 1JYBA 2HR5A 1NNQA 2YJJA 4KXRB 1O9IA 3MPSA 3FRSA 5JDOB 2V0EA 2W0OA 2B5ID 3AK9A 4JAGA 1OWCA 3UOIA 2CKCA 2KKDA 4AR6A 3E1PA 4CMYA 3QD8A 2FG8A 2XJMA 5ERJA 3DBYA 4LQJA 4TVMA 1Z6OM 4ITWA 3H7GA 3TA8A 2C2JA 4CY9A 3JZ9A 2PVEA 4LQHA 2ERJA 3R2SA 2JI1A 3FVBA 3M6JA 4AR4A 3BKNA 3N6OA 3GGYA 5JKMA 2OKCA 3NOZX 4IWKA 4DASA 3E1MA 4TOGA 2RDVA 3PKIA 5GU3X 2Y44A 2CKAA 2OH3A 1JI5A 4B8CD 2C41A 4ZN3B 1QYBA 2WLAA 3LPEB 3KXUA 1BE7A 3R2HA 2DSXA 2M4VA 3EZUA 2Z90A 4LPNA 4RC5A 3R2OA 4X0JA 3F33A 4PGIA 4RC7B 2L0ZA 3KX9A 4XXBB 2UX1A 3E1LA 3E2CA 2GYDA 3KA3A 3PWQC 3F38A 1IW7D 1JKUA 3GVYA 4ZKWA 1S30A 3NP0X 3WVUA 5MGNA 2M4YA 4Y08A 1RB9A 2AR0A 3VNXA 1JI4A 4AM4A 5K53A 3PKJA 3AF7X 2G38B 2ZA8A 4TOEA 4R42A 4II4A 1RYTA 4ZL6A 3EGMA 1GWGA 3E1JA 4RC6B 4E40A 2XJRA 1E8JA 5CMQA 3B08B 2JD60 2M6OA 2JD80 1QCVA 4POFA 4W4KB 3RD0A 2M6PA 1DVBA 1R0FA 1NF4A 2D5KA 1F33A 2C6BA 4PG0A 3AJPA 1VCXA 5D8SA 1TKOA 3PWQA 1ODHA 4U3GA 2OC5A 3KHKA 2CN6A 2CIHA 2PPTA 5GOUA 4RC7A 4XGSA 4JAFA 5HU6D 3C1YA 3R2MA 2V2IA 2GS4A 5FFDA 4CMYV 3EZ0A 4ETRA 1CADA 1VELA 3PVRB 2V2JA 5AN9H 2FHAA 4LPMA 2MS3A 4AHXA 3A44A 3RZ6A 2VL6A 2VZBA 5EIOC 5DM71 4ZMCA 2GMGA 3KA9A 3Q4QA 1IRNA 3KDQA 2A68D 2V2NA 1LB3A 2CHPA 2JD70 1YUXA 4ME3A 1NFVA 2C2UA 4LYXA 6RXNA 3R2RA 4V196 2PVXA 5C6FA 3K35A 2V8TA 2FL0A 2VXIA 4TPUA 1DATA 4ZKHA 1B2OA 5H1Sc 5GU2X 1KRQA 2FG4A 3WVWA 1L8IA 4CVTA 1NXEA 4RC5B 3ZG6A 4ISPA 3PVRA 1VJXA 2ZG7X 1OWBA 2X170 4DYZA 4AM2A 2XJQA 3GHQA 1JGCA 3E6SA 4ITTA 3KYXA 5D8OA 3B0AB 1ZUJA 3PVTA 1YK4A 1RCCA 2AYJA 1L8HA 1NXGA 1ZS3A 2V8UA 3F36A 5JKMG 4LHLA 5CMRA 4E6KA 1JKVA 3WWNB 2CWLA 1S3QA 2JI2A 2N02A 4II4B 2QL0A 5GADc 2ZG8X 5LBHA 4UY81 5FFBA 1R03A 1VEIA 5J8SA 3ERZA 4LQVA 2XGWA 1ZRPA 2V0FA 5D8RA 1VZHA 4CVRA 1SMWA 3PW8C 4EVDA 3T9JA 2WWXB 5D8PA 4M33A 3KWOA 5FEJA 5JACA 1T9PA 5LG2A 3BVFA 2ZURX 2Z3RB 3VVAA 1B2JA 1BFRA 3FRRA 1RDVA 3NFPI 4AHYA 1Z6OA 1VLGA 3QZ3A 3V3KB 5MFPA 5AXSA 2C6AA 1XZ3A 3BVKA 5GAEc 1LKMA 4AR5A 4POGA 4TODA 4Z3BA 3F32A 3E1OA 4MY7A 3RZTA 3F35A 3OGHA 4AI3A 4LQNA 3GGZA 3U90A 5JVG1 2RBDA 4DYUA 4AI1A 3PW8A 2A69D 4K9FA 5D8YA 1VEQA 2A6HD 3KYYA 2CEIA 4ZL5A 2BK6A 2YW6A 3KA4A 4TO9A 2QQYA 3AJQA 5ERKA 5GU0X 1J30A 1RCDA 3Q4RA 1SOFA 3RBCA 4LHNA 2V2LA 1WJVA 4E6YA 5CZUA 5DM61 4EVCA 3ISFA 2XJUA 3F39A 4AHWA 2V2MA 3HIUA 3L0MA 4YVZA 3O7SA 4IXKA 1UVHA 2FFXJ 1DPSA 2VXXA 2CN7A 2V15A 2V2OA 2FZFA 3OJ5A 2XJPA 2XJNA 4ZLWA 1SQ3A 3C23A 1IERA 3AF8X 4YWLA 3HL1A 3RGDA 5J93A 2Z6MA 3R2KA 2J9UB 3PVTB 4DI0A 5J9VA 4DYYA 2A6ED 3PW1A 4M34A 3BVEA 2F7NA 2CR8A 1RCIA 1RCGA 5GN8A 3KA8A 4CYAA 3KYVA 1TKPA 1BQ8A 2K2DA 3WVVA 1B13A 3RAVA 4TOBA 3BT5A 2YJKA 4RC8A 5K2ME 1CAAA 1LKOA 1AEWA 4RXNA 1IROA 2Z5PA 3Q4OA 1QGHA 5AI3A 1BQ9A 2HTNA 5FFAA 1JTSA 3IS7A 1SMMA 1IESA 5LS9A 4LPJA 3JZAB 3FI6A 5GAGc 4A25A 1VZIA 5MFZA 4ISMA 1O9RA 3FSEA 4YXMA 2CLUA 4XKUA 3SIDA 4DE6A 1BCFA 1T9OA 2NYDA 2BJYA 4JADA 2Z5QA 4ZN1B 4MKUA 4M32A 4YXJA 5D8QA 5MF6A 3LNLA 1R0JA 5IY0A 1TJOA 1IU6A 3C21A 3P2AA 3KYUA 4AR3A 5JKLA 3LKDA 5FFEA 1S24A 5IX6A 2ITBA 5I4JA 3NP2X 4Z5SA 2XJTA 3QQCE 5E2DA 3AF9X 1JIGA 4MUDA 2XJOA 2V2PA 4EVBA 2ZA7A 2PYBA 3E6RA 5AI2A 2PYAA 1RDGA 1YK5A 3J7Z1 3D19A 2BKCA 2C2FA 4OYNA 3RE7A 2JI3A 4U671 1TK6A 4GS7D 4ERUA 3SE1A 1YV1A 3UOFA 5JVH1 2C6RA 2O5JD 5HJFA 4XGHA 1MFRA 2BW1A 1F30A 4EVEA 3PVYB 1B71A 3AJOA 2XKQA 3Q4NA 4KVQA 3E1NA 5HJHA 1C09A 5D8XA 4G6BA 3SH6A 3WWLA 4CVPA 1BRFA 4AHZA 2MGYA 3KYWA 1LKPA 2GYQA 3UNOA 3J7Y1 5GAHc 3SS2A 5RXNA 3A68A 3UFBA 4TOFA 2CF7A 1FHMA 2Y3QA 1RCEA 1MOJA 3C1ZA 4LYUA 2IY4A 1HRSA 3QHBA 4ZTTA 2V2SA 1R0HA 4AI2A 5JDOA 1S2ZA 3PW1B 4M35A 3W54A 5GN8B 2FKZA 4PG1A 3E1QA 1R0GA 4W4LB 3ISEA 5E1UA 4REUA 2V3BB 2KN9A 2ZG9X 3RYGA 1H7VA 2V2RA 1Z92B 3GE4A 4ZKXA 3R2LA 1BFYA 1DX8A 3QVDA 3VPBE 4IWJA 3P8BA 3PVYA 3ES3A 4KVSA 4AM5A 2PSMC 1H96A 3A9QA 5FFCA 3PWFA 3IQ1A 1T9QA 4CYBA 4JAEA 4WFN1 3BVLA 4KVRA 3WNWA 2FJCA 2Z5RA 7RXNA 5HQOA 4MJYA 2YW7A 3IU3I 1IU5A 2XJSA 3MSUA 5GU1X 1LTLA 1SMUA 1OTKA 2WTLA 2ZA6A 3IS8A 2CLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKH A;  1EUM A;  4CVS A;  1XZ1 A;  2IU2 A;  1JRE A;  2WLU A;  4MN9 A;  3QHC A;  3F37 A;  4PGK A;  4DYX A;  1N1Q A;  1FHH A;  5J8W A;  3SHX A;  3O7R A;  4P18 A;  5LG8 A;  4DZ0 A;  4RC6 A;  1BG7 A;  1R0I A;  2G4H A;  1UMN A;  4YWM A;  4QUW A;  3QB9 A;  3AK8 A;  1RWD A;  1FHA A;  4TOH A;  1YUZ A;  4ML5 A;  4TW3 A;  8RXN A;  3PZA A;  4ZJK A;  4XKT A;  3BVI A;  5JKL G;  3F34 A;  4TOC A;  3KA6 A;  4TOA A;  2CHI A;  2IB0 A;  1NF6 A;  2LCQ A;  5K52 A;  4XKS A;  1Z4A A;  2QF9 A;  1JYB A;  2HR5 A;  1NNQ A;  2YJJ A;  1O9I A;  3MPS A;  2W0O A;  3AK9 A;  3UOI A;  2KKD A;  4AR6 A;  3E1P A;  4CMY A;  3QD8 A;  2FG8 A;  2XJM A;  5ERJ A;  4LQJ A;  1Z6O M;  4ITW A;  3H7G A;  3TA8 A;  2C2J A;  4CY9 A;  2PVE A;  4LQH A;  3R2S A;  3FVB A;  4AR4 A;  3BKN A;  5JKM A;  3NOZ X;  4IWK A;  4DAS A;  3E1M A;  4TOG A;  2RDV A;  5GU3 X;  2OH3 A;  1JI5 A;  2C41 A;  1QYB A;  2WLA A;  3KXU A;  1BE7 A;  3R2H A;  2DSX A;  3EZU A;  2Z90 A;  4LPN A;  4RC5 A;  3R2O A;  3F33 A;  4PGI A;  4RC7 B;  3KX9 A;  2UX1 A;  3E1L A;  3E2C A;  2GYD A;  3KA3 A;  3PWQ C;  3F38 A;  1JKU A;  3GVY A;  4ZKW A;  1S30 A;  3NP0 X;  3WVU A;  2M4Y A;  4Y08 A;  1RB9 A;  3VNX A;  1JI4 A;  4AM4 A;  5K53 A;  3AF7 X;  2ZA8 A;  4TOE A;  4R42 A;  4II4 A;  1RYT A;  4ZL6 A;  3EGM A;  1GWG A;  3E1J A;  4RC6 B;  1E8J A;  5CMQ A;  2JD6 0;  2JD8 0;  1QCV A;  4POF A;  3RD0 A;  1DVB A;  1R0F A;  1NF4 A;  2D5K A;  1F33 A;  4PG0 A;  3AJP A;  1VCX A;  5D8S A;  1TKO A;  3PWQ A;  4U3G A;  2OC5 A;  2CN6 A;  2CIH A;  5GOU A;  4RC7 A;  4XGS A;  3R2M A;  2V2I A;  2GS4 A;  5FFD A;  4CMY V;  3EZ0 A;  4ETR A;  1CAD A;  1VEL A;  3PVR B;  2V2J A;  2FHA A;  4LPM A;  2MS3 A;  3A44 A;  3RZ6 A;  2VL6 A;  2VZB A;  4ZMC A;  2GMG A;  3KA9 A;  3Q4Q A;  1IRN A;  2V2N A;  1LB3 A;  2CHP A;  2JD7 0;  1YUX A;  4ME3 A;  1NFV A;  2C2U A;  4LYX A;  6RXN A;  3R2R A;  2PVX A;  5C6F A;  2FL0 A;  2VXI A;  4TPU A;  1DAT A;  4ZKH A;  1B2O A;  5GU2 X;  1KRQ A;  2FG4 A;  3WVW A;  1L8I A;  4CVT A;  4RC5 B;  4ISP A;  3PVR A;  1VJX A;  2ZG7 X;  2X17 0;  4DYZ A;  4AM2 A;  3GHQ A;  1JGC A;  3E6S A;  4ITT A;  3KYX A;  5D8O A;  1ZUJ A;  3PVT A;  1YK4 A;  1RCC A;  1L8H A;  1ZS3 A;  3F36 A;  5JKM G;  5CMR A;  4E6K A;  1JKV A;  1S3Q A;  4II4 B;  2QL0 A;  2ZG8 X;  5LBH A;  5FFB A;  1R03 A;  1VEI A;  5J8S A;  3ERZ A;  4LQV A;  2XGW A;  1ZRP A;  5D8R A;  4CVR A;  1SMW A;  3PW8 C;  4EVD A;  3T9J A;  5D8P A;  4M33 A;  3KWO A;  5FEJ A;  5JAC A;  1T9P A;  5LG2 A;  3BVF A;  2ZUR X;  1B2J A;  1BFR A;  1RDV A;  1Z6O A;  1VLG A;  3QZ3 A;  5AXS A;  1XZ3 A;  3BVK A;  1LKM A;  4AR5 A;  4POG A;  4TOD A;  4Z3B A;  3F32 A;  3E1O A;  4MY7 A;  3RZT A;  3F35 A;  3OGH A;  4LQN A;  3U90 A;  2RBD A;  4DYU A;  3PW8 A;  4K9F A;  5D8Y A;  1VEQ A;  3KYY A;  2CEI A;  4ZL5 A;  2BK6 A;  2YW6 A;  3KA4 A;  4TO9 A;  2QQY A;  3AJQ A;  5ERK A;  5GU0 X;  1J30 A;  1RCD A;  3Q4R A;  1SOF A;  3RBC A;  2V2L A;  5CZU A;  4EVC A;  3ISF A;  3F39 A;  2V2M A;  3HIU A;  3O7S A;  4IXK A;  1UVH A;  2FFX J;  1DPS A;  2VXX A;  2CN7 A;  2V15 A;  2V2O A;  2FZF A;  3OJ5 A;  2XJN A;  4ZLW A;  1SQ3 A;  1IER A;  3AF8 X;  4YWL A;  3HL1 A;  3RGD A;  5J93 A;  2Z6M A;  3R2K A;  3PVT B;  4DI0 A;  5J9V A;  4DYY A;  3PW1 A;  4M34 A;  3BVE A;  2F7N A;  1RCI A;  1RCG A;  5GN8 A;  3KA8 A;  4CYA A;  3KYV A;  1TKP A;  1BQ8 A;  2K2D A;  3WVV A;  1B13 A;  3RAV A;  4TOB A;  3BT5 A;  2YJK A;  4RC8 A;  1CAA A;  1LKO A;  1AEW A;  4RXN A;  1IRO A;  2Z5P A;  3Q4O A;  1QGH A;  5AI3 A;  1BQ9 A;  2HTN A;  5FFA A;  1JTS A;  3IS7 A;  1SMM A;  1IES A;  5LS9 A;  4LPJ A;  3FI6 A;  4A25 A;  4ISM A;  1O9R A;  3FSE A;  2CLU A;  4XKU A;  3SID A;  4DE6 A;  1BCF A;  1T9O A;  2BJY A;  2Z5Q A;  4MKU A;  4M32 A;  5D8Q A;  1R0J A;  5IY0 A;  1TJO A;  1IU6 A;  3KYU A;  4AR3 A;  5JKL A;  5FFE A;  1S24 A;  5IX6 A;  2ITB A;  5I4J A;  3NP2 X;  4Z5S A;  5E2D A;  3AF9 X;  1JIG A;  4MUD A;  2XJO A;  2V2P A;  4EVB A;  2ZA7 A;  2PYB A;  3E6R A;  5AI2 A;  2PYA A;  1RDG A;  1YK5 A;  2BKC A;  2C2F A;  4OYN A;  3RE7 A;  1TK6 A;  4ERU A;  3SE1 A;  1YV1 A;  3UOF A;  2C6R A;  5HJF A;  1MFR A;  2BW1 A;  1F30 A;  4EVE A;  3PVY B;  1B71 A;  3AJO A;  2XKQ A;  3Q4N A;  4KVQ A;  3E1N A;  5HJH A;  1C09 A;  5D8X A;  3SH6 A;  4CVP A;  1BRF A;  3KYW A;  1LKP A;  2GYQ A;  3UNO A;  3SS2 A;  5RXN A;  3A68 A;  4TOF A;  2CF7 A;  1FHM A;  2Y3Q A;  1RCE A;  1MOJ A;  4LYU A;  2IY4 A;  1HRS A;  3QHB A;  4ZTT A;  2V2S A;  1R0H A;  1S2Z A;  3PW1 B;  4M35 A;  5GN8 B;  2FKZ A;  4PG1 A;  3E1Q A;  1R0G A;  3ISE A;  5E1U A;  4REU A;  2V3B B;  2KN9 A;  2ZG9 X;  3RYG A;  1H7V A;  2V2R A;  3GE4 A;  4ZKX A;  3R2L A;  1BFY A;  1DX8 A;  3QVD A;  4IWJ A;  3PVY A;  3ES3 A;  4KVS A;  4AM5 A;  1H96 A;  3A9Q A;  5FFC A;  3PWF A;  3IQ1 A;  1T9Q A;  4CYB A;  3BVL A;  4KVR A;  3WNW A;  2FJC A;  2Z5R A;  7RXN A;  5HQO A;  4MJY A;  2YW7 A;  1IU5 A;  5GU1 X;  1LTL A;  1SMU A;  1OTK A;  2WTL A;  2ZA6 A;  3IS8 A;  2CLB A; 
#chains in the Genus database with same CATH topology
 4YKH A;  1EUM A;  4CVS A;  3HJW B;  1XZ1 A;  2IU2 A;  1JRE A;  2WLU A;  3PIP 1;  1RYQ A;  3HAX C;  4MN9 A;  3QHC A;  3F37 A;  4PGK A;  3S2D L;  2ERS A;  4DYX A;  1N1Q A;  1FHH A;  2Z3Q B;  5MLC 3;  5J8W A;  2ZIX A;  3SHX A;  3O7R A;  4P18 A;  2XJV A;  2NVQ L;  5LG8 A;  4DZ0 A;  4RC6 A;  4AI0 A;  3LWP B;  1BG7 A;  1R0I A;  3VV9 A;  2G4H A;  1UMN A;  4YWM A;  4QUW A;  3QB9 A;  5EIN C;  3AK8 A;  3PO2 L;  2BE5 D;  1RWD A;  3HOX L;  2AUS B;  3S16 L;  4A3F L;  1FHA A;  4TOH A;  3RZO L;  1YUZ A;  4ML5 A;  4TW3 A;  3GTQ L;  8RXN A;  4WJG 4;  2H12 A;  3PZA A;  4ZJK A;  4XKT A;  3BVI A;  5JKL G;  4MXP A;  1VZG A;  3F34 A;  4TOC A;  3KA6 A;  4TOA A;  2CHI A;  1WCM L;  4Y7N L;  3PIO 1;  4Y52 L;  2IB0 A;  1NF6 A;  2LCQ A;  2R92 L;  5K52 A;  4XKS A;  1Z4A A;  2QF9 A;  1JYB A;  2HR5 A;  1NNQ A;  2YJJ A;  4KXR B;  1O9I A;  3MPS A;  3GTP L;  3FRS A;  5JDO B;  2V0E A;  2W0O A;  2B5I D;  3AK9 A;  4JAG A;  1OWC A;  3UOI A;  2CKC A;  1PZX A;  3PL5 A;  2KKD A;  4AR6 A;  3E1P A;  2PMZ P;  4CMY A;  3QD8 A;  2FG8 A;  2XJM A;  5ERJ A;  3DBY A;  1F4L A;  4QIW P;  4LQJ A;  3HKZ P;  4TVM A;  1Z6O M;  4ITW A;  3H7G A;  3TA8 A;  2WAQ P;  2C2J A;  4CY9 A;  3S1M L;  3JZ9 A;  2PVE A;  4LQH A;  2ERJ A;  3R2S A;  2JI1 A;  3FVB A;  3M6J A;  4BBR L;  5IP7 L;  4AR4 A;  3BKN A;  3N6O A;  3GGY A;  5JKM A;  1TWC L;  2OKC A;  1Y1W L;  3NOZ X;  4IWK A;  4DAS A;  1I50 L;  3E1M A;  4TOG A;  2RDV A;  3PKI A;  2NVX L;  5GU3 X;  2Y44 A;  2CKA A;  2OH3 A;  3S2H L;  1JI5 A;  4B8C D;  2C41 A;  4ZN3 B;  1QYB A;  2HVY C;  2WLA A;  3LPE B;  5M3F L;  3KXU A;  1BE7 A;  3R2H A;  1PFY A;  2DSX A;  2M4V A;  5IP9 L;  3EZU A;  2Z90 A;  4LPN A;  4RC5 A;  3R2O A;  4X0J A;  3F33 A;  4PGI A;  4RC7 B;  2L0Z A;  4C3I L;  3KX9 A;  4XXB B;  2UX1 A;  3E1L A;  3E2C A;  2GYD A;  3KA3 A;  3PWQ C;  3F38 A;  1IW7 D;  4A93 L;  1JKU A;  3GVY A;  4ZKW A;  1S30 A;  3NP0 X;  3WVU A;  5MGN A;  2M4Y A;  4Y08 A;  1RB9 A;  2AR0 A;  3GTJ L;  3VNX A;  1JI4 A;  5C3E L;  4AM4 A;  5K53 A;  3PKJ A;  3AF7 X;  2G38 B;  2ZA8 A;  1PFW A;  4TOE A;  4R42 A;  2E2J L;  4II4 A;  1RYT A;  4ZL6 A;  3EGM A;  1GWG A;  3E1J A;  4RC6 B;  4E40 A;  2XJR A;  1E8J A;  5CMQ A;  3B08 B;  2JD6 0;  2M6O A;  4A3M L;  2JD8 0;  1QCV A;  4POF A;  4W4K B;  3RD0 A;  2M6P A;  1DVB A;  1R0F A;  4A3I L;  1NF4 A;  2D5K A;  1F33 A;  3H99 A;  2C6B A;  4PG0 A;  3AJP A;  1VCX A;  5D8S A;  1TKO A;  3PWQ A;  1ODH A;  4U3G A;  2OC5 A;  3KHK A;  2YU9 L;  2CN6 A;  2CIH A;  4A3G L;  2PPT A;  5GOU A;  4RC7 A;  1TWH L;  4XGS A;  4JAF A;  5HU6 D;  3C1Y A;  1P7P A;  3GTM L;  3R2M A;  2V2I A;  2GS4 A;  5FFD A;  4CMY V;  3EZ0 A;  5C44 L;  4ETR A;  2AQC A;  3S1N L;  1CAD A;  1VEL A;  3PVR B;  2V2J A;  5AN9 H;  2FHA A;  4LPM A;  2MS3 A;  4AHX A;  3A44 A;  3RZ6 A;  2VL6 A;  3GTO L;  2VZB A;  3S1Q L;  5EIO C;  5DM7 1;  4ZMC A;  2GMG A;  3KA9 A;  3Q4Q A;  1IRN A;  3KDQ A;  2A68 D;  2V2N A;  1LB3 A;  4C3H L;  2CHP A;  2JD7 0;  1YUX A;  4ME3 A;  1NFV A;  2C2U A;  4LYX A;  6RXN A;  4A3D L;  3R2R A;  3FKI L;  4V19 6;  2VUM L;  4X6A L;  2PVX A;  5C6F A;  3K35 A;  2R7Z L;  2V8T A;  2FL0 A;  2VXI A;  1TWA L;  4TPU A;  4A3B L;  1DAT A;  4ZKH A;  1B2O A;  2E2H L;  3H9B A;  5H1S c;  5GU2 X;  3S15 L;  3GTG L;  1KRQ A;  4BXX L;  2FG4 A;  3WVW A;  1L8I A;  4CVT A;  1NXE A;  4RC5 B;  3ZG6 A;  4ISP A;  3PVR A;  1VJX A;  2ZG7 X;  1OWB A;  2X17 0;  4DYZ A;  4AM2 A;  2XJQ A;  3GHQ A;  5C4X L;  1JGC A;  3E6S A;  4ITT A;  3KYX A;  5C4J L;  1K83 L;  5D8O A;  3B0A B;  1ZUJ A;  3PVT A;  1YK4 A;  1RCC A;  2AYJ A;  1L8H A;  1NXG A;  1ZS3 A;  2V8U A;  3F36 A;  5JKM G;  4LHL A;  5CMR A;  4E6K A;  1JKV A;  3WWN B;  2CWL A;  1S3Q A;  2JI2 A;  2N02 A;  4II4 B;  2QL0 A;  5GAD c;  2ZG8 X;  5LBH A;  4UY8 1;  2WB1 P;  5FFB A;  1R03 A;  1VEI A;  5J8S A;  3ERZ A;  4A3K L;  3S17 L;  4LQV A;  2XGW A;  1ZRP A;  2V0F A;  3LWQ B;  5D8R A;  1VZH A;  4CVR A;  1SMW A;  3PW8 C;  4EVD A;  3T9J A;  2WWX B;  5D8P A;  4M33 A;  3KWO A;  5FEJ A;  5JAC A;  1T9P A;  5LG2 A;  3BVF A;  4A3C L;  2ZUR X;  2Z3R B;  3VVA A;  1B2J A;  1BFR A;  3FRR A;  1RDV A;  2APO B;  3NFP I;  4AHY A;  1Z6O A;  1VLG A;  3QZ3 A;  2Y0S P;  3V3K B;  5MFP A;  5AXS A;  2C6A A;  1XZ3 A;  3BVK A;  5GAE c;  1LKM A;  4AR5 A;  4POG A;  3S14 L;  4TOD A;  4Z3B A;  3F32 A;  3E1O A;  2EY4 E;  4MY7 A;  3RZT A;  3F35 A;  3OGH A;  5IYC L;  4AI3 A;  4LQN A;  3GGZ A;  3U90 A;  5JVG 1;  2RBD A;  4DYU A;  4AI1 A;  3PW8 A;  2A69 D;  4K9F A;  5D8Y A;  3HOU L;  1VEQ A;  2A6H D;  3KYY A;  3GTK L;  2CEI A;  3LWR B;  4ZL5 A;  4A3E L;  2BK6 A;  2YW6 A;  3KA4 A;  4TO9 A;  2QQY A;  1I3Q L;  3AJQ A;  5ERK A;  5GU0 X;  1J30 A;  1RCD A;  3Q4R A;  1SOF A;  3RBC A;  3M4O L;  4BBS L;  3M3Y L;  4LHN A;  2V2L A;  1R9T L;  1WJV A;  4E6Y A;  5CZU A;  5DM6 1;  4EVC A;  3ISF A;  1PFV A;  2XJU A;  4A3J L;  4BY7 L;  3F39 A;  4AHW A;  2V2M A;  3HIU A;  3L0M A;  4YVZ A;  3O7S A;  4IXK A;  1UVH A;  2FFX J;  1DPS A;  1TWF L;  3HOY L;  2VXX A;  2CN7 A;  2V15 A;  2V2O A;  5M3M L;  2JA5 L;  2FZF A;  3OJ5 A;  2XJP A;  2XJN A;  3K7A L;  4ZLW A;  1SQ3 A;  3C23 A;  5IYB L;  5IYD L;  1IER A;  3AF8 X;  4YWL A;  3HL1 A;  3RGD A;  5J93 A;  2Z6M A;  3R2K A;  2J9U B;  3PVT B;  4DI0 A;  5J9V A;  4DYY A;  3H9C A;  2A6E D;  3PW1 A;  4M34 A;  3BVE A;  4AYB P;  4BY1 L;  2F7N A;  2CR8 A;  1I6H L;  1RCI A;  1RCG A;  5GN8 A;  3KA8 A;  4CYA A;  3KYV A;  2R93 L;  3MQK B;  1TKP A;  1BQ8 A;  2K2D A;  3WVV A;  5M5Y L;  1B13 A;  3RAV A;  4TOB A;  3FDJ A;  3BT5 A;  2YJK A;  4RC8 A;  5K2M E;  1CAA A;  1LKO A;  1AEW A;  4RXN A;  1IRO A;  3H3V M;  2Z5P A;  3Q4O A;  1QGH A;  5AI3 A;  3I4N L;  1BQ9 A;  2HTN A;  5FFA A;  1JTS A;  3IS7 A;  1SMM A;  1IES A;  5LS9 A;  1SFO L;  4LPJ A;  3JZA B;  3FI6 A;  5GAG c;  4A25 A;  1VZI A;  5MFZ A;  4ISM A;  3H97 A;  1O9R A;  3FSE A;  4YXM A;  2CLU A;  4XKU A;  3SID A;  4DE6 A;  1BCF A;  1T9O A;  1PFU A;  2BJY A;  2NYD A;  2Z5Q A;  4JAD A;  4ZN1 B;  4MKU A;  4M32 A;  4YXJ A;  2JA6 L;  5D8Q A;  5MF6 A;  3LNL A;  1R0J A;  5IY0 A;  1TJO A;  1IU6 A;  3C21 A;  3P2A A;  3KYU A;  4AR3 A;  5JKL A;  3LKD A;  5FFE A;  1S24 A;  5IX6 A;  3LWO B;  2ITB A;  5I4J A;  2RFK B;  3NP2 X;  3RZD L;  4Z5S A;  2XJT A;  3QQC E;  5E2D A;  3AF9 X;  1JIG A;  4MUD A;  5M5X L;  3S1R L;  2XJO A;  2V2P A;  4EVB A;  2ZA7 A;  2PYB A;  3E6R A;  3H0G L;  5AI2 A;  3HJY B;  2PYA A;  1RDG A;  1YK5 A;  3J7Z 1;  3D19 A;  2BKC A;  2C2F A;  4OYN A;  3RE7 A;  3JR7 A;  2JI3 A;  4U67 1;  1TK6 A;  2B63 L;  5M5W L;  4GS7 D;  4ERU A;  3PO3 L;  2JA7 L;  3SE1 A;  3HOV L;  1YV1 A;  3UOF A;  2NVY L;  5JVH 1;  2C6R A;  2O5J D;  5HJF A;  4XGH A;  1MFR A;  2BW1 A;  1F30 A;  4EVE A;  3PVY B;  1B71 A;  3AJO A;  2XKQ A;  3Q4N A;  4KVQ A;  3E1N A;  5HJH A;  1C09 A;  5D8X A;  1QQT A;  3SH6 A;  4G6B A;  4CVP A;  1BRF A;  3WWL A;  2MGY A;  3KYW A;  4AHZ A;  3I4M L;  4A3L L;  1LKP A;  4C2M 1;  2GYQ A;  3UNO A;  3J7Y 1;  5GAH c;  2JA8 L;  3SS2 A;  5RXN A;  3A68 A;  3UFB A;  4TOF A;  2CF7 A;  1FHM A;  2Y3Q A;  1RCE A;  5FJ8 L;  1MOJ A;  3C1Z A;  4LYU A;  2IY4 A;  1HRS A;  3QHB A;  4ZTT A;  2V2S A;  1R0H A;  4AI2 A;  5JDO A;  1S2Z A;  3PW1 B;  4M35 A;  3W54 A;  5GN8 B;  2FKZ A;  4PG1 A;  2E2I L;  4C3J L;  3E1Q A;  1R0G A;  4W4L B;  3ISE A;  5E1U A;  4REU A;  2V3B B;  2KN9 A;  2ZG9 X;  3RYG A;  1Y1V L;  1H7V A;  3HOZ L;  2V2R A;  1Z92 B;  3GE4 A;  4ZKX A;  3R2L A;  1BFY A;  1DX8 A;  2NVT L;  3QVD A;  3VPB E;  4IWJ A;  3P8B A;  3PVY A;  3ES3 A;  5FLM L;  4KVS A;  3HOW L;  4AM5 A;  2PSM C;  1H96 A;  3A9Q A;  5FFC A;  3PWF A;  3CQZ L;  3IQ1 A;  1T9Q A;  4CYB A;  4JAE A;  4WFN 1;  3BVL A;  4KVR A;  3WNW A;  3GTL L;  2FJC A;  3LWV B;  2Z5R A;  7RXN A;  5HQO A;  4MJY A;  2YW7 A;  3IU3 I;  1IU5 A;  2XJS A;  3MSU A;  1TWG L;  5GU1 X;  1LTL A;  1SMU A;  1OTK A;  2WTL A;  2ZA6 A;  3IS8 A;  2CLB A; 
#chains in the Genus database with same CATH homology
 4YKH A;  1EUM A;  4CVS A;  1XZ1 A;  2IU2 A;  1JRE A;  2WLU A;  3PIP 1;  1RYQ A;  4MN9 A;  3QHC A;  3F37 A;  4PGK A;  2ERS A;  4DYX A;  1N1Q A;  1FHH A;  2Z3Q B;  5MLC 3;  5J8W A;  2ZIX A;  3SHX A;  3O7R A;  4P18 A;  2XJV A;  5LG8 A;  4DZ0 A;  4RC6 A;  4AI0 A;  1BG7 A;  1R0I A;  3VV9 A;  2G4H A;  1UMN A;  4YWM A;  4QUW A;  3QB9 A;  5EIN C;  3AK8 A;  2BE5 D;  1RWD A;  1FHA A;  4TOH A;  1YUZ A;  4ML5 A;  4TW3 A;  8RXN A;  4WJG 4;  2H12 A;  3PZA A;  4ZJK A;  4XKT A;  3BVI A;  5JKL G;  4MXP A;  1VZG A;  3F34 A;  4TOC A;  3KA6 A;  4TOA A;  2CHI A;  3PIO 1;  2IB0 A;  1NF6 A;  2LCQ A;  5K52 A;  4XKS A;  1Z4A A;  2QF9 A;  1JYB A;  2HR5 A;  1NNQ A;  2YJJ A;  4KXR B;  1O9I A;  3MPS A;  3FRS A;  5JDO B;  2V0E A;  2W0O A;  2B5I D;  3AK9 A;  4JAG A;  1OWC A;  3UOI A;  2CKC A;  2KKD A;  4AR6 A;  3E1P A;  4CMY A;  3QD8 A;  2FG8 A;  2XJM A;  5ERJ A;  3DBY A;  4LQJ A;  4TVM A;  1Z6O M;  4ITW A;  3H7G A;  3TA8 A;  2C2J A;  4CY9 A;  3JZ9 A;  2PVE A;  4LQH A;  2ERJ A;  3R2S A;  2JI1 A;  3FVB A;  3M6J A;  4AR4 A;  3BKN A;  3N6O A;  3GGY A;  5JKM A;  2OKC A;  3NOZ X;  4IWK A;  4DAS A;  3E1M A;  4TOG A;  2RDV A;  3PKI A;  5GU3 X;  2Y44 A;  2CKA A;  2OH3 A;  1JI5 A;  4B8C D;  2C41 A;  4ZN3 B;  1QYB A;  2WLA A;  3LPE B;  3KXU A;  1BE7 A;  3R2H A;  2DSX A;  2M4V A;  3EZU A;  2Z90 A;  4LPN A;  4RC5 A;  3R2O A;  4X0J A;  3F33 A;  4PGI A;  4RC7 B;  2L0Z A;  3KX9 A;  4XXB B;  2UX1 A;  3E1L A;  3E2C A;  2GYD A;  3KA3 A;  3PWQ C;  3F38 A;  1IW7 D;  1JKU A;  3GVY A;  4ZKW A;  1S30 A;  3NP0 X;  3WVU A;  5MGN A;  2M4Y A;  4Y08 A;  1RB9 A;  2AR0 A;  3VNX A;  1JI4 A;  4AM4 A;  5K53 A;  3PKJ A;  3AF7 X;  2G38 B;  2ZA8 A;  4TOE A;  4R42 A;  4II4 A;  1RYT A;  4ZL6 A;  3EGM A;  1GWG A;  3E1J A;  4RC6 B;  4E40 A;  2XJR A;  1E8J A;  5CMQ A;  3B08 B;  2JD6 0;  2M6O A;  2JD8 0;  1QCV A;  4POF A;  4W4K B;  3RD0 A;  2M6P A;  1DVB A;  1R0F A;  1NF4 A;  2D5K A;  1F33 A;  2C6B A;  4PG0 A;  3AJP A;  1VCX A;  5D8S A;  1TKO A;  3PWQ A;  1ODH A;  4U3G A;  2OC5 A;  3KHK A;  2CN6 A;  2CIH A;  2PPT A;  5GOU A;  4RC7 A;  4XGS A;  4JAF A;  5HU6 D;  3C1Y A;  3R2M A;  2V2I A;  2GS4 A;  5FFD A;  4CMY V;  3EZ0 A;  4ETR A;  1CAD A;  1VEL A;  3PVR B;  2V2J A;  5AN9 H;  2FHA A;  4LPM A;  2MS3 A;  4AHX A;  3A44 A;  3RZ6 A;  2VL6 A;  2VZB A;  5EIO C;  5DM7 1;  4ZMC A;  2GMG A;  3KA9 A;  3Q4Q A;  1IRN A;  3KDQ A;  2A68 D;  2V2N A;  1LB3 A;  2CHP A;  2JD7 0;  1YUX A;  4ME3 A;  1NFV A;  2C2U A;  4LYX A;  6RXN A;  3R2R A;  4V19 6;  2PVX A;  5C6F A;  3K35 A;  2V8T A;  2FL0 A;  2VXI A;  4TPU A;  1DAT A;  4ZKH A;  1B2O A;  5H1S c;  5GU2 X;  1KRQ A;  2FG4 A;  3WVW A;  1L8I A;  4CVT A;  1NXE A;  4RC5 B;  3ZG6 A;  4ISP A;  3PVR A;  1VJX A;  2ZG7 X;  1OWB A;  2X17 0;  4DYZ A;  4AM2 A;  2XJQ A;  3GHQ A;  1JGC A;  3E6S A;  4ITT A;  3KYX A;  5D8O A;  3B0A B;  1ZUJ A;  3PVT A;  1YK4 A;  1RCC A;  2AYJ A;  1L8H A;  1NXG A;  1ZS3 A;  2V8U A;  3F36 A;  5JKM G;  4LHL A;  5CMR A;  4E6K A;  1JKV A;  3WWN B;  2CWL A;  1S3Q A;  2JI2 A;  2N02 A;  4II4 B;  2QL0 A;  5GAD c;  2ZG8 X;  5LBH A;  4UY8 1;  5FFB A;  1R03 A;  1VEI A;  5J8S A;  3ERZ A;  4LQV A;  2XGW A;  1ZRP A;  2V0F A;  5D8R A;  1VZH A;  4CVR A;  1SMW A;  3PW8 C;  4EVD A;  3T9J A;  2WWX B;  5D8P A;  4M33 A;  3KWO A;  5FEJ A;  5JAC A;  1T9P A;  5LG2 A;  3BVF A;  2ZUR X;  2Z3R B;  3VVA A;  1B2J A;  1BFR A;  3FRR A;  1RDV A;  3NFP I;  4AHY A;  1Z6O A;  1VLG A;  3QZ3 A;  3V3K B;  5MFP A;  5AXS A;  2C6A A;  1XZ3 A;  3BVK A;  5GAE c;  1LKM A;  4AR5 A;  4POG A;  4TOD A;  4Z3B A;  3F32 A;  3E1O A;  4MY7 A;  3RZT A;  3F35 A;  3OGH A;  4AI3 A;  4LQN A;  3GGZ A;  3U90 A;  5JVG 1;  2RBD A;  4DYU A;  4AI1 A;  3PW8 A;  2A69 D;  4K9F A;  5D8Y A;  1VEQ A;  2A6H D;  3KYY A;  2CEI A;  4ZL5 A;  2BK6 A;  2YW6 A;  3KA4 A;  4TO9 A;  2QQY A;  3AJQ A;  5ERK A;  5GU0 X;  1J30 A;  1RCD A;  3Q4R A;  1SOF A;  3RBC A;  4LHN A;  2V2L A;  1WJV A;  4E6Y A;  5CZU A;  5DM6 1;  4EVC A;  3ISF A;  2XJU A;  3F39 A;  4AHW A;  2V2M A;  3HIU A;  3L0M A;  4YVZ A;  3O7S A;  4IXK A;  1UVH A;  2FFX J;  1DPS A;  2VXX A;  2CN7 A;  2V15 A;  2V2O A;  2FZF A;  3OJ5 A;  2XJP A;  2XJN A;  4ZLW A;  1SQ3 A;  3C23 A;  1IER A;  3AF8 X;  4YWL A;  3HL1 A;  3RGD A;  5J93 A;  2Z6M A;  3R2K A;  2J9U B;  3PVT B;  4DI0 A;  5J9V A;  4DYY A;  2A6E D;  3PW1 A;  4M34 A;  3BVE A;  2F7N A;  2CR8 A;  1RCI A;  1RCG A;  5GN8 A;  3KA8 A;  4CYA A;  3KYV A;  1TKP A;  1BQ8 A;  2K2D A;  3WVV A;  1B13 A;  3RAV A;  4TOB A;  3BT5 A;  2YJK A;  4RC8 A;  5K2M E;  1CAA A;  1LKO A;  1AEW A;  4RXN A;  1IRO A;  2Z5P A;  3Q4O A;  1QGH A;  5AI3 A;  1BQ9 A;  2HTN A;  5FFA A;  1JTS A;  3IS7 A;  1SMM A;  1IES A;  5LS9 A;  4LPJ A;  3JZA B;  3FI6 A;  5GAG c;  4A25 A;  1VZI A;  5MFZ A;  4ISM A;  1O9R A;  3FSE A;  4YXM A;  2CLU A;  4XKU A;  3SID A;  4DE6 A;  1BCF A;  1T9O A;  2NYD A;  2BJY A;  4JAD A;  2Z5Q A;  4ZN1 B;  4MKU A;  4M32 A;  4YXJ A;  5D8Q A;  5MF6 A;  3LNL A;  1R0J A;  5IY0 A;  1TJO A;  1IU6 A;  3C21 A;  3P2A A;  3KYU A;  4AR3 A;  5JKL A;  3LKD A;  5FFE A;  1S24 A;  5IX6 A;  2ITB A;  5I4J A;  3NP2 X;  4Z5S A;  2XJT A;  3QQC E;  5E2D A;  3AF9 X;  1JIG A;  4MUD A;  2XJO A;  2V2P A;  4EVB A;  2ZA7 A;  2PYB A;  3E6R A;  5AI2 A;  2PYA A;  1RDG A;  1YK5 A;  3J7Z 1;  3D19 A;  2BKC A;  2C2F A;  4OYN A;  3RE7 A;  2JI3 A;  4U67 1;  1TK6 A;  4GS7 D;  4ERU A;  3SE1 A;  1YV1 A;  3UOF A;  5JVH 1;  2C6R A;  2O5J D;  5HJF A;  4XGH A;  1MFR A;  2BW1 A;  1F30 A;  4EVE A;  3PVY B;  1B71 A;  3AJO A;  2XKQ A;  3Q4N A;  4KVQ A;  3E1N A;  5HJH A;  1C09 A;  5D8X A;  4G6B A;  3SH6 A;  3WWL A;  4CVP A;  1BRF A;  4AHZ A;  2MGY A;  3KYW A;  1LKP A;  2GYQ A;  3UNO A;  3J7Y 1;  5GAH c;  3SS2 A;  5RXN A;  3A68 A;  3UFB A;  4TOF A;  2CF7 A;  1FHM A;  2Y3Q A;  1RCE A;  1MOJ A;  3C1Z A;  4LYU A;  2IY4 A;  1HRS A;  3QHB A;  4ZTT A;  2V2S A;  1R0H A;  4AI2 A;  5JDO A;  1S2Z A;  3PW1 B;  4M35 A;  3W54 A;  5GN8 B;  2FKZ A;  4PG1 A;  3E1Q A;  1R0G A;  4W4L B;  3ISE A;  5E1U A;  4REU A;  2V3B B;  2KN9 A;  2ZG9 X;  3RYG A;  1H7V A;  2V2R A;  1Z92 B;  3GE4 A;  4ZKX A;  3R2L A;  1BFY A;  1DX8 A;  3QVD A;  3VPB E;  4IWJ A;  3P8B A;  3PVY A;  3ES3 A;  4KVS A;  4AM5 A;  2PSM C;  1H96 A;  3A9Q A;  5FFC A;  3PWF A;  3IQ1 A;  1T9Q A;  4CYB A;  4JAE A;  4WFN 1;  3BVL A;  4KVR A;  3WNW A;  2FJC A;  2Z5R A;  7RXN A;  5HQO A;  4MJY A;  2YW7 A;  3IU3 I;  1IU5 A;  2XJS A;  3MSU A;  5GU1 X;  1LTL A;  1SMU A;  1OTK A;  2WTL A;  2ZA6 A;  3IS8 A;  2CLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...