3QHBA

Crystal structure of oxidized symerythrin from cyanophora paradoxa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
179
structure length
179
Chain Sequence
GLNYNQEDFMGLDRFFQDAVSHNNTDANAASSIEVEMYECDCMYPTFAEIARRSGQPEIGAMFDAIAKEEGMHAQLLTKLYSELEVKDSAETLEAKRLVSTIESQIDAVASDSRGLRRALETALEVETIESQKTYPAFAKLAAEQGNMEVATAFEAIVKSETKHANWVKRALENLLEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Symerythrin
publication title A diiron protein autogenerates a valine-phenylalanine cross-link.
pubmed doi rcsb
source organism Cyanophora paradoxa
total genus 81
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3qhbA00
1XZ1A 2XJMA 1RCCA 2PYBA 3WVUA 4R42A 4RC7A 3GVYA 3WNWA 2ZA7A 1TKPA 2V15A 2XKQA 1UVHA 1L8HA 1L8IA 3R2LA 5FFEA 5LG2A 3H7GA 4TOEA 4TOBA 1VEIA 2CHPA 4DASA 3R2KA 2ZG8X 3PVTB 1NF6A 1JI5A 2V2JA 2BK6A 2XGWA 3NOZX 4RC8A 4DYXA 2W0OA 4MN9A 2CF7A 3F35A 4TOAA 3Q4RA 3TA8A 3AJPA 2V2RA 4M34A 1ZS3A 1JI4A 1Z6OM 4EVCA 2FZFA 3AJQA 1GWGA 4REUA 3BVIA 4ITWA 2FFXJ 3E1JA 3E1OA 5D8RA 4II4A 3SH6A 4ISPA 3O7SA 5HQOA 3E1MA 4ZKHA 5GN8A 2VXXA 3BVEA 3PW1B 2C2UA 4M32A 3A9QA 4CMYA 4ITTA 3QB9A 5CMRA 3F33A 3HIUA 5D8PA 2V2PA 4DYZA 4KVQA 1RYTA 5GU2X 3SIDA 2RBDA 4ZL5A 3BVLA 4EVBA 1O9RA 3ES3A 4CVSA 3NP2X 2WTLA 4RC6B 1LB3A 1QYBA 3ISFA 3IQ1A 4LYXA 4LPMA 1OTKA 1YUXA 2V2OA 4PGKA 3E1PA 3Q4OA 1S3QA 3AK9A 4PG0A 1VELA 1VJXA 1TJOA 4PGIA 5K52A 5ERKA 4LPNA 4TW3A 1JGCA 5CZUA 2JD70 1VLGA 3KA6A 3WVVA 3WVWA 4LYUA 3PVTA 5D8OA 2CN7A 2C41A 5JACA 2JD60 3T9JA 2GYDA 3EZUA 4LQNA 2V2LA 4XKUA 3PVRB 2G4HA 1UMNA 2IB0A 1BFRA 3RE7A 4DE6A 3ISEA 3KA9A 3KXUA 5LBHA 5J8WA 4ZJKA 3E1QA 2CN6A 3BKNA 5E1UA 2ZA8A 5FFDA 4U3GA 4EVDA 3R2RA 3E1LA 3UOIA 3PW8A 2D5KA 1YV1A 4M33A 5J9VA 2ZG7X 5D8QA 5J93A 3PW1A 2UX1A 2OC5A 3RGDA 3UNOA 2XJOA 1Z6OA 5FFBA 5GU0X 1B71A 3RBCA 4ZMCA 3Q4NA 5JKLA 2QQYA 2FHAA 4AM2A 5K53A 2C6RA 4IWKA 4RC6A 2ZURX 5D8XA 3O7RA 5LG8A 3R2MA 4CVRA 1BCFA 3OGHA 1LKPA 3BT5A 3MPSA 3RAVA 4XKSA 3PVYA 2Y3QA 4TOHA 1JREA 2FG4A 5I4JA 3F39A 1RCEA 2ITBA 5HJHA 1N1QA 3F32A 4ZL6A 4CVPA 5JKLG 5FFAA 1TKOA 2BJYA 1MFRA 5ERJA 1LKOA 3QHCA 2FL0A 3E6RA 3E6SA 1NNQA 2FG8A 4AM4A 2V2NA 1O9IA 2QF9A 2X170 2Z5QA 5JKMA 4TOCA 3PVRA 3QVDA 3PVYB 4LPJA 4PG1A 3PW8C 2VZBA 1IESA 1VEQA 4Z3BA 1HRSA 4OYNA 2F7NA 3RD0A 5GOUA 3KA8A 5AXSA 4IXKA 3KWOA 3UOFA 2BKCA 1TK6A 2FKZA 4CYBA 2Z90A 1NFVA 3KA4A 3Q4QA 2HR5A 4M35A 5HJFA 1KRQA 1BG7A 4TO9A 3PWFA 4DI0A 4ZKWA 2IU2A 3EZ0A 4ISMA 2Z6MA 5JKMG 3SE1A 3F37A 5IX6A 3GE4A 1FHAA 4LQHA 5CMQA 2Z5PA 4DZ0A 1R03A 1IERA 4ZKXA 1F33A 1EUMA 3PWQA 2Z5RA 4TODA 2CLUA 3AJOA 1NF4A 3R2OA 4TOFA 3F38A 2C2FA 2V2MA 1H96A 2WLUA 5FEJA 1MOJA 2V2SA 5GU1X 2HTNA 4AM5A 4LQVA 3E1NA 5J8SA 4Z5SA 4ETRA 4RC5A 4CYAA 3ERZA 1RCDA 3E2CA 3KA3A 2C2JA 4Y08A 4RC7B 4CVTA 2ZA6A 3IS7A 3AF9X 4TOGA 2YW6A 4CY9A 3QHBA 4XKTA 1JYBA 1RCIA 3HL1A 3QZ3A 3AF8X 5LS9A 4RC5B 2OH3A 4MJYA 4QUWA 4XGSA 5D8YA 3FVBA 4KVRA 4CMYV 5GU3X 1S30A 2YJKA 2IY4A 1AEWA 3GHQA 3EGMA 1SOFA 3F36A 4A25A 2GS4A 4MUDA 1Z4AA 2V2IA 2GYQA 2YW7A 4IWJA 1JKVA 5E2DA 1S2ZA 3VNXA 1QGHA 2BW1A 1ZUJA 1LKMA 4ML5A 2CIHA 3BVFA 3OJ5A 4II4B 3FSEA 3PWQC 1DVBA 2FJCA 2VXIA 3IS8A 2JD80 2ZG9X 4MKUA 5GN8B 1JIGA 4MY7A 3AF7X 3R2HA 1JTSA 1F30A 3U90A 2WLAA 3PZAA 4ERUA 4ZTTA 3SHXA 3BVKA 5FFCA 2CLBA 2XJNA 1RCGA 1J30A 4LQJA 3NP0X 5C6FA 2YJJA 1XZ3A 4EVEA 2CEIA 2CHIA 5D8SA 3QD8A 4KVSA 1JKUA 3AK8A 3A68A 3R2SA 3FI6A 3KX9A 4DYUA 4DYYA 1DPSA 4YKHA 1SQ3A 3F34A 4E6KA 4ZLWA 1YUZA 4P18A 1DATA
chains in the Genus database with same CATH superfamily
1XZ1A 2XJMA 3FRRA 1RCCA 2PYBA 3WVUA 4R42A 4RC7A 3GVYA 3WNWA 2ZA7A 1TKPA 2V15A 2XKQA 1UVHA 1L8HA 1L8IA 3R2LA 5FFEA 5LG2A 3H7GA 4TOEA 4TOBA 1VEIA 2CHPA 4DASA 3R2KA 2ZG8X 3PVTB 1NF6A 1JI5A 2V2JA 2BK6A 2XGWA 3NOZX 4YXJA 4RC8A 4DYXA 2W0OA 4MN9A 2CF7A 3F35A 4TOAA 3Q4RA 3TA8A 3AJPA 2V2RA 4M34A 1ZS3A 1JI4A 1Z6OM 4EVCA 2FZFA 3AJQA 3W54A 1GWGA 3FRSA 4REUA 3BVIA 4ITWA 2FFXJ 3E1JA 3E1OA 5D8RA 3UFBA 4II4A 3SH6A 4ISPA 3O7SA 5HQOA 3E1MA 4ZKHA 5GN8A 2VXXA 3BVEA 3PW1B 2C2UA 4M32A 3A9QA 3C1ZA 4CMYA 4ITTA 3QB9A 5CMRA 3F33A 3HIUA 5D8PA 2V2PA 4DYZA 4KVQA 5JDOA 1RYTA 5GU2X 3SIDA 2RBDA 4ZL5A 3BVLA 3DBYA 4EVBA 1O9RA 3ES3A 4CVSA 3NP2X 2WTLA 4RC6B 1LB3A 1QYBA 3ISFA 3IQ1A 4LYXA 4LPMA 1OTKA 1YUXA 2V2OA 4PGKA 3E1PA 3Q4OA 1S3QA 3AK9A 4PG0A 1VELA 1VJXA 4YXMA 1TJOA 4PGIA 5K52A 5JDOB 5ERKA 5HU6D 4LPNA 2G38B 4TW3A 1JGCA 5CZUA 2JD70 1VLGA 3KA6A 2OKCA 3WVVA 3WVWA 4LYUA 3PVTA 5D8OA 2CN7A 2AR0A 2C41A 5JACA 2JD60 3T9JA 2GYDA 3EZUA 4LQNA 2V2LA 4XKUA 3PVRB 2G4HA 1UMNA 2IB0A 1BFRA 3RE7A 4DE6A 2MGYA 3ISEA 3KA9A 3KXUA 5LBHA 5J8WA 4ZJKA 3E1QA 2CN6A 3BKNA 5E1UA 3GGZA 2ZA8A 5FFDA 3JZAB 4U3GA 2V8UA 4EVDA 3R2RA 3E1LA 3UOIA 3PW8A 2D5KA 1YV1A 4YVZA 4M33A 5J9VA 2ZG7X 5D8QA 3M6JA 5J93A 3PW1A 2UX1A 2OC5A 3RGDA 3UNOA 2XJOA 3JZ9A 1Z6OA 5FFBA 5GU0X 1B71A 3RBCA 4ZMCA 3Q4NA 5JKLA 2QQYA 2FHAA 4AM2A 5K53A 2C6RA 4IWKA 4RC6A 3VV9A 2ZURX 5D8XA 3O7RA 5LG8A 3R2MA 4CVRA 1BCFA 3OGHA 1LKPA 3BT5A 3MPSA 3RAVA 4XKSA 3PVYA 2Y3QA 4TOHA 1JREA 3L0MA 4E40A 2FG4A 5I4JA 3F39A 1RCEA 2ITBA 5HJHA 1N1QA 3F32A 4ZL6A 4CVPA 5JKLG 5FFAA 1TKOA 2BJYA 1MFRA 5ERJA 1LKOA 3QHCA 2FL0A 3E6RA 3E6SA 1NNQA 2FG8A 4AM4A 2V2NA 1O9IA 2QF9A 2X170 2Z5QA 5JKMA 4TOCA 3PVRA 4WJG4 3QVDA 3PVYB 4LPJA 4PG1A 3PW8C 2VZBA 1IESA 1VEQA 3N6OA 4Z3BA 1HRSA 4OYNA 2F7NA 3RD0A 5GOUA 3KA8A 5AXSA 4IXKA 3GGYA 3KWOA 3UOFA 2BKCA 1TK6A 2FKZA 4CYBA 2Z90A 1NFVA 3D19A 3KA4A 3Q4QA 2HR5A 4M35A 2WWXB 5HJFA 1KRQA 1BG7A 4TO9A 3PWFA 4DI0A 4ZKWA 2IU2A 3EZ0A 4ISMA 2Z6MA 4W4LB 5JKMG 3SE1A 3F37A 5IX6A 3GE4A 3C1YA 1FHAA 4LQHA 5CMQA 2Z5PA 4DZ0A 1R03A 1IERA 4ZKXA 1F33A 1EUMA 3PWQA 2Z5RA 4TODA 2CLUA 3AJOA 3LKDA 1NF4A 3R2OA 4TOFA 2Y44A 2C2FA 2V2MA 3F38A 1H96A 2WLUA 4W4KB 5FEJA 1MOJA 2V2SA 5GU1X 2HTNA 4AM5A 4KXRB 4LQVA 3E1NA 5J8SA 2V8TA 4Z5SA 4ETRA 4RC5A 3KDQA 4CYAA 3ERZA 1RCDA 3E2CA 3KA3A 2C2JA 4Y08A 4RC7B 4CVTA 2ZA6A 3IS7A 3AF9X 4TOGA 2YW6A 4CY9A 3QHBA 3VVAA 4XKTA 1JYBA 3C21A 1RCIA 3HL1A 3QZ3A 3AF8X 5LS9A 4RC5B 2OH3A 4MJYA 4QUWA 4X0JA 4XGSA 5D8YA 3FVBA 4KVRA 4CMYV 5GU3X 1S30A 2YJKA 2IY4A 1AEWA 3GHQA 3EGMA 1SOFA 2CWLA 3F36A 4A25A 2GS4A 4MUDA 1Z4AA 2V2IA 2GYQA 2YW7A 4IWJA 1JKVA 5E2DA 1S2ZA 3VNXA 1QGHA 2BW1A 1ZUJA 1LKMA 4ML5A 2CIHA 3BVFA 3OJ5A 4II4B 3FSEA 3PWQC 1DVBA 2FJCA 2VXIA 3IS8A 2JD80 2ZG9X 4MKUA 5GN8B 1JIGA 4MY7A 3AF7X 3R2HA 1JTSA 1F30A 3U90A 2N02A 2WLAA 3PZAA 4ERUA 4ZTTA 3SHXA 3BVKA 5FFCA 2CLBA 2XJNA 1RCGA 3V3KB 1J30A 4LQJA 4MXPA 3NP0X 5C6FA 2YJJA 1XZ3A 4EVEA 2CEIA 2CHIA 5D8SA 3QD8A 4KVSA 1JKUA 3AK8A 3A68A 3R2SA 3FI6A 3KX9A 4DYUA 4DYYA 1DPSA 3KHKA 4YKHA 1SQ3A 3F34A 4E6KA 4ZLWA 1YUZA 4P18A 3C23A 1DATA
chains in the Genus database with same CATH topology
1XZ1A 2XJMA 3FRRA 1RCCA 2PYBA 3WVUA 4R42A 4RC7A 3GVYA 3WNWA 2ZA7A 1TKPA 2V15A 2XKQA 1UVHA 1L8HA 1L8IA 3R2LA 5FFEA 5LG2A 3H7GA 4TOEA 4TOBA 1VEIA 2CHPA 4DASA 3R2KA 2ZG8X 3PVTB 1NF6A 1JI5A 2V2JA 2BK6A 2XGWA 3NOZX 4YXJA 4RC8A 4DYXA 2W0OA 4MN9A 2CF7A 3F35A 4TOAA 3Q4RA 3TA8A 3AJPA 2V2RA 4M34A 1ZS3A 1JI4A 1Z6OM 4EVCA 2FZFA 3AJQA 3W54A 1GWGA 3FRSA 4REUA 3BVIA 4ITWA 2FFXJ 3E1JA 3E1OA 5D8RA 3UFBA 4II4A 3SH6A 4ISPA 3O7SA 5HQOA 3E1MA 4ZKHA 5GN8A 2VXXA 3BVEA 3PW1B 2C2UA 4M32A 3A9QA 3C1ZA 4CMYA 4ITTA 3QB9A 5CMRA 3F33A 3HIUA 5D8PA 2V2PA 4DYZA 4KVQA 5JDOA 1RYTA 5GU2X 3SIDA 2RBDA 4ZL5A 3BVLA 3DBYA 4EVBA 1O9RA 3ES3A 4CVSA 3NP2X 2WTLA 4RC6B 1LB3A 1QYBA 3ISFA 3IQ1A 4LYXA 4LPMA 1OTKA 1YUXA 2V2OA 4PGKA 3E1PA 3Q4OA 1S3QA 3AK9A 4PG0A 1VELA 1VJXA 4YXMA 1TJOA 4PGIA 5K52A 5JDOB 5ERKA 5HU6D 4LPNA 2G38B 4TW3A 1JGCA 5CZUA 2JD70 1VLGA 3KA6A 2OKCA 3WVVA 3WVWA 4LYUA 3PVTA 5D8OA 2CN7A 2AR0A 2C41A 5JACA 2JD60 3T9JA 2GYDA 3EZUA 4LQNA 2V2LA 4XKUA 3PVRB 2G4HA 1UMNA 2IB0A 1BFRA 3RE7A 4DE6A 2MGYA 3ISEA 3KA9A 3KXUA 5LBHA 5J8WA 4ZJKA 3E1QA 2CN6A 3BKNA 5E1UA 3GGZA 2ZA8A 5FFDA 3JZAB 4U3GA 2V8UA 4EVDA 3R2RA 3E1LA 3UOIA 3PW8A 2D5KA 1YV1A 4YVZA 4M33A 5J9VA 2ZG7X 5D8QA 3M6JA 5J93A 3PW1A 2UX1A 2OC5A 3RGDA 3UNOA 2XJOA 3JZ9A 1Z6OA 5FFBA 5GU0X 1B71A 3RBCA 4ZMCA 3Q4NA 5JKLA 2QQYA 2FHAA 4AM2A 5K53A 2C6RA 4IWKA 4RC6A 3VV9A 2ZURX 5D8XA 3O7RA 5LG8A 3R2MA 4CVRA 1BCFA 3OGHA 1LKPA 3BT5A 3MPSA 3RAVA 4XKSA 3PVYA 2Y3QA 4TOHA 1JREA 3L0MA 4E40A 2FG4A 5I4JA 3F39A 1RCEA 2ITBA 5HJHA 1N1QA 3F32A 4ZL6A 4CVPA 5JKLG 5FFAA 1TKOA 2BJYA 1MFRA 5ERJA 1LKOA 3QHCA 2FL0A 3E6RA 3E6SA 1NNQA 2FG8A 4AM4A 2V2NA 1O9IA 2QF9A 2X170 2Z5QA 5JKMA 4TOCA 3PVRA 4WJG4 3QVDA 3PVYB 4LPJA 4PG1A 3PW8C 2VZBA 1IESA 1VEQA 3N6OA 4Z3BA 1HRSA 4OYNA 2F7NA 3RD0A 5GOUA 3KA8A 5AXSA 4IXKA 3GGYA 3KWOA 3UOFA 2BKCA 1TK6A 2FKZA 4CYBA 2Z90A 1NFVA 3D19A 3KA4A 3Q4QA 2HR5A 4M35A 2WWXB 5HJFA 1KRQA 1BG7A 4TO9A 3PWFA 4DI0A 4ZKWA 2IU2A 3EZ0A 4ISMA 2Z6MA 4W4LB 5JKMG 3SE1A 3F37A 5IX6A 3GE4A 3C1YA 1FHAA 4LQHA 5CMQA 2Z5PA 4DZ0A 1R03A 1IERA 4ZKXA 1F33A 1EUMA 3PWQA 2Z5RA 4TODA 2CLUA 3AJOA 3LKDA 1NF4A 3R2OA 4TOFA 2Y44A 2C2FA 2V2MA 3F38A 1H96A 2WLUA 4W4KB 5FEJA 1MOJA 2V2SA 5GU1X 2HTNA 4AM5A 4KXRB 4LQVA 3E1NA 5J8SA 2V8TA 4Z5SA 4ETRA 4RC5A 3KDQA 4CYAA 3ERZA 1RCDA 3E2CA 3KA3A 2C2JA 4Y08A 4RC7B 4CVTA 2ZA6A 3IS7A 3AF9X 4TOGA 2YW6A 4CY9A 3QHBA 3VVAA 4XKTA 1JYBA 3C21A 1RCIA 3HL1A 3QZ3A 3AF8X 5LS9A 4RC5B 2OH3A 4MJYA 4QUWA 4X0JA 4XGSA 5D8YA 3FVBA 4KVRA 4CMYV 5GU3X 1S30A 2YJKA 2IY4A 1AEWA 3GHQA 3EGMA 1SOFA 2CWLA 3F36A 4A25A 2GS4A 4MUDA 1Z4AA 2V2IA 2GYQA 2YW7A 4IWJA 1JKVA 5E2DA 1S2ZA 3VNXA 1QGHA 2BW1A 1ZUJA 1LKMA 4ML5A 2CIHA 3BVFA 3OJ5A 4II4B 3FSEA 3PWQC 1DVBA 2FJCA 2VXIA 3IS8A 2JD80 2ZG9X 4MKUA 5GN8B 1JIGA 4MY7A 3AF7X 3R2HA 1JTSA 1F30A 3U90A 2N02A 2WLAA 3PZAA 4ERUA 4ZTTA 3SHXA 3BVKA 5FFCA 2CLBA 2XJNA 1RCGA 3V3KB 1J30A 4LQJA 4MXPA 3NP0X 5C6FA 2YJJA 1XZ3A 4EVEA 2CEIA 2CHIA 5D8SA 3QD8A 4KVSA 1JKUA 3AK8A 3A68A 3R2SA 3FI6A 3KX9A 4DYUA 4DYYA 1DPSA 3KHKA 4YKHA 1SQ3A 3F34A 4E6KA 4ZLWA 1YUZA 4P18A 3C23A 1DATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZ1 A;  2XJM A;  1RCC A;  2PYB A;  3WVU A;  4R42 A;  4RC7 A;  3GVY A;  3WNW A;  2ZA7 A;  1TKP A;  2V15 A;  2XKQ A;  1UVH A;  1L8H A;  1L8I A;  3R2L A;  5FFE A;  5LG2 A;  3H7G A;  4TOE A;  4TOB A;  1VEI A;  2CHP A;  4DAS A;  3R2K A;  2ZG8 X;  3PVT B;  1NF6 A;  1JI5 A;  2V2J A;  2BK6 A;  2XGW A;  3NOZ X;  4RC8 A;  4DYX A;  2W0O A;  4MN9 A;  2CF7 A;  3F35 A;  4TOA A;  3Q4R A;  3TA8 A;  3AJP A;  2V2R A;  4M34 A;  1ZS3 A;  1JI4 A;  1Z6O M;  4EVC A;  2FZF A;  3AJQ A;  1GWG A;  4REU A;  3BVI A;  4ITW A;  2FFX J;  3E1J A;  3E1O A;  5D8R A;  4II4 A;  3SH6 A;  4ISP A;  3O7S A;  5HQO A;  3E1M A;  4ZKH A;  5GN8 A;  2VXX A;  3BVE A;  3PW1 B;  2C2U A;  4M32 A;  3A9Q A;  4CMY A;  4ITT A;  3QB9 A;  5CMR A;  3F33 A;  3HIU A;  5D8P A;  2V2P A;  4DYZ A;  4KVQ A;  1RYT A;  5GU2 X;  3SID A;  2RBD A;  4ZL5 A;  3BVL A;  4EVB A;  1O9R A;  3ES3 A;  4CVS A;  3NP2 X;  2WTL A;  4RC6 B;  1LB3 A;  1QYB A;  3ISF A;  3IQ1 A;  4LYX A;  4LPM A;  1OTK A;  1YUX A;  2V2O A;  4PGK A;  3E1P A;  3Q4O A;  1S3Q A;  3AK9 A;  4PG0 A;  1VEL A;  1VJX A;  1TJO A;  4PGI A;  5K52 A;  5ERK A;  4LPN A;  4TW3 A;  1JGC A;  5CZU A;  2JD7 0;  1VLG A;  3KA6 A;  3WVV A;  3WVW A;  4LYU A;  3PVT A;  5D8O A;  2CN7 A;  2C41 A;  5JAC A;  2JD6 0;  3T9J A;  2GYD A;  3EZU A;  4LQN A;  2V2L A;  4XKU A;  3PVR B;  2G4H A;  1UMN A;  2IB0 A;  1BFR A;  3RE7 A;  4DE6 A;  3ISE A;  3KA9 A;  3KXU A;  5LBH A;  5J8W A;  4ZJK A;  3E1Q A;  2CN6 A;  3BKN A;  5E1U A;  2ZA8 A;  5FFD A;  4U3G A;  4EVD A;  3R2R A;  3E1L A;  3UOI A;  3PW8 A;  2D5K A;  1YV1 A;  4M33 A;  5J9V A;  2ZG7 X;  5D8Q A;  5J93 A;  3PW1 A;  2UX1 A;  2OC5 A;  3RGD A;  3UNO A;  2XJO A;  1Z6O A;  5FFB A;  5GU0 X;  1B71 A;  3RBC A;  4ZMC A;  3Q4N A;  5JKL A;  2QQY A;  2FHA A;  4AM2 A;  5K53 A;  2C6R A;  4IWK A;  4RC6 A;  2ZUR X;  5D8X A;  3O7R A;  5LG8 A;  3R2M A;  4CVR A;  1BCF A;  3OGH A;  1LKP A;  3BT5 A;  3MPS A;  3RAV A;  4XKS A;  3PVY A;  2Y3Q A;  4TOH A;  1JRE A;  2FG4 A;  5I4J A;  3F39 A;  1RCE A;  2ITB A;  5HJH A;  1N1Q A;  3F32 A;  4ZL6 A;  4CVP A;  5JKL G;  5FFA A;  1TKO A;  2BJY A;  1MFR A;  5ERJ A;  1LKO A;  3QHC A;  2FL0 A;  3E6R A;  3E6S A;  1NNQ A;  2FG8 A;  4AM4 A;  2V2N A;  1O9I A;  2QF9 A;  2X17 0;  2Z5Q A;  5JKM A;  4TOC A;  3PVR A;  3QVD A;  3PVY B;  4LPJ A;  4PG1 A;  3PW8 C;  2VZB A;  1IES A;  1VEQ A;  4Z3B A;  1HRS A;  4OYN A;  2F7N A;  3RD0 A;  5GOU A;  3KA8 A;  5AXS A;  4IXK A;  3KWO A;  3UOF A;  2BKC A;  1TK6 A;  2FKZ A;  4CYB A;  2Z90 A;  1NFV A;  3KA4 A;  3Q4Q A;  2HR5 A;  4M35 A;  5HJF A;  1KRQ A;  1BG7 A;  4TO9 A;  3PWF A;  4DI0 A;  4ZKW A;  2IU2 A;  3EZ0 A;  4ISM A;  2Z6M A;  5JKM G;  3SE1 A;  3F37 A;  5IX6 A;  3GE4 A;  1FHA A;  4LQH A;  5CMQ A;  2Z5P A;  4DZ0 A;  1R03 A;  1IER A;  4ZKX A;  1F33 A;  1EUM A;  3PWQ A;  2Z5R A;  4TOD A;  2CLU A;  3AJO A;  1NF4 A;  3R2O A;  4TOF A;  3F38 A;  2C2F A;  2V2M A;  1H96 A;  2WLU A;  5FEJ A;  1MOJ A;  2V2S A;  5GU1 X;  2HTN A;  4AM5 A;  4LQV A;  3E1N A;  5J8S A;  4Z5S A;  4ETR A;  4RC5 A;  4CYA A;  3ERZ A;  1RCD A;  3E2C A;  3KA3 A;  2C2J A;  4Y08 A;  4RC7 B;  4CVT A;  2ZA6 A;  3IS7 A;  3AF9 X;  4TOG A;  2YW6 A;  4CY9 A;  3QHB A;  4XKT A;  1JYB A;  1RCI A;  3HL1 A;  3QZ3 A;  3AF8 X;  5LS9 A;  4RC5 B;  2OH3 A;  4MJY A;  4QUW A;  4XGS A;  5D8Y A;  3FVB A;  4KVR A;  4CMY V;  5GU3 X;  1S30 A;  2YJK A;  2IY4 A;  1AEW A;  3GHQ A;  3EGM A;  1SOF A;  3F36 A;  4A25 A;  2GS4 A;  4MUD A;  1Z4A A;  2V2I A;  2GYQ A;  2YW7 A;  4IWJ A;  1JKV A;  5E2D A;  1S2Z A;  3VNX A;  1QGH A;  2BW1 A;  1ZUJ A;  1LKM A;  4ML5 A;  2CIH A;  3BVF A;  3OJ5 A;  4II4 B;  3FSE A;  3PWQ C;  1DVB A;  2FJC A;  2VXI A;  3IS8 A;  2JD8 0;  2ZG9 X;  4MKU A;  5GN8 B;  1JIG A;  4MY7 A;  3AF7 X;  3R2H A;  1JTS A;  1F30 A;  3U90 A;  2WLA A;  3PZA A;  4ERU A;  4ZTT A;  3SHX A;  3BVK A;  5FFC A;  2CLB A;  2XJN A;  1RCG A;  1J30 A;  4LQJ A;  3NP0 X;  5C6F A;  2YJJ A;  1XZ3 A;  4EVE A;  2CEI A;  2CHI A;  5D8S A;  3QD8 A;  4KVS A;  1JKU A;  3AK8 A;  3A68 A;  3R2S A;  3FI6 A;  3KX9 A;  4DYU A;  4DYY A;  1DPS A;  4YKH A;  1SQ3 A;  3F34 A;  4E6K A;  4ZLW A;  1YUZ A;  4P18 A;  1DAT A; 
#chains in the Genus database with same CATH topology
 1XZ1 A;  2XJM A;  3FRR A;  1RCC A;  2PYB A;  3WVU A;  4R42 A;  4RC7 A;  3GVY A;  3WNW A;  2ZA7 A;  1TKP A;  2V15 A;  2XKQ A;  1UVH A;  1L8H A;  1L8I A;  3R2L A;  5FFE A;  5LG2 A;  3H7G A;  4TOE A;  4TOB A;  1VEI A;  2CHP A;  4DAS A;  3R2K A;  2ZG8 X;  3PVT B;  1NF6 A;  1JI5 A;  2V2J A;  2BK6 A;  2XGW A;  3NOZ X;  4YXJ A;  4RC8 A;  4DYX A;  2W0O A;  4MN9 A;  2CF7 A;  3F35 A;  4TOA A;  3Q4R A;  3TA8 A;  3AJP A;  2V2R A;  4M34 A;  1ZS3 A;  1JI4 A;  1Z6O M;  4EVC A;  2FZF A;  3AJQ A;  3W54 A;  1GWG A;  3FRS A;  4REU A;  3BVI A;  4ITW A;  2FFX J;  3E1J A;  3E1O A;  5D8R A;  3UFB A;  4II4 A;  3SH6 A;  4ISP A;  3O7S A;  5HQO A;  3E1M A;  4ZKH A;  5GN8 A;  2VXX A;  3BVE A;  3PW1 B;  2C2U A;  4M32 A;  3A9Q A;  3C1Z A;  4CMY A;  4ITT A;  3QB9 A;  5CMR A;  3F33 A;  3HIU A;  5D8P A;  2V2P A;  4DYZ A;  4KVQ A;  5JDO A;  1RYT A;  5GU2 X;  3SID A;  2RBD A;  4ZL5 A;  3BVL A;  3DBY A;  4EVB A;  1O9R A;  3ES3 A;  4CVS A;  3NP2 X;  2WTL A;  4RC6 B;  1LB3 A;  1QYB A;  3ISF A;  3IQ1 A;  4LYX A;  4LPM A;  1OTK A;  1YUX A;  2V2O A;  4PGK A;  3E1P A;  3Q4O A;  1S3Q A;  3AK9 A;  4PG0 A;  1VEL A;  1VJX A;  4YXM A;  1TJO A;  4PGI A;  5K52 A;  5JDO B;  5ERK A;  5HU6 D;  4LPN A;  2G38 B;  4TW3 A;  1JGC A;  5CZU A;  2JD7 0;  1VLG A;  3KA6 A;  2OKC A;  3WVV A;  3WVW A;  4LYU A;  3PVT A;  5D8O A;  2CN7 A;  2AR0 A;  2C41 A;  5JAC A;  2JD6 0;  3T9J A;  2GYD A;  3EZU A;  4LQN A;  2V2L A;  4XKU A;  3PVR B;  2G4H A;  1UMN A;  2IB0 A;  1BFR A;  3RE7 A;  4DE6 A;  2MGY A;  3ISE A;  3KA9 A;  3KXU A;  5LBH A;  5J8W A;  4ZJK A;  3E1Q A;  2CN6 A;  3BKN A;  5E1U A;  3GGZ A;  2ZA8 A;  5FFD A;  3JZA B;  4U3G A;  2V8U A;  4EVD A;  3R2R A;  3E1L A;  3UOI A;  3PW8 A;  2D5K A;  1YV1 A;  4YVZ A;  4M33 A;  5J9V A;  2ZG7 X;  5D8Q A;  3M6J A;  5J93 A;  3PW1 A;  2UX1 A;  2OC5 A;  3RGD A;  3UNO A;  2XJO A;  3JZ9 A;  1Z6O A;  5FFB A;  5GU0 X;  1B71 A;  3RBC A;  4ZMC A;  3Q4N A;  5JKL A;  2QQY A;  2FHA A;  4AM2 A;  5K53 A;  2C6R A;  4IWK A;  4RC6 A;  3VV9 A;  2ZUR X;  5D8X A;  3O7R A;  5LG8 A;  3R2M A;  4CVR A;  1BCF A;  3OGH A;  1LKP A;  3BT5 A;  3MPS A;  3RAV A;  4XKS A;  3PVY A;  2Y3Q A;  4TOH A;  1JRE A;  3L0M A;  4E40 A;  2FG4 A;  5I4J A;  3F39 A;  1RCE A;  2ITB A;  5HJH A;  1N1Q A;  3F32 A;  4ZL6 A;  4CVP A;  5JKL G;  5FFA A;  1TKO A;  2BJY A;  1MFR A;  5ERJ A;  1LKO A;  3QHC A;  2FL0 A;  3E6R A;  3E6S A;  1NNQ A;  2FG8 A;  4AM4 A;  2V2N A;  1O9I A;  2QF9 A;  2X17 0;  2Z5Q A;  5JKM A;  4TOC A;  3PVR A;  4WJG 4;  3QVD A;  3PVY B;  4LPJ A;  4PG1 A;  3PW8 C;  2VZB A;  1IES A;  1VEQ A;  3N6O A;  4Z3B A;  1HRS A;  4OYN A;  2F7N A;  3RD0 A;  5GOU A;  3KA8 A;  5AXS A;  4IXK A;  3GGY A;  3KWO A;  3UOF A;  2BKC A;  1TK6 A;  2FKZ A;  4CYB A;  2Z90 A;  1NFV A;  3D19 A;  3KA4 A;  3Q4Q A;  2HR5 A;  4M35 A;  2WWX B;  5HJF A;  1KRQ A;  1BG7 A;  4TO9 A;  3PWF A;  4DI0 A;  4ZKW A;  2IU2 A;  3EZ0 A;  4ISM A;  2Z6M A;  4W4L B;  5JKM G;  3SE1 A;  3F37 A;  5IX6 A;  3GE4 A;  3C1Y A;  1FHA A;  4LQH A;  5CMQ A;  2Z5P A;  4DZ0 A;  1R03 A;  1IER A;  4ZKX A;  1F33 A;  1EUM A;  3PWQ A;  2Z5R A;  4TOD A;  2CLU A;  3AJO A;  3LKD A;  1NF4 A;  3R2O A;  4TOF A;  2Y44 A;  2C2F A;  2V2M A;  3F38 A;  1H96 A;  2WLU A;  4W4K B;  5FEJ A;  1MOJ A;  2V2S A;  5GU1 X;  2HTN A;  4AM5 A;  4KXR B;  4LQV A;  3E1N A;  5J8S A;  2V8T A;  4Z5S A;  4ETR A;  4RC5 A;  3KDQ A;  4CYA A;  3ERZ A;  1RCD A;  3E2C A;  3KA3 A;  2C2J A;  4Y08 A;  4RC7 B;  4CVT A;  2ZA6 A;  3IS7 A;  3AF9 X;  4TOG A;  2YW6 A;  4CY9 A;  3QHB A;  3VVA A;  4XKT A;  1JYB A;  3C21 A;  1RCI A;  3HL1 A;  3QZ3 A;  3AF8 X;  5LS9 A;  4RC5 B;  2OH3 A;  4MJY A;  4QUW A;  4X0J A;  4XGS A;  5D8Y A;  3FVB A;  4KVR A;  4CMY V;  5GU3 X;  1S30 A;  2YJK A;  2IY4 A;  1AEW A;  3GHQ A;  3EGM A;  1SOF A;  2CWL A;  3F36 A;  4A25 A;  2GS4 A;  4MUD A;  1Z4A A;  2V2I A;  2GYQ A;  2YW7 A;  4IWJ A;  1JKV A;  5E2D A;  1S2Z A;  3VNX A;  1QGH A;  2BW1 A;  1ZUJ A;  1LKM A;  4ML5 A;  2CIH A;  3BVF A;  3OJ5 A;  4II4 B;  3FSE A;  3PWQ C;  1DVB A;  2FJC A;  2VXI A;  3IS8 A;  2JD8 0;  2ZG9 X;  4MKU A;  5GN8 B;  1JIG A;  4MY7 A;  3AF7 X;  3R2H A;  1JTS A;  1F30 A;  3U90 A;  2N02 A;  2WLA A;  3PZA A;  4ERU A;  4ZTT A;  3SHX A;  3BVK A;  5FFC A;  2CLB A;  2XJN A;  1RCG A;  3V3K B;  1J30 A;  4LQJ A;  4MXP A;  3NP0 X;  5C6F A;  2YJJ A;  1XZ3 A;  4EVE A;  2CEI A;  2CHI A;  5D8S A;  3QD8 A;  4KVS A;  1JKU A;  3AK8 A;  3A68 A;  3R2S A;  3FI6 A;  3KX9 A;  4DYU A;  4DYY A;  1DPS A;  3KHK A;  4YKH A;  1SQ3 A;  3F34 A;  4E6K A;  4ZLW A;  1YUZ A;  4P18 A;  3C23 A;  1DAT A; 
#chains in the Genus database with same CATH homology
 1XZ1 A;  2XJM A;  3FRR A;  1RCC A;  2PYB A;  3WVU A;  4R42 A;  4RC7 A;  3GVY A;  3WNW A;  2ZA7 A;  1TKP A;  2V15 A;  2XKQ A;  1UVH A;  1L8H A;  1L8I A;  3R2L A;  5FFE A;  5LG2 A;  3H7G A;  4TOE A;  4TOB A;  1VEI A;  2CHP A;  4DAS A;  3R2K A;  2ZG8 X;  3PVT B;  1NF6 A;  1JI5 A;  2V2J A;  2BK6 A;  2XGW A;  3NOZ X;  4YXJ A;  4RC8 A;  4DYX A;  2W0O A;  4MN9 A;  2CF7 A;  3F35 A;  4TOA A;  3Q4R A;  3TA8 A;  3AJP A;  2V2R A;  4M34 A;  1ZS3 A;  1JI4 A;  1Z6O M;  4EVC A;  2FZF A;  3AJQ A;  3W54 A;  1GWG A;  3FRS A;  4REU A;  3BVI A;  4ITW A;  2FFX J;  3E1J A;  3E1O A;  5D8R A;  3UFB A;  4II4 A;  3SH6 A;  4ISP A;  3O7S A;  5HQO A;  3E1M A;  4ZKH A;  5GN8 A;  2VXX A;  3BVE A;  3PW1 B;  2C2U A;  4M32 A;  3A9Q A;  3C1Z A;  4CMY A;  4ITT A;  3QB9 A;  5CMR A;  3F33 A;  3HIU A;  5D8P A;  2V2P A;  4DYZ A;  4KVQ A;  5JDO A;  1RYT A;  5GU2 X;  3SID A;  2RBD A;  4ZL5 A;  3BVL A;  3DBY A;  4EVB A;  1O9R A;  3ES3 A;  4CVS A;  3NP2 X;  2WTL A;  4RC6 B;  1LB3 A;  1QYB A;  3ISF A;  3IQ1 A;  4LYX A;  4LPM A;  1OTK A;  1YUX A;  2V2O A;  4PGK A;  3E1P A;  3Q4O A;  1S3Q A;  3AK9 A;  4PG0 A;  1VEL A;  1VJX A;  4YXM A;  1TJO A;  4PGI A;  5K52 A;  5JDO B;  5ERK A;  5HU6 D;  4LPN A;  2G38 B;  4TW3 A;  1JGC A;  5CZU A;  2JD7 0;  1VLG A;  3KA6 A;  2OKC A;  3WVV A;  3WVW A;  4LYU A;  3PVT A;  5D8O A;  2CN7 A;  2AR0 A;  2C41 A;  5JAC A;  2JD6 0;  3T9J A;  2GYD A;  3EZU A;  4LQN A;  2V2L A;  4XKU A;  3PVR B;  2G4H A;  1UMN A;  2IB0 A;  1BFR A;  3RE7 A;  4DE6 A;  2MGY A;  3ISE A;  3KA9 A;  3KXU A;  5LBH A;  5J8W A;  4ZJK A;  3E1Q A;  2CN6 A;  3BKN A;  5E1U A;  3GGZ A;  2ZA8 A;  5FFD A;  3JZA B;  4U3G A;  2V8U A;  4EVD A;  3R2R A;  3E1L A;  3UOI A;  3PW8 A;  2D5K A;  1YV1 A;  4YVZ A;  4M33 A;  5J9V A;  2ZG7 X;  5D8Q A;  3M6J A;  5J93 A;  3PW1 A;  2UX1 A;  2OC5 A;  3RGD A;  3UNO A;  2XJO A;  3JZ9 A;  1Z6O A;  5FFB A;  5GU0 X;  1B71 A;  3RBC A;  4ZMC A;  3Q4N A;  5JKL A;  2QQY A;  2FHA A;  4AM2 A;  5K53 A;  2C6R A;  4IWK A;  4RC6 A;  3VV9 A;  2ZUR X;  5D8X A;  3O7R A;  5LG8 A;  3R2M A;  4CVR A;  1BCF A;  3OGH A;  1LKP A;  3BT5 A;  3MPS A;  3RAV A;  4XKS A;  3PVY A;  2Y3Q A;  4TOH A;  1JRE A;  3L0M A;  4E40 A;  2FG4 A;  5I4J A;  3F39 A;  1RCE A;  2ITB A;  5HJH A;  1N1Q A;  3F32 A;  4ZL6 A;  4CVP A;  5JKL G;  5FFA A;  1TKO A;  2BJY A;  1MFR A;  5ERJ A;  1LKO A;  3QHC A;  2FL0 A;  3E6R A;  3E6S A;  1NNQ A;  2FG8 A;  4AM4 A;  2V2N A;  1O9I A;  2QF9 A;  2X17 0;  2Z5Q A;  5JKM A;  4TOC A;  3PVR A;  4WJG 4;  3QVD A;  3PVY B;  4LPJ A;  4PG1 A;  3PW8 C;  2VZB A;  1IES A;  1VEQ A;  3N6O A;  4Z3B A;  1HRS A;  4OYN A;  2F7N A;  3RD0 A;  5GOU A;  3KA8 A;  5AXS A;  4IXK A;  3GGY A;  3KWO A;  3UOF A;  2BKC A;  1TK6 A;  2FKZ A;  4CYB A;  2Z90 A;  1NFV A;  3D19 A;  3KA4 A;  3Q4Q A;  2HR5 A;  4M35 A;  2WWX B;  5HJF A;  1KRQ A;  1BG7 A;  4TO9 A;  3PWF A;  4DI0 A;  4ZKW A;  2IU2 A;  3EZ0 A;  4ISM A;  2Z6M A;  4W4L B;  5JKM G;  3SE1 A;  3F37 A;  5IX6 A;  3GE4 A;  3C1Y A;  1FHA A;  4LQH A;  5CMQ A;  2Z5P A;  4DZ0 A;  1R03 A;  1IER A;  4ZKX A;  1F33 A;  1EUM A;  3PWQ A;  2Z5R A;  4TOD A;  2CLU A;  3AJO A;  3LKD A;  1NF4 A;  3R2O A;  4TOF A;  2Y44 A;  2C2F A;  2V2M A;  3F38 A;  1H96 A;  2WLU A;  4W4K B;  5FEJ A;  1MOJ A;  2V2S A;  5GU1 X;  2HTN A;  4AM5 A;  4KXR B;  4LQV A;  3E1N A;  5J8S A;  2V8T A;  4Z5S A;  4ETR A;  4RC5 A;  3KDQ A;  4CYA A;  3ERZ A;  1RCD A;  3E2C A;  3KA3 A;  2C2J A;  4Y08 A;  4RC7 B;  4CVT A;  2ZA6 A;  3IS7 A;  3AF9 X;  4TOG A;  2YW6 A;  4CY9 A;  3QHB A;  3VVA A;  4XKT A;  1JYB A;  3C21 A;  1RCI A;  3HL1 A;  3QZ3 A;  3AF8 X;  5LS9 A;  4RC5 B;  2OH3 A;  4MJY A;  4QUW A;  4X0J A;  4XGS A;  5D8Y A;  3FVB A;  4KVR A;  4CMY V;  5GU3 X;  1S30 A;  2YJK A;  2IY4 A;  1AEW A;  3GHQ A;  3EGM A;  1SOF A;  2CWL A;  3F36 A;  4A25 A;  2GS4 A;  4MUD A;  1Z4A A;  2V2I A;  2GYQ A;  2YW7 A;  4IWJ A;  1JKV A;  5E2D A;  1S2Z A;  3VNX A;  1QGH A;  2BW1 A;  1ZUJ A;  1LKM A;  4ML5 A;  2CIH A;  3BVF A;  3OJ5 A;  4II4 B;  3FSE A;  3PWQ C;  1DVB A;  2FJC A;  2VXI A;  3IS8 A;  2JD8 0;  2ZG9 X;  4MKU A;  5GN8 B;  1JIG A;  4MY7 A;  3AF7 X;  3R2H A;  1JTS A;  1F30 A;  3U90 A;  2N02 A;  2WLA A;  3PZA A;  4ERU A;  4ZTT A;  3SHX A;  3BVK A;  5FFC A;  2CLB A;  2XJN A;  1RCG A;  3V3K B;  1J30 A;  4LQJ A;  4MXP A;  3NP0 X;  5C6F A;  2YJJ A;  1XZ3 A;  4EVE A;  2CEI A;  2CHI A;  5D8S A;  3QD8 A;  4KVS A;  1JKU A;  3AK8 A;  3A68 A;  3R2S A;  3FI6 A;  3KX9 A;  4DYU A;  4DYY A;  1DPS A;  3KHK A;  4YKH A;  1SQ3 A;  3F34 A;  4E6K A;  4ZLW A;  1YUZ A;  4P18 A;  3C23 A;  1DAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...