3FSEA

Crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
352
structure length
336
Chain Sequence
KKVAILIEQAVEDTEFIIPCNGLKQAGFEVVVLGSRMNEKYKGKRGRLSTQADGTTTEAIASEFDAVVIPGGMAPDKMRRNPNTVRFVQEAMEQGKLVAAVHGPQVLIEGDLLRGKQATGFIAISKDMMNAGADYLDEALVVDGNLITSREPGDLAIFTTAILSRLGYGGKDAALPDEKDRNAEWWKLADAWGGSTKGDIVRGLNTALGGERYSLEALEKYTEKESDVEAKALFQEMITNKQRHIEYLETYLTRLGEKPSLSANDDIYQIRSALGDIQTGIGDIGNLCAMYTDPIATAIFKEIYKDLVKYEQRLVSLYRTRTNATVQPPKPTTGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords two-domain protein containing DJ-1/ThiJ/PfpI-like and ferrit
publication title Crystal structure of two-domain protein containing DJ-1/ThiJ/PfpI-like and ferritin-like domains. (YP_324989.1) from ANABAENA VARIABILIS ATCC 29413 at 1.90 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Hydrolase
total genus 123
structure length 336
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3fseA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fseA01
3O7RA 4RC7A 1SOAA 3P9RA 5FFDA 2LXNA 3E1OA 1M6VB 2RK3A 3EJ6A 1QVWA 3NOQA 4RC5B 1RCCA 4PG1A 5D8QA 2FHAA 5CMRA 5JZMA 1Z4AA 4D1YA 1BXRB 3PQ7A 5J8SA 4E6KA 3F5DA 4UOZA 2FG8A 1KRQA 5E1UA 4RKYA 2UX1A 2V2RA 5GOUA 4DYZA 4I4NA 5LIRA 4E5VA 1VELA 4ENUA 4IXKA 4DYXA 3KA9A 3E2CA 3CNEA 4PGKA 2W0OA 3SF8A 2IY4A 3PVYB 3BVKA 1OX5A 3QD8A 1H96A 3TTVA 1ZS3A 2BJYA 4DASA 4P36A 5K52A 2W7TA 2X170 3UOIA 3SOZA 1L8IA 3VNXA 5JACA 5SYAA 3TQIA 4AUNA 4IWJA 4B31A 4UOQA 2V2JA 3PVRA 1JDBC 5ERKA 1AEWA 1O9IA 4TOGA 4XKTA 2BK6A 4DYUA 3R75A 3Q4RA 5GU2X 4LQVA 1JTSA 3R74A 4TW3A 1TJOA 1Q2UA 1RCDA 3P9SA 3AF9X 4ZDIA 2IB0A 4RC8A 1JYBA 3BHNA 4N12A 2HR5A 4TODA 4Y1RA 5D8PA 1A9XB 4RKWA 3UNOA 1JKUA 1GGJA 5DFAA 1GGHA 3EWNA 4LPMA 5FFAA 2XGWA 2R1TA 3F36A 1N1QA 4ENWA 5E9AA 1EUMA 4B5KA 2YWJA 3EGMA 4PG0A 3WVUA 4XGSA 3ES3A 2GYQA 3R2MA 3NOOA 3PVTA 1QWSA 4L8FA 3KWOA 3PW8C 4Y0NA 1G2IA 1P7YA 4TOCA 2ZUSA 1T36B 2VXOA 1OX4A 4OQ4A 1PDVA 2PYBA 4AUEA 2YJKA 2IUFA 3CY6A 3B3AA 4L8WB 3QVDA 2VZBA 3KA3A 4PXYA 1IESA 5JKLA 3F39A 2JD70 5JKLG 4Y1EA 5HJFA 1GGEA 3ZJ5A 2V4UA 3RE7A 3O7SA 3MIIA 1LKMA 4M32A 3A68A 3BT5A 3BVIA 3R2SA 3WNWA 4II4A 2NV0A 1RCIA 4TOAA 5LG2A 2ZG7X 2RBDA 4ERUA 5E2DA 1KWKA 2ZUTA 3KA8A 2Z5QA 3SF8B 2ISSD 4GUDA 3P9QA 5IX6A 2BW1A 4ML5A 1LKPA 2C41A 4E08A 2CHPA 1F33A 2Y3QA 1P5FA 3BVEA 3KA6A 4RC6B 4XKUA 1NF6A 1QGHA 3FI6A 3PZAA 4L8YA 1UVHA 2V2LA 1T0BA 2C2JA 1T3TA 4LPJA 2FKZA 1SQ3A 5J9VA 3QHCA 1O1YA 4A25A 2VXXA 1P81A 2C6RA 3AJQA 3AK9A 1ONSA 5J8WA 1IPHA 1N57A 1K9VF 4Z5SA 2AB0A 4Y1RB 2A9VA 3PQ8A 5D8SA 2IU2A 2C2FA 2GYDA 2FFXJ 4M35A 3R2LA 1QYBA 3UOFA 5CZUA 3ZJ4A 5CMQA 5HJHA 2R1VA 3SIDA 3L18A 4UNIA 2FG4A 1KXJA 3R2RA 4ITTA 3CZAA 3ER6A 2ZUVA 3QHBA 4AM5A 3RHTA 3AJPA 4TOBA 2R1TB 3UK7A 1S2ZA 2CEIA 1RCEA 5LBHA 2Z90A 4MUDA 1XZ3A 3RGDA 3IS7A 2CLBA 4CYBA 2R1UA 3CZ9A 1OTKA 4CVTA 1QDLB 2CIHA 3GHQA 1TK6A 1PE0A 4WINA 4XLLA 2CF7A 1I1QB 3MPSA 3WVWA 2FJCA 2ZUUA 4ZGGA 4LQJA 1VCMA 4LGYA 2G4HA 3P9PA 3TA8A 4IWKA 1JIGA 4ZL5A 4S0ZA 2F7NA 2FEXA 4MN9A 2HTNA 1Q7RA 3KA4A 4AULA 1GPWB 2GS4A 2C2UA 1CF9A 4OJYA 3HIUA 5GN8A 1YUXA 4M34A 1R03A 4MKUA 4ZKXA 1VEIA 1XZ1A 3PW1A 5SY9A 3T9JA 2ZA6A 1JVNA 1I7QB 3NORA 2D5KA 2Z6MA 3PWFA 4MGHA 4II4B 3SH6A 4DYYA 2JD60 3NP2X 3PQ5A 3EZ0A 1Z6OM 4LQNA 1U9CA 3IQ1A 3B38A 3RD0A 1OX6A 4RC5A 4Z3BA 3PQ4A 2H2WA 4ENVA 3E1PA 4ETRA 3SHXA 3R2HA 4EVBA 4CMYA 4TOHA 5GU3X 5J93A 3MGKA 4MJYA 1YUZA 2OR3A 5BV2P 1MOJA 4ENRA 1IERA 2V2SA 1OY1A 1QVVA 4P18A 2GK3A 4OIFA 3BVLA 5SY6A 4OGGA 3Q4QA 3E1QA 2Z5PA 4AJ9A 4RC7B 3QB9A 3EFEA 2CN6A 2ZURX 3PW8A 4ISPA 2VPIA 4K2HA 2ZG9X 4ZTTA 3CYFA 4B2YA 1KWGA 3R76A 2V2MA 1CS0B 3KKLA 3F33A 1J30A 1RYTA 3TTXA 1DPSA 3RBCA 4DI0A 1QVZA 3NP0X 4M33A 2R1VB 3QZ3A 4ZL6A 2CHIA 2XJMA 2VDJA 4MNTA 3E1JA 5ERJA 4CVPA 3TTWA 4TOFA 3ISEA 4ADSG 4DZ0A 3NVAA 1O9RA 2VKTA 3L7NA 3GE4A 2RK6A 4TOEA 1JGCA 1YV1A 1GWGA 3BVFA 1PDWA 1MFRA 5C6FA 1GGKA 3EZGA 4U3GA 3PVRB 3PWQC 3ERZA 1FYEA 4P2GA 1S1MA 4ZJKA 2VRNA 1VJXA 1BCFA 3N7TA 3AF8X 3ISFA 2GHRA 4GE0A 3A9QA 3ZR4B 1PV2A 4ENPA 1I7SB 1KEEB 4ZKWA 3F35A 2YWCA 4ENTA 3TTUA 2WLAA 3BKNA 1JREA 3UGJA 4Y08A 5SY4A 2V2IA 3L4EA 2XJNA 2V2NA 3PW1B 4R7GA 2XF2A 3TTSA 3PWQA 3L3BA 2FZFA 3UJNA 1DATA 1P80A 2ABWA 2Z5RA 4B40A 4BIMA 3E1LA 4MY7A 1J42A 3OT1A 1JI4A 3GRAA 2NV2B 2V2PA 4TO9A 5D8RA 1GG9A 2YWBA 4L95C 5LS9A 1SOFA 3PVTB 4OYNA 1C3OB 4ZMCA 1L8HA 1VHQA 2V2OA 4ZLWA 1JI5A 5D8OA 1GGFA 5LG8A 2OH3A 1NF4A 2RK4A 3M3PA 1VEQA 1QF7A 4OGFA 3F71A 1OX4B 3F34A 4YKHA 5I4JA 3VU3A 4ZDKA 1C30B 3WVVA 1IZZA 4KVSA 4AUMA 1GPMA 1UMNA 1TKOA 5HQOA 2XKQA 4RC6A 1UCFA 1LKOA 3H7GA 2WJZB 4OFWA 2D7JA 2OC5A 4LQHA 4MTCA 3HL1A 1RCGA 2YJJA 2YWDA 2VXIA 3AJOA 4Y1FA 4P34A 4LYUA 3NONA 4AM2A 2BKCA 1P7ZA 3D54D 4QYTA 2QQYA 4JQSA 1JKVA 3KX9A 5GU0X 4CVSA 1CE8B 3U90A 3WFZA 1VLGA 2V15A 4LRUA 4ISMA 4KVRA 2ZA8A 4I2NA 1WL8A 5GU1X 1S3QA 3R2KA 4UZSA 2WTLA 2CN7A 2JD80 3PVYA 3R2OA 4EVCA 3FVBA 1NNQA 1IZYA 2CLUA 3NOVA 4ENQA 4KVQA 4ENSA 4QYXA 5D8YA 3PQ6A 3GVYA 4EVEA 3OJ5A 1VCOA 3FIJA 1NFVA 3KXUA 5D8XA 5FEJA 2WLUA 3E6RA 3UMMA 5FFEA 1FHAA 3FSEA 3OGHA 3EN0A 4CVRA 4CY9A 3Q4OA 2ZUWA 4QUWA 4WXYB 4L78A 5IP5A 1HRSA 4UCFA 2ZG8X 3SE1A 3F38A 1TKPA 4LPNA 4CYAA 4ITWA 1ZUJA 2QF9A 1OI4A 2FL0A 1BG7A 1Z6OA 4DE6A 2YW7A 5AXSA 3E1NA 4XKSA 5JKMA 3OT1B 4REUA 4ZDJA 3F37A 2ITBA 1S30A 5JKMG 3TTYA 1B71A 2AD5A 1DVBA 1BFRA 3E6SA 5FFCA 1VCNA 4BTEA 1FY2A 4PGIA 4ZKHA 3AK8A 4BFLA 3NOZX 3F32A 5JZOA 2XJOA 1F30A 4R42A 3IS8A 4EVDA 2YW6A 3PQ2A 3UOWA 3AF7X 4L7QA 5K4AA 3PQ3A 1SY7A 1KA9H 4CMYV 2ZA7A 3RAVA 4N0MA 3BWEA 3E1MA 3EZUA 4HCJA 5GN8B 3B36A 4P35A 3Q4NA 4GE3A 5K53A 4I46A 4B7AA 4LYXA 1L9XA 3TTTA 5FFBA 1R9GA 4Y1GA 1LB3A 4P5PA 4AM4A
chains in the Genus database with same CATH superfamily
3O7RA 1GN9A 2DWOA 2JKZA 3BFPA 1CR1A 1QO7A 1BVUA 4GYJA 4ZRNA 1YQUA 1QH0A 2YY7A 1W34A 3U62A 3RSGA 5HIKA 4QSMA 1H0KA 3HB1A 3RKUA 1F0NA 4OIMA 1K88A 4BGVA 2O8DB 1QGUB 1NXQA 3GCXA 5JZMA 3E22A 3EXAA 4E6KA 2JLSA 4OJTA 1QQBA 4UOZA 3OKPA 1Q0TA 5E1UA 1M10A 1XNQB 1RBMA 4FHCA 1NXOA 2DHQA 1MZVA 3FUXA 4JJGA 5EY5B 1GAJA 1E8DA 2NO7A 4P82A 5THKA 4GVPA 1XLVA 2BL4A 4HAIA 3TL3A 1J2JA 3TSCA 3ZWVA 4D3XA 1KJZA 4DM7A 1U2GC 3EVTA 4WA8A 1ZNZA 5B1EA 3L1HA 3DEFA 4BVGA 2Z83A 1R0XA 4RTPA 1JA0A 1R0RE 2D2FA 2P78A 3GLKA 1KDYA 3R41A 4O4LA 2VCYA 2VJOA 3O4GA 4Q1CA 1MXHA 3AR8A 4JSRA 5CHEA 2WWXA 4C6HA 1GTJ1 2HDHA 4ECEA 2QYOA 3SHFA 3L8EA 3ND8A 2AFHA 4DCSA 4HMQA 3T3IA 4EYEA 2I0FA 4N5NA 4OQLA 3H13A 3KZKA 3LUDA 1U0FA 1N2BA 1O3YA 1OYWA 1T1JA 1HQDA 2RGWA 1OV4A 1NBIA 3BH0A 2VUUA 2IE0A 3D6FA 3DMRA 1Z4QA 4WVLA 5CLIA 2GSWA 3TQTA 3R74A 1V8OA 3EYWA 1C14A 2QIPA 2YDYA 1WDMA 3BTOA 4LRSB 1WXFA 3VPBA 4DMRA 1WHTB 4HWOA 4MOWA 4ALKA 4ZOBA 3IUSA 1BGWA 1J25A 4MROA 3Q72A 5K05A 4KRXA 4U5QA 1E3WA 3WSTA 3T5DA 2HR5A 2V97A 3UHJA 1NW6A 3Q5GA 1WXXA 2DBYA 1E0SA 5DFAA 1JQDA 4RY0A 1JZTA 1K97A 1QIEA 4FDLA 4M9RA 4OYHA 4CIBA 4XQEA 1RRPA 1F7UA 2ZS7A 1V5GA 1ZD8A 2NQTA 3L6BA 3AHGA 4I9FA 4CFYA 2FFRA 3LUBA 2Q6VA 5IJ9B 2J7KA 1A2OA 4IX1A 3F36A 2Z4TA 5EC8A 3R6LA 5I9NA 2WF9A 5HR5A 2AMVA 1NUUA 1BA3A 1CJKC 4LZAA 2QVCA 2ZROA 1I4WA 5ER9A 2GEUA 3P0HA 1PJSA 2PMEA 4LDJA 1JPVA 1KR5A 1QS0A 2IIQA 2KHZA 3G3EA 4BFVA 3I76A 2FZKA 3BE4A 4X63A 3AGQA 3FNIA 1VPDA 2O06A 4EFDA 5BN1A 1UEXC 3N87A 4M1QA 4ERNA 4C04A 3PE4A 1GNPA 1NQUA 3IC5A 3OLCX 1G66A 1CDZA 3CR8A 2I2XB 3PCXA 4CQLB 2X41A 2RGDA 2R79A 2YXLA 1JV2B 4GR9A 1KQPA 1N6PA 1B42A 1LNZA 5JAMA 2LIVA 3S40A 4BCBA 3T5MA 3OQNA 4ZTUB 2H2HA 2I4LA 4XWYA 3HMQA 3IT2A 3K0KA 1ZH8A 1Q3HA 2VQDA 1II8A 2X4IA 1HQCA 1C29B 2NQ8A 2YFQA 3LE8A 1I2CA 1DJPA 3LHKA 1QCDA 3D8HA 3QFFA 4KR0A 4MW1A 2G9QA 5D7BA 2ZIUB 3QPAA 2PEYA 2OXIA 5ITZB 2R5NA 1X6VA 4GAEA 4ESHA 1Z22A 1RJFA 3I04A 3JQAD 2RKOA 4QXPA 3SZMA 1RI5A 3HCDA 4Y1EA 3WXMA 5HJFA 2X0NA 3HSKA 2V4UA 1PKEA 4ND2A 4PZCA 4ZQCB 4AWAA 1ACLA 1GQSA 3A68A 3NBXX 4M0MA 2XY4A 4D9JA 4FFMA 4OMFG 3VYTB 3NHRA 1R5BA 1KIAA 1RAGA 4NBWA 5GIOE 4TOAA 2LE0A 4MVJI 3AX6A 4RDHA 1S5PA 4QD3A 1V11A 1J8VA 2ZG7X 4YJ3B 3R0VA 3CZMA 2UUAB 2G9UA 3RVDA 2E49A 3EDOA 5HFNA 5JVDB 3E35A 4S12A 3DF9A 3HK2A 3CRRA 4A0FA 3DBLB 1RMTA 2OVFA 1PNVA 3QVKA 4FHDA 4Q4JB 1LLDA 1OPXA 3HY4A 4GT1A 4R1MA 1MJGM 2QYTA 1UJMA 5EJAA 1VIYA 2BFEB 5AJYA 1FFAA 2OHFA 4IEEA 1H2RS 3I3SR 4L8YA 3Q7EA 2IW1A 4RELA 1AQJA 1YJAA 2GAAA 4LPJA 4NCNA 4IHJA 2VJYA 4W7HA 4DC1A 1T3SA 1O1YA 5EXEA 2D5BA 3W4IA 2C9MA 4DA8A 1X15A 4JJFA 4A9AA 2FMFA 3G5LA 3O8CA 3F7TA 4WVFA 1FMTA 1IZ9A 4LI3X 4RZ3A 4YT8A 3QXSA 3KALA 5TJ9A 3ABOB 4ZEXA 3D02A 1RP7A 1VJGA 2EJCA 2NX2A 4PNZA 4ZARA 4LYJA 1ODTC 5HF9A 1FNNA 1XCJA 1GDDA 3EULA 4E0BA 2XE7A 4F46A 1QF7A 1ESZA 3RRYA 3OLVA 4ZAYA 5FTJA 1QYBA 3NYRA 4MS1B 3OZDA 4HQ6A 1EVJA 5TSDA 5DM1A 2W71A 3K2EA 4PWZA 3CUKA 2B3DA 4AM5A 1NZFA 3LP6A 3QELA 1IBKB 1S8NA 1FLVA 3ENNA 1WCWA 3L1UA 2G88A 4OD0A 4LV8B 3MT8A 4Q4LA 5SZJA 1D2AA 5EWJB 3VAYA 2XE6A 5JYBA 5EG5A 3NCHA 5L40A 4K9RA 2Q3EA 2AG5A 1DT3A 4YUXA 4UW9A 2GD0A 3UUWA 1JMKC 2JFGA 3IODA 5EJEA 2R1UA 4CR7A 1EWKA 3PUVA 1ECBA 3LOUA 2ZIAA 2ONKA 4N0PA 3AMVA 1Y5MA 4X85A 5E6RB 3DKKA 1PQUA 2Z09A 3FBTA 2VFAA 2ZJ7A 3IAUA 2CYBA 4ZI7A 5BPHA 1KI6A 1KEZA 1X9IA 1ZC3A 2JCBA 2QTGA 3B1WA 2MTBA 1MO2A 2G9VA 4RKQA 1S2OA 1T13A 2Y4OA 4G5OA 4M49A 2H48A 3FCXA 3MBOA 3QX3A 1KFCB 2I6QA 2AFVA 2XB6A 4MWSA 1HEIA 2FEXA 3N7UA 3AF3A 2RAUA 1T9BA 1X38A 1Q7RA 2ZYVX 1R10A 1WB6A 3IAFA 3Q1KA 4QUBA 3TIGA 4R98A 3TW8B 2OE2A 3UAGA 1R1DA 4N4AA 2IT1A 5CFMA 3DLPX 1XEXA 1GARA 1H42A 1Q14A 2JZNA 3G23A 1BMFA 1G9XA 3SM3A 2Q45A 3LRPA 3UMRA 3FTDA 2HREA 3R09A 4A0SA 1U2SA 1IY8A 2FWRA 5CPBA 2IHKA 1Y8ZA 1Q92A 2OOKA 4UPDA 3D3NA 5FLEX 3V9PA 1ZD2P 2G3YA 2OHGA 2VPTA 3MTAA 4OJMX 5FKJA 2IP4A 2FUKA 1LS6A 1OI3A 4B17A 1WLSA 5CCDA 1DWPA 5ARBA 3R23A 3UM9A 1U1CA 4RWZA 4ZREA 1W0CA 4LVNA 1NVAA 1AK2A 4NJOA 5IH3A 3QA3E 2YWGA 1XB2A 1CJMA 5CAEB 3IS3A 3CX6A 4M8LA 3BWVA 2ZSBA 4WJZA 1C9YA 4YJHB 3WJ1A 1JQKA 1V8BA 3MUNA 2EKPA 1DU4A 1YXMA 2O5RA 4M83A 1D7OA 1DLIA 1E2PA 3EOAI 1LJLA 4UBNA 3WJAA 2WSBA 2X0EA 3RUPA 1LLFA 3LDHA 4UFNA 1YZNA 3D4OA 1K6JA 1KI8A 1U04A 5C8XA 4CM8B 3OUTA 2D1SA 2I3GA 3Q4QA 1CR2A 2O50A 2W6MA 2WF5A 5FQOA 1OFIA 3V46A 4BLOA 3QB9A 2TMGA 3V4RA 2O8FA 4FNMA 4HDQB 4B84A 4CL8A 2VDRB 3QOFA 1NFQA 2A5JA 2OAEA 4MUXA 2ZG9X 2D00A 3GDGA 2NO5A 1Z6AA 5AKIA 3V3TA 4UFOA 3VKUA 2CNWD 3ZE2B 1EXDA 4RSRA 1J0DA 4CKBB 3DXYA 5A0FA 2QM8A 1MX5A 2MMCA 4O0MA 2PRJA 4WKPA 4J75A 4MW9A 1P1FA 1HORA 4JYMA 4ZT5A 2CV1A 1C8LA 2OD2A 4G4SP 1LBQA 5JBQA 1W5EA 1N7JA 3V4FA 3CEMA 1GZ7A 5A7HA 2XPCA 3GLHB 4DG8A 5LBTA 4QRIA 5AUPB 1LA2A 4XQ9A 5IYZB 4MNTA 3OQ6A 4CL0A 1IBLB 3ZCUA 4Q19A 2BGWA 4CVPA 1SUBA 2Q6IA 1H5QA 3IDOA 3QMVA 3ST7A 4BFXA 1VSTA 1A71A 4V0NA 3GNQA 5AOVA 4C78A 1ZAYA 1CUHA 3MTQA 4YAUA 5IUJC 4RVDA 3L7YA 5DHQA 3H8WA 2ZJOA 2VJLA 4BMOB 3VGPA 1QANA 1RXCA 4KVGA 5IKXA 4J2HA 1OYOA 2OLKA 2QTAA 2FSGA 3HO8A 3IL2A 4P93A 5DYWA 1PDOA 3ER9A 3O1IC 5IKEA 2ZI5A 4NFSA 1K86A 2JIBA 3IAXA 1FFEA 2RCYA 1UBFA 1OXKB 2GCOB 1VMKA 1ZCAA 1QH1A 2QX7A 3DKVA 3MJRA 3UAYA 1TLLA 5JASA 1ZCFA 3NVMB 4B6PA 6GPBA 5EMKA 4EELA 5L7TA 1S8OA 4P5EA 3WA6A 4GVLA 2WU1A 1EP3B 3BG5A 3PU6A 2QVZX 3TQOA 1YZTA 2YRWA 3WBKA 1O95C 3VZPA 3AHEA 4N8SA 1YFLA 3O83A 1XNRB 4JU8A 4PGGA 5CB4A 1GUBA 1I1HA 4FEYA 5IKPA 1Y1PA 1TK2A 5ALYA 3UV7A 1CS4C 4US1R 2V2NA 1JDBB 1RIFA 1NJ1A 3JS5A 5DBOA 4O4JF 2RHJA 1UMCB 2H7CA 1P3DA 4GXNA 4LNHA 1DATA 4X0JA 5DTQA 4WPGA 4JROA 3GGZA 4PQRA 5C3MA 4RIFA 2NVWA 2B9EA 1LV8A 1J42A 1N3BA 4FEEA 4TMWA 5EHQA 2XSZA 1T6NA 3PFBA 2EWMA 3JWGA 1HYBA 3ENVA 4O1HA 4QO8A 2FB9A 3Q15C 3RVMA 8AT1A 1F4PA 2QZPA 3QZUA 4YQFA 3T54A 4RACA 5JNWA 1E32A 3MBIA 3KSDO 5I9TA 3SHOA 2GTHA 2NPFA 3NKLA 3R7WB 3K5HA 1SVSA 2ZTUA 4IJUA 4QJBA 2QY6A 2XUHA 3TKAA 2PXXA 1FFXB 3T9EA 3TQRA 3NVKI 5B36A 4K1XA 1AHNA 4QFCA 2Z4SA 1LKZA 2HMAA 4AUMA 2JIZA 3RTGA 1UMNA 1CVRA 2EG9A 1U8CB 1IRXA 2EEPA 2PEZA 3ORYA 4YO7A 3KQHA 2KSQA 1NW5A 3SXPA 2UVPB 3A6HA 1WP4A 4JI8B 1AQ6A 4TYWA 3EA5A 2GEFA 1XALA 2H1VA 3AI1A 5B58T 4HTAA 1P5RA 3UV3A 3DFMA 3PE3A 4KP7A 5LBIA 5JCJA 2B1GA 2N47A 2GBIA 2VAXA 4A15A 3HZZA 2KE5A 4MUGA 2C5HA 1IPEA 4Q16A 3AR3A 1FP7A 3QRWA 4JC5A 4DCPA 1DQRA 1QRDA 2CHQA 3UGKA 3ISTA 5B57C 1YH3A 2V4ZA 5ALIA 1OUMA 1K68A 4E5DA 4AK9A 3UMJA 1LPPA 1PTJA 4BEVA 2BRUA 2O05A 3SYTA 1JKVA 4B6SA 4B32A 3U90A 2A30A 1VLGA 1Y7PA 4F2PA 5C7OO 3NEYA 3HJUA 4C7XA 1JECA 2ORIA 2WFLB 4KE7A 2V15A 5BWMA 5M04A 4N1AA 4D79A 1CETA 4D3SA 3H2KA 5TARA 4UZFA 4DJAA 5C5DA 2QSZA 4G0XA 3BRWD 3I1YA 1CZLA 1Q11A 3Q2IA 4UZSA 2PZ8A 1XAIA 5DTIA 4CFSA 1HQKA 1WVGA 4KVQA 2G9RA 2VP0A 3LTNC 2P79A 5EQDA 1OH8A 2ZRNA 1KKUA 5FEJA 1G8GA 1ECCA 3I83A 1QDEA 3PUKA 5BN4A 2O52A 3L49A 3NHKA 2H07A 3ZHXA 4D9MA 1SHLA 3FSEA 1B6GA 1Q83A 1NI5A 3GUVA 4FYHA 4HLCA 2GUGA 3ZU6A 2VYNA 5JNRA 2FN7A 2IXGA 1LEHA 5K3AA 2Q50A 2ZG8X 1N5KA 1UINA 4J6FA 2EJWA 5I51A 2ZUFA 1ZLYA 4M87A 4QJIA 3A6PC 2YNMD 3RWMB 4MJ3A 3A4MA 2UV8A 2DSNA 4ZIRB 1PX2A 4M98A 1P4GA 1NMQA 1OI4A 1XU4A 4MQFB 5CYFA 5DVZA 4C1BA 4PY2A 5TGTA 3DSRA 2JLBA 2JHPA 4AB1A 5GOZA 3OU6A 2D06A 1VA4A 2IYUA 3DZIA 4MPDA 4R2WA 3VDQA 3TR0A 2FXIA 4MITA 4HH3C 4XKSA 2CE2X 1VL8A 3QPVA 1BVYF 1C0LA 4XFDA 4NZNA 4TLLB 4FGUA 4J29A 3JYNA 1CTQA 4B2PA 2NQ2C 2DHCA 2V58A 4J7AA 1C0EA 1BFRA 1M2JA 5IC5A 4BGDA 5HDQA 1X7XB 3SJBA 2PMWB 3V2UA 5TC4A 3WADA 4ZKHA 2W2LD 1U63A 3NDPA 2IBTA 1F1JA 1G8PA 4M2LA 3AHFA 4C7MA 4NI5A 1A95A 2XMRA 3VR3A 2OO5C 3C5HA 1EE1A 5JYDA 1SUSA 1SB8A 2X9NA 3LT0A 1IG0A 4GECA 5DHRA 2X4LA 3ZK9A 5DM70 1CEEA 3FPJA 3B12A 1V5FA 3T1OA 1RD4A 3RBVA 3SZOA 4PCUA 4I7EA 3WHKA 1GKYA 2OHJA 4DA7A 3KTAB 2XUAA 2XUKA 2BN4A 2GQ0A 3B36A 4BYGA 3AVVA 4JY7A 3NW9A 3C4VA 5MGBA 3BXZA 4I46A 4IKOA 4MVJH 1L9XA 4MIOA 3J81A 2CDRA 1J8FA 3QTLA 1ZK2A 2WJIA 4MR9A 3W1EA 3N0WA 2BHLA 5EZQA 2J31A 1RLTA 3BE8A 1ZSYA 3DHWC 3N3AC 4IEIA 4LCBA 4P5PA 2QK4A 5A4AA 3N0RA 4BV8A 3EODA 4OY3A 3EJ6A 3LKZA 5DYIA 1SG0A 1JEYA 1EA7A 1UP6A 1WUYA 2VCEA 2UZ1A 4PG1A 2HJGA 3G2OA 4HWGA 4BMXA 4DXHA 1P44A 3TM5A 3VXKA 4BJ5A 1TUEA 3L7OA 4PNEA 4NYMR 5C8VA 1EUDB 5L53A 5IK2A 2RDMA 1IHDA 4QRDA 3KIPA 4R3NA 3ZPXA 5LKAA 5GQSA 1YHZA 1S3SA 5FUQA 1ULAA 1FTGA 2EBHX 4OL0A 2BM0A 4BO4A 4K1LA 4E1AA 2IJGX 3URMA 4I5IA 2DVMA 4B8WA 3CE6A 4PHCA 1EVQA 3O8NA 3UJPA 2G38B 1IQUA 3PV0A 1NJFA 4UHJA 3H7IA 4YAJA 4JVOA 4L73A 2WEKA 4JASB 4EOGA 3HYTA 4NYJR 3PKZA 1N9ZA 2P3LA 5HCIA 4WADA 1V9CA 1L8IA 1JNYA 1PO7A 2PMKA 2CL6X 3SKYA 4KV9A 3UW3A 2QVLA 5AXBA 4CLOA 1XD2B 2XCQA 4PAGA 2IYYA 5D3ZA 2ZJ1A 5CX4A 9LDBA 4UXHA 5A62A 4GVXA 4K7JA 1W36C 4DUPA 1R3DA 3UHPA 2DT8A 3MWYW 1V48A 4GXRA 5DXFA 5F5XA 4ZYYA 2V8OA 1ZN7A 3HHEA 1A4RA 3IPYA 4L16A 3AHIA 2F4VB 1RYFA 3OESA 2GN8A 3OZSA 3QLVC 4UMVA 1N2IA 2FZ4A 3BD7A 2UZ4A 1U8ZA 3OY2A 2ST1A 2BUAA 4NAVA 2WDZA 2ZVDA 5EMMA 1DL5A 3GN2A 3IIIA 2PGLA 3RU9A 1F8XA 1UJBA 2C99A 3WV5A 1RW4A 5CFLA 4TRRA 4PR3A 4CJXA 1LDMA 3K2QA 4OJQA 5JNVA 1JS1X 1DOZA 5KQMA 2IYQA 4KIWA 1WV1A 2OQ2A 1CRWG 3D4PA 4DMLA 5EQFA 2BZSA 3UV6A 1E2GA 4WDRA 3QOXA 1B4DA 5IX8A 2XGWA 4LSWA 3ZVMA 4WFJA 5BMVF 2E55A 4Q9AA 4UREA 5DI3B 2J09A 1ADYA 2XYHA 3QEMA 1ZHFA 3TMAA 4DDVA 4DV1B 1XQ9A 1YZLA 3TVDA 3KLOA 5J3JA 3DVRX 1X8KA 4FHGA 3P52A 4PZDA 1YK1A 2VNJA 3R3JA 4JP2A 1M6NA 4IW3B 2I71A 4GBGA 3ZEIA 5D84A 3DBVO 1CQWA 4Y0NA 4YBRA 5FWAA 3SQXA 1OT5A 1T1EA 2YQ5A 1EPUA 4G24A 1JIQA 2P0AA 3VFDA 4M22A 3L7AA 4RMIA 2XCUA 4LPSA 4EH1A 1QPBA 4LSMA 2NT3A 2HZBA 2W6NA 3KEOA 4NSNA 5JSYA 4R7TA 1JPNA 5AKGA 3NX4A 1XVAA 3TGLA 1T8WA 4RGYA 1OLSB 2G5PA 2NSHA 1NRWA 3DE6X 2P77A 3EGWA 4KQKA 5IEJA 3B8HA 4OGKA 2VZBA 3K53A 5SZHB 1I4EB 1Z74A 2PUHA 4PXYA 1RXIA 3RF7A 3TB6A 3D4BA 1CPYA 1YZGA 3GPCA 1CZOA 3FWKA 2XLBA 3GIDA 3HWWA 3LXUX 4RQUA 1UFKA 1LKMA 2M1ZA 5IU6A 1AGYA 2YN4A 3AP1A 3FLAA 3GAAA 5LP6A 3GV0A 2P67A 5CPFA 1UPBA 1X1EA 1CQJA 1GTL1 4WK2B 5LUBA 5FPHA 4C22A 3KKZA 4EAAA 1TT5A 4C9BA 5LG2A 3DAYA 1T6ZA 1WD5A 2PZAA 4ICIA 4S1PA 4E5YA 3DDNA 3N76A 2QQFA 2O5EA 2O4CA 3DJFA 1VMAA 4FK8A 1AQYA 1WV0A 3V7UA 1E3DA 1F0YA 1JUDA 2WRZA 2K5UA 3G1TA 4FMDF 4JI3B 4YXFA 4O59O 5JDOA 5JD3A 5T6BA 4XKUA 1YDHA 3FMVA 5GADl 1H69A 1NW3A 5IVHA 3IE1A 3KQLA 2XCIA 4TV8B 3TBFA 3CB2A 4C5AA 1NVKA 3EASA 5E7MA 2QTWB 2G80A 2WR8A 4JOSA 1ML3A 3HJFA 3I6QA 4PZZA 2IITA 4IDQA 3FDZB 3NGLA 4U3JA 1QHHB 3OM0A 4X3PA 2X6TA 4MEAA 4ZCIA 2IZ0A 4K87A 5ELXA 1SUAA 1DXQA 1VKRA 4J1QA 4LHVA 4M55A 2WAOA 2YFYA 4CLHA 3N2NA 3VR1A 2ZRDA 5J1TB 3TBHA 2W93A 3DBIA 4FC6A 4J4BA 2NPOA 4PLZA 4TTIA 5HJHA 3RUCA 2HK6A 3SIDA 1GADO 1XNHA 1R6XA 2PV0A 3FFWA 5FOSA 1KZ1A 3AR4A 2GEVA 3RNLA 1R0LA 3EOZA 4JFRA 2X5NA 2RC5A 1U9ZA 5JZBA 1PS0A 2QMZA 4JKOA 3CZ4A 2HMTA 2Y0DA 1RLJA 3OJOA 3GAZA 1CJVC 5CP8A 1WCXA 4LXQA 2CSUA 3OM1A 2CLFB 2LDBA 2PBZA 4LC0A 1PL0A 1JFFB 1JB9A 5EHZA 2DFLA 3D6UA 4IIJA 3K9GA 4Q93A 4XJSA 2VP4A 3A6JA 4I5DA 1NXVA 1TZCA 2FPWA 2Q0SA 3A1VA 1EFRD 1MVNA 5AOAA 3FF1A 4DCTA 2WJ6A 4LJAA 5LA6B 4KODA 1IEVA 2BV3A 1PFGA 3WVWA 5FTNA 3UJDA 5DLDA 3E9CA 3PXXA 4FFDA 1GT91 4P0TA 5IAEA 1X42A 2FJCA 4ZGGA 4H27A 2GBGA 3Q85A 3KLNA 1DKMA 5EIBC 2AN9A 3D5TA 4GM4A 2DBZA 1ABFA 3LGXA 5CM8B 4OQFA 4UU1A 1PTJC 1FU4A 2WI8A 1A9ZA 1QBGA 1XVUA 2I03A 2XCLA 3CUWA 4MJLA 4NE7A 5DHAA 2B35A 1E0DA 4F8JA 4X8HA 3RS5A 3GUZA 3KJZA 3AVXA 4YLGA 1KAMA 1XHEA 4UUPA 3SQNA 1YUXA 2Y1XA 3MD9A 5DBEX 2ZFUA 4UKDA 1AKNA 2X5KO 1JHPA 4KAAA 3NTXA 4F2DA 2JPDA 3ZXXA 4O02B 4NR0A 4CLXA 4MIKA 4MWOA 2RHRA 5DP2A 4C0XA 4DA6A 1I6KA 1XJ5A 2CVOA 3LVRE 1GT6A 3ZLJA 1GA1A 1L5VA 2XVMA 4CUZA 1WJGA 1CB0A 2B0JA 3FX2A 4D9KA 1SMKA 5T8KC 2VHQA 1RQ7A 2I4MA 3IB6A 1YVDA 5I5GA 2FSHA 4J9UE 4UM9D 1XTZA 5JS1A 2GHIA 4HPWA 4U6NA 4TYYA 2UUCB 1L4UA 5AKHA 1VL5A 4EBBA 5JARA 1SKYB 3P32A 5J93A 3T9AA 4OAQA 1U80A 1V6SA 3H4IA 4NBRA 4N3AA 2XJ4A 1THZA 4DSNA 1PW7A 4EABA 2NUPA 2OR3A 2DETA 1H2WA 3G6WA 4L76A 4XPIB 1LF5A 3T7DA 4NNOA 2BIFA 1T9CA 4RA6B 5JCXA 4FR5A 2WWHA 1JIIA 1ZNQO 1RWVA 4FPXA 2XTMA 2RHLA 1R16A 1ULUA 2VJKA 4QPPA 1N2CB 4C4XA 3A3KA 3TOVA 1B93A 1TW3A 3EW9A 3HEMA 2QN8A 4RA9B 4D9FA 5KUTA 1T8RA 1YMQA 5J59A 5LZ9A 4HQLA 4OG2A 1WCYA 2WYIA 5AK6A 2AG1A 3DMGA 1O97D 3VUFA 2BFOA 2BDEA 2QSUA 4G0VA 5FV4A 4EHIA 1FDWA 3E22B 1DAGA 3RYCA 1C80A 5L9AA 1GZVA 2WJ4A 3F33A 2VYCA 1UWCA 1Q7TA 3KL4A 4J0KA 1E3JA 2VQFB 1H1TA 1QVZA 3P5BA 3NP0X 1OB5A 1ATZA 3MFQA 3O8OB 1MAWA 1Y9ZA 5SV2A 5DOVA 3QEKA 1DKRA 3NTOA 4HAUA 4RZQA 4DPLA 4ER7A 3AZPA 5IJXA 4K9MA 2O0JA 5T57A 2MJLA 2J67A 1GPDG 3NHWA 3KOUA 3NM5A 1YAHA 2HMVA 3QMMA 4O4LB 4ZDWA 5JHGB 1J39A 3L7NA 1KIMA 1EX9A 1PR1A 3X2EA 1FRZA 4PR0A 4FE4A 1NQTA 2AFHB 3I6YA 3V4OA 1GWGA 1D1QA 1VMEA 2EW2A 5BN5A 3EPKA 1U98A 2Q8QA 3BMCA 4H7IA 2DPGA 2VBFA 1CDOA 3MTBA 1GDTA 3G13A 5KQSA 1UT5A 4KRYA 4R6WA 1WG8A 4R2JA 1XNJA 2X6RA 1USWA 5KNBA 3EGOA 1MZPA 1ZL2A 2GZRA 1N75A 2Q8PA 2XUQA 3I4CA 4KQIA 2E1PA 5JVDF 3F2VA 1XXHE 1EFVA 4O63O 4IFTA 4PHHA 5A9SA 2EWWA 1E4YA 2B69A 4IRMA 2G08A 1R74A 2PKCA 5C7IO 5D6NA 3TCNA 2WLAA 4EM6A 5KX5A 1EX7A 2W2TA 3D1JA 3E8XA 4FQ5A 5SY4A 1N0UA 3JAKB 5CB8A 4QDTA 1N77A 4ZAWA 3OTWA 1ZOPA 3LUCA 4FE3A 4NPAA 2CK3A 4RYLA 1AV7A 4CKZA 5FWYA 2WB2A 3WVNA 1TIPA 1G3QA 2UU9B 4L08A 3TGWA 4X3OA 3CPJB 4BFCA 3F5FA 4Z8XA 1R0YA 4A5OA 3ELBA 2HTEA 3BXFA 1YJCA 2OV2A 4MY7A 2OA0A 3WGYA 1JI4A 2YQZA 3L7DA 2PKRA 2ZTLA 1PEYA 3IILA 4KXWA 4ZOCA 5I9SA 3RT9A 3AB3A 5KVCA 5LXTA 3PLRA 4R8RA 4MVJD 5I8PA 2Z5FA 1QS0B 1VGVA 5IJAA 5TQ0A 3L1JA 1PGQA 1O8CA 1OIXA 1C7EA 1N2SA 3AHDA 4MP8A 4ZMCA 5C8ZA 1XZDA 5F4ZA 5AXDA 2GAOA 1EBBA 2OH3A 2OK7A 1G0NA 2RK4A 2R7MA 3H6GA 3PFIA 2PKXA 4FKBA 4V3BA 5EJMA 3ED1A 4YUVA 1F5NA 3RFXA 3S28A 4EX7A 3GJYA 4PTLA 5FOXA 3I6IA 4TLAA 3IP7A 5F9FA 2IQ5A 1XX6A 3PFHA 1V8DA 2R47A 3E7DA 4WNAA 2VHCA 4BAGA 1PZHA 1P1JA 3LPMA 2NZXA 1IHUA 4N8EA 2FP4B 1BH2A 3IO3A 5EJ9A 4OFWA 3HCRA 3HFJA 3F4LA 3RREA 2XQGA 3A2NA 4H4CA 5C1OA 5F9HA 4IINA 1NZDA 4G2TA 3NS7A 2H06A 1JR6A 1HDYA 3D1VA 1TMOA 1Z5WA 2XBLA 3VU9A 1E79A 4UZEA 4DV5B 4TMFA 1W8IA 1QMPA 4MP6A 2ZR8A 4RPIA 3ZZUA 4DTIA 5BY2A 1Q7CA 5AUNB 1Y6FA 1P0IA 4RF3A 1H1LB 3KOXA 1V11B 4ALMA 3KPJA 1EUQA 1IIRA 2W4IA 3I42A 1K66A 3KYBA 4Y2HA 3KUXA 1B0PA 2BFAA 3LOQA 2MGYA 1SCAA 4OEHA 2YVKA 1CY6A 1GZDA 2ISQA 1IY9A 1Z08A 1PJBA 3F5SA 4AN0A 4F91B 4KGDA 3C23A 1Q7EA 1OV6A 2WIJA 3M4NA 1N7IA 2QAGA 4YRDA 2V96A 2A5LA 1GUAA 3UEOA 4D9HA 4KRGA 4JNCA 1NBMD 3BVPA 5BPFA 3BMOB 4YXWD 4XYMA 4LV5B 2OKCA 4OBXA 2E5LB 1N78A 3CZQA 3UAXA 4DQXA 3RLIA 1RKXA 2C8VA 3OICA 1D4ZA 4G97A 4YPOA 5AHRA 4DYDA 1YT5A 1KQ3A 2WT9A 3FCAA 3NBMA 3ZLTA 1NP3A 2PUDA 1AKVA 1UBHS 2ZYIA 4KN5A 5IUKC 3I05A 3WB0A 2Y2VA 3QUTA 4IR7A 2G4CA 5ESDA 1TIKA 2B7BA 5IBCA 2KMLA 1R6AA 3GOQA 3HYSA 4A03A 3HB5X 2C2BA 4OI1A 2WJGA 5BSVA 3BERA 1L5KA 2H51A 4CY9A 1Z0FA 1XDZA 4J2TA 4RQAA 1DHRA 2QTVA 3G02A 4MQMA 4PQEA 1L7DA 5LOVB 2G17A 1UR5A 3KZ1E 4IQFA 3F38A 1TKPA 2ZQYA 5FORA 1MFPA 5E9WA 1F2TA 2EIXA 1OQAA 3IPLA 1SHJA 2P2NA 3FYDA 3LUFA 1Y5NA 2VWPA 4MV7A 4AICA 4JLUA 2F1KA 5FBVB 1FXWF 3SS8A 4JVLA 2AI3A 4QNMA 3ROFA 2WK1A 3U7IA 4GI5A 5C5CA 1XZIA 4Q39A 1GSHA 4RULA 4R1LA 5FUVA 1UWKA 4D26A 2AZTA 3OURA 3VYSB 1GTG1 1RHMA 1T2VA 3EAQA 2ERXA 3OECA 3GZJA 4PAOA 3T7CA 1SXJE 2ZRKA 4CG2A 5LFAA 1LRLA 1P72A 3LVFO 3BXXA 4ZDJA 4OH1A 3AG6A 2EZ9A 2R6GA 3C15C 2ZRPA 3Q7QA 4R8LA 5ETJA 3TTYA 1FP2A 2ZVQX 4X6UA 1MB3A 1ZOLA 3FYHA 3G2JA 1TDJA 4LJ9A 3NTUA 2EX4A 4KGZA 3GW8A 4L4YA 3ZZNA 4BTEA 1C1YA 3FR8A 4ZI7B 5IC4A 4EVQA 1WTCA 4OL9A 3NBUA 1KSJA 5FDFA 4I4LA 1DQNA 1KHHA 3F32A 1DWOA 2HNAA 4BIIA 5JRJA 3U1VA 5JZOA 2XYVA 2JJ2D 1ADBA 1NOKA 1TJ5A 1HMPA 2X4GA 1P6XA 4FQ7A 1W1WA 4Y2QA 5EXTA 4CMEC 4ARIA 3KD3A 4R1NA 3SVTA 1Q15A 1F3LA 1ZK1A 1L4EA 3O31A 4I8XA 2CZCA 1EUCA 1G1AA 1T1IA 2UZAA 1JHYA 1HDIA 3ADDA 4NVRA 2FPIA 2A84A 1PW5A 3FDJA 3TR6A 1OXBB 2GTPA 3LSTA 4HZUA 3H5WA 4ZZIA 4YMSA 1CULC 2ZKLA 3KO8A 1N0VC 2ZSDA 5TGDA 1NNLA 2PSFA 2NYAA 1N5DA 3DNMA 4OHMA 4EWLA 1EDBA 5KTNA 2B94A 4L15A 3KV3O 2DFTA 1Y7TA 2AWOA 1TTPB 1T0JB 2X40A 3NOQA 3P97A 2ZSUA 4HXYA 4W8OA 5DASA 2UXDB 1WZ2A 3MNFA 1PBNA 4X95A 3TQHA 5LQNA 1F5SA 3DFIA 3EOBI 5MN4A 1JR3A 2FHAA 2D5IA 4X20B 3X1WA 1N36B 5GP1A 4RFSA 4MCJA 1MT3A 3B1VA 1XD9A 4RPHA 2BGRA 1N5IA 4CTKA 1GITA 3QSYA 1BJKA 1GP2A 5LDHA 5K8IA 1AKYA 3E15A 4HUTA 5ADWA 3A0UA 1ZW6A 4QECA 1YDEA 3Q3JB 4FHEA 1PL8A 3NBQA 3FDFA 2VRCD 4Z2YA 2DY0A 4IIDA 4OBEA 2ZYWX 4A23A 2BEJA 4WERA 3HB9A 5FUYA 3GUCA 4U02A 2PGNA 4R16A 1ZS3A 2EFYA 3NNDA 5IJ0A 3WQBA 1HETA 4EMUA 1QX4A 4O2RA 3NOXA 4XQ0A 3UYLA 3M8KA 5JPDA 3GEMA 3AZOA 5EMNA 2Z56A 2O8FB 2Q21A 4H3VA 2MDTA 2OHOA 2YOFA 2OGWA 1OAKA 4HNVA 1WZUA 1NF2A 2KB0A 4UOQA 3WRXC 1G7TA 3AKZA 1WXWA 3TDMA 5KYXB 1X0VA 5FPQA 1OTHA 1AO3A 1OWPA 1Y42X 1W85B 2Y76A 1N5MA 5EPOA 3W5VA 1EEXB 4YCSA 2EKLA 4BFTA 3EGXA 4GUAA 4R1QA 3B9BA 3S5UA 4ND7A 2OL4A 1JEQB 3A1SA 4Z0PA 5TE9A 1QP7A 4KX5A 2NVOA 2OXTA 5EUCA 4N12A 1TADA 2OSVA 3FD8A 4PV7A 4BO8A 4JGGA 2IX3A 1YVRA 2M32A 2G1KA 1JKUA 1TAQA 3OFNA 1UFQA 4C30A 3R7SA 4CV1A 1FIUA 2VF7A 4BB6A 4QWWA 1QQ7A 2BH9A 3PX2A 4P22A 1Y9EA 4PRYA 2BZ1A 2NUBA 4Y8VA 4RADA 3CLHA 4E3ZA 1YRHA 2X0IA 2XUJA 3PNSA 4Q82A 4URWR 4ER5A 1G8HA 2BM9A 4L6CA 4XIYA 5E9AA 2CJWB 1GVNB 2VH5R 2P5TB 3WRYC 4M1YA 2XXAB 5DLPA 5MN5A 3CF6R 1GAWA 4M1SA 4XJTA 3BD9A 2YVAA 4QU8A 5EE1A 5FNZA 5IWCA 2GYQA 1X74A 3GXBA 1XQWA 2BT4A 4L8FA 1QYXA 4I5FA 2HLDD 4CDMA 3OZCA 1E9AA 4ZYTA 1KH3A 3EEQA 3NBYC 1ZONA 4KK3A 1E66A 2ZWOA 1D0VA 3KKKA 1P0MA 4LJKA 1E2UA 4BNVA 2IZ5A 1GQ2A 4DR1B 5CB4B 1YIAA 4XOUA 3KETA 1FPQA 3LLSA 1R4NA 1VYTA 2GN6A 1N1DA 4JMLA 3UWMA 1YRAA 3TFOA 2EFJA 2BCJQ 2OBNA 5K3BA 4FBLA 4DZRA 1H3EA 3M6JA 2WBLC 4RD1A 1OA0A 2QUAA 4HH0A 4JU9A 5H68A 2Z6QA 4YV1A 3RS0A 2ZTVA 5J2TA 3F39A 1GYRA 3IOYA 1DTEA 3R0JA 3SEQA 3FPHA 3RCBA 4RABA 2XB4A 4X5OA 3ETLA 5I7SA 2CVQA 1CR0A 1HZZC 2QLLA 4LYFA 1Y3DE 1KZ7B 2ZPAA 5MFZA 4LF6B 3COYA 2YH2A 4Q3BA 1STOA 3FBGA 2QR3A 4HAZA 2QRHA 1JPUA 1PK7A 2XXBA 3LIPA 4G81A 1XVIA 2QW1A 4OLBA 2PZBA 4RZIA 3O9ZA 2PHZA 3W4JA 3HV0A 3HEBA 2ZVJA 2JVKA 3GLFB 4JZYA 1IDOA 3KA8A 2PBLA 3PDWA 1NSTA 3H6KA 4B4VA 4KJXA 3OQMA 2YVQA 2EKQA 1HDXA 2ODAA 3OQIB 3R3HA 4W4TA 3WGLA 2ZOSA 1RSZA 4V0ME 4ZKEA 1HTWA 5ALXA 1YJ5A 4MVXA 3BKWA 4G4SO 4KPYA 1T1GA 4J07A 4LDZA 2VEDA 4TWBA 1R8XA 4N3NA 2ZU6A 4WZAB 5LQDA 3TRKA 4KBGA 1L5RA 3MTJA 1Y82A 2ZG6A 2PRKA 1C50A 3EZ7A 3EMBA 3HFRA 4L7VA 4MW6A 2FKZA 4PQGA 1Z9BA 2JGJA 2WVHA 4N03A 5DN9A 2PUGA 1XMIA 2YN2A 2C3OA 2IHJA 2X86A 4R9SA 3U3KA 1X7DA 4EY6A 1TZBA 3OZTA 1C7ZA 4IFEA 2FPLA 4MSUA 4PC7A 5EVCA 1BCRA 2OFFA 4F86A 3U60B 4TT3A 4W7IA 3B5JA 3ZOKA 4YCCA 3GPDG 4XYBA 1OFTA 1K9VF 2CFTA 2I4NA 1S8AA 3LBFA 4I4CA 3KAPA 3VSDA 3FVTA 4MLCA 3T5AA 2RG1A 3HCEA 4FONA 2GD2A 2R4TA 1OWNA 3QVGB 4KUGA 2FFXJ 1R5NA 3N1UA 5CMQA 1K0FA 2B5VA 2JKYA 3B48A 5AH0A 3D3WA 1XTBA 2F7SA 3L18A 3ZWWA 2C2WA 3GEIA 3EH1A 5TT1A 1RIIA 4AN4A 2ZUVA 5H70A 1AUOA 5A04A 1M1NA 1I2MA 3S6JA 1GFZA 3GZ4A 1Z5ZA 2CEIA 4MJXA 3ZN2A 4KO8A 2WV9A 5TQ2A 2R2AA 4NFYA 1VG1A 5AI4A 3NXKA 4AS3A 2PQ6A 2GI4A 2Y1OA 3ILYA 3KFVA 3CM0A 4IVPA 4QQFA 4PG8A 1BN7A 3L1KA 2HA5A 3EYAA 4QQKA 4FYYA 1JEDA 3ME5A 2AOTA 1I1QB 1T4CA 2IRWA 4QOHA 4RU1A 4UUOA 1LS1A 5TMEA 4EYGA 4WNIA 2ZETA 4FYJA 5HHTA 5JRZA 4BNGA 3MYRA 1RRCA 2WWFA 4TXLA 1G4AE 2L2QA 3RJTA 3WP0A 3ELDA 3W9SA 3KB8A 3TLAA 5KTPA 3K71B 2ZAOA 2P6MA 1YIOA 3P9PA 4F9TA 1QYRA 1WABA 2AFIB 2AHRA 4JI1B 2R25B 4N65A 3VH1A 3DVLA 3DAHA 1VGRA 2F7NA 1Y8AA 2FUG6 3FZEA 3IURA 2AJBA 3NPAA 4JA0A 1F6BA 1ZPDA 4P4NA 4B9EA 2WAXA 4AULA 4BLVA 4D7AA 5CW1A 4P0QB 1F8UA 5LBUA 4EEZA 1DZIA 1CF9A 4YA6A 5KU7A 1NNUA 1OH7A 1O0CA 5GN8A 5EJIA 4DUGD 2ZWAA 4PZUA 3RHZA 3OPXA 1VEIA 5ALEA 1OWOA 1SUWA 3RSZA 1M2HA 3UOAB 2LCIA 3TAXA 4TV9B 2Z6MA 4LF9B 2YMMA 4ZHQB 4D4GA 2HJ9A 2ZYHA 3PXDA 3I2GA 5D3KA 4DYYA 3PQ5A 2BSAA 1OH5A 1AM4D 1LRJA 2IQIA 4IJQA 1M8KA 1SA0B 2F3PA 4CCYA 1GSIA 5F77A 4QXQA 4Z9FA 3ZU4A 3LQFA 3I9OA 3GAFA 5GWXA 2WT8A 1OA1A 3QPBA 5A1JA 1Z45A 3C5CA 5CX1A 2XA9A 1ONBA 2HPHA 1VPWA 1UIMA 4R8VA 4E03A 3ESBA 3IVXA 3PJFA 3IJEB 1Y4UA 1JQJC 3LUGA 1KJIA 4I6EA 4M76B 4MGZR 5GAJA 3K0EA 4L5IA 1IMJA 1Y7IA 3LLVA 1YI8A 4P98A 3IR7A 4PFKA 2WA2A 3L4BC 2O0KA 4KQJA 2FSIA 3VNSA 2JLUA 2XDQA 1DEOA 2C5EA 4IRXA 1OFUX 2GZ1A 3P20A 1DIGA 1LZKA 3V4SA 4QOGA 4YRZA 1NXSA 1L2TA 2ODEA 4MR9B 2EARA 5G40A 2EJVA 1JHQA 3QE4A 5AM2A 3BVLA 1V35A 1V4BA 1VC2A 3FRRA 3C16C 3G8DA 3IDFA 3N07A 4HH1A 4WN9B 2WHPB 4AJ9A 2B1IA 3DD5A 3B5EA 5IRCD 1JTVA 1Y81A 1W25A 3ZYCA 4MYCA 4GOLD 2RGXA 2ZT6A 3FLEA 4L85A 4XDGA 1GPKA 4RY2A 3WGHA 5JJKA 2EKDA 3U61B 1E59A 3LKBA 1AD2A 3W5SA 1E1DA 1RYTA 4QLAA 2B2CA 3EIFA 2GSDA 4I9GA 4I3FA 4XDYA 4BJ6A 1F7VA 1HXHA 2CUNA 1DEKA 2CBXA 2AF3C 3O26A 2H52A 2ZPUA 1VA5A 2PJZA 4TL9A 1UJ2A 4QVKA 3RSQA 2OB1A 5AIBA 4LDAA 1XAGA 3R0ZA 3DTVA 5DLEA 4KN8A 1FLDA 1KZ6A 3CZCA 3LGSA 2XEDA 3QVJA 3EARA 3TPFA 4KPFC 2AF4C 2RJOA 4LOJA 3AJEA 5ANRB 3DE2X 2XRYA 4TVSA 2GAJA 2JBHA 3OMLA 4TOEA 4NNPA 4GMKA 1PVOA 1DELA 2HQ1A 1JHUA 4CLOB 3V8RA 5IT5A 3QX9A 3WICA 3W9UA 1GNRA 1DV1A 2W58A 3FRIA 4ARUA 3ERCA 1SBQA 1UDWA 3NRCA 1J06A 3OA2A 3M6IA 2G63A 1H1DA 5IJWA 1RYEA 1WUJS 4N0EA 4REQA 1G60A 1MX9A 1NE7A 2KM1A 2YMPA 1XOIA 1K8XB 1M0SA 1YIDA 2GAFA 2HNKA 3Q7TA 2MINB 4FCVA 1EIWA 4GL4A 1P1KA 3GDWA 4H1UA 4MUKA 5KS2A 3GVCA 5CIQA 5DM2A 4D0NA 1P2DA 2AN4A 1RZRD 1ETUA 2GFIA 1YMVA 2X0FA 1OJLA 4TV8F 2HADA 4JVNA 4JJKA 2CXPA 1SHKA 1WCIA 2YJNA 1TZMA 3LLCA 2ASVA 1U3GA 1FRFS 4OTZA 1RJDA 2P7IA 5ITVA 4MB0A 5DE3A 4IQ8A 3VDRA 4J7CA 1VFPA 5J5AA 1BQEA 4YI3A 1CUWA 2J3MA 4WLOA 3ZTWA 5AD1A 5H1YA 2D62A 1JGTA 2HT1A 5LQAA 3ETNA 4MHSA 1S4MA 4GP9A 1I10A 4NS1A 3L40A 3DV0B 4QPJC 4F3NA 1QB7A 1P0FA 2UKDA 2BMDA 2JBAB 1RBZA 2AG0A 2ZBPA 5CK5A 1QE5A 4K6GA 3V55A 2HV8A 1L7EA 3LUKA 4M6WA 1WQ4A 1YB5A 3PD1A 2OPHA 3JQ8A 1IK4A 1EM6A 1QUFA 4OO3A 4PSVA 5E4YA 1VI5A 2C5FA 4H60A 1EU1A 1SR8A 2L82A 3MYYA 4WOPA 2KBFA 1IBMB 1ENPA 2LR0A 2YJZA 2QQGA 3FUTA 3PS9A 2XGOA 1PSDA 3CRNA 4M1KA 3N2IA 2FSPA 1V5WA 1YNSA 2OZEA 4EDFA 3NM4A 5BW8A 2XCRB 3TW6A 1IXZA 3W6OA 5DIZA 4FYVA 3SQLA 1QG6A 2QMHA 4MHTA 4HR7A 1ZMTA 1HYQA 4TTJA 5LA6F 2VJAA 1NQOA 4EL5A 1DOHA 3FCSB 2AWNA 4D4JA 2OC5A 1Q77A 1PUXA 2OCIA 1WHSA 2X9LA 1SAYA 4DMMA 3BIFA 5LP6B 3T7EA 2Y9PB 4L9WA 4PNPA 1RRGA 4XCXA 1T2NA 1THTA 3EZ6A 4QUDA 2B61A 1N4DA 5AKYA 3WNCA 3DCIA 4GSYA 4EJ6A 1U2RA 3B52X 2OZPA 1XTPA 3M4XA 4IH1A 4YRJA 1Y7LA 4AM2A 4OI4A 4QYTA 1N2JA 3W6ZA 2OCYC 4D99A 6ADHA 4MO2A 2BFDB 5G4KB 1W49A 1M9NA 2BEVB 2P3QA 4UVEA 4P80A 1B41A 4MAMA 4Z5XA 2VO1A 3I45A 5ICCA 3ZDAA 4A8PA 3CF0A 1I4TD 4OQPA 3SF0A 3IIEA 4D44A 5BSEA 1RQNA 3UG6A 3E6AA 2HQOA 1TPZA 3KL2A 4CM6A 1H4TA 5JPIA 1QK5A 2P4HX 2JJ1D 2FAXA 1S9HA 4L9RA 2Q5OA 1NNQA 2GM5A 2VA8A 3K8YA 1U5CA 3HA2A 2O7RA 3GUUA 3NBZC 1VKZA 3RG8A 4KUEA 4D8XA 1YE5A 5E6SA 1YU9A 4DLYA 1CY4A 4DABA 3BMQA 2FEOA 2W4MA 4MVCA 4G1FA 2O8DA 2UAGA 3BTUA 1NW7A 2WLUA 1UMBA 4KIGA 3QG5A 3E7WA 4LVUA 5AKKA 3TE7A 3FOFC 5FFEA 1F8YA 4GPD1 4JJZA 1OF1A 3E9QA 4ZAXA 1QTNA 3PVCA 1O9BA 4NRDA 3LY7A 1JR2A 4E30A 3G5TA 2AYYA 2GPYA 4KO4S 3ZLVA 2X1LA 3PJEA 1I7DA 3P2JA 5JXWA 3N2EA 2V74B 1WSWA 4W5WA 2PMBA 5EP4A 3FNRA 2HLPA 3ND6A 1II0A 4O4IB 5HOEA 1I80A 4G5SA 4RD0A 5DEOA 5T64A 4D4IA 5ALFA 5KOJB 2JI9A 3AFIA 2ZM5A 2Q4TA 3A11A 2JLQA 1PNTA 1EFPB 3SJZA 5M2QA 1KPGA 6PFKA 1QNLA 2RGYA 1PNOA 3L84A 1N9GA 4IO1A 4MV1A 4RVNA 3VU8A 4JUDX 5KSZA 4J3NA 3B3QA 5G3ZA 4IV5A 2JH3A 4AROA 3NHLA 1PZFA 4KQWA 3AEYA 3MSXA 3NTRA 4DV2B 2GF9A 2QX9A 1YS1X 4KYVA 3ZEAA 4M37A 1SUEA 1NGSA 2V59A 2JCVA 1TT7A 5ADHA 3NRJA 1R64A 3R5HA 4OFZA 4DR2B 4GX5A 4IKPA 3BOSA 2QLBA 1FSPA 3OHPA 4IFIA 5AVWA 1ODIA 1TQ2A 4YRNA 1L7NA 1E9BA 3E82A 4EVDA 2DAPA 3H16A 1QQ6A 4HFMA 2O20A 3GEEA 1A2BA 4DIDA 2JCGA 1SUFA 3CPHA 5E95A 3D7MA 4A0QA 3UANA 4ROTA 2E4UA 3CVVA 4NL4H 3QA9A 2P69A 1LTHR 1IHPA 1YULA 2MYUA 1C0IA 1FC0A 2ON6A 3CW8X 1CNEA 5E0OA 3R3UA 5FFBA 2WTXA 3G5MA 1OTXA 3WL4A 5KVQA 1KQNA 3I73A 4ZOLF 4LKOA 1L5NA 2UXBB 1OXSC 2O8EB 2PMFA 4DL9A 3OZUA 4HLUA 4D9CA 1FYXA 2FW8A 3PIDA 1K5GA 2XQFA 4M9CA 1VGQA 2OENG 3JU3A 4RORA 4DCNA 2PIDA 2HWWA 2CKDA 3BWYA 1RCCA 721PA 4QARA 3OQVA 3GD5A 4D1YA 4PW0A 1XELA 4X90A 4PO8A 4Z1MA 3QNWA 2PT9A 1KTVA 5B1DA 4NV0A 5AW2A 3L2OB 4OCZA 4OHUA 5E1BA 1LC0A 2OMEA 4JEHA 4YHHB 4Q4DA 1NG1A 1WR8A 1SVOA 5DN6D 5KCZA 2NUPB 4DYXA 5ISMA 2FETA 4KB5A 2OQIA 2DPYA 2OM2A 4JZKA 4F97A 2P0EA 3G0GA 5T4EA 4RTQA 1T2FA 1MT0A 1TM1E 5DB4A 1V7PC 1LWNA 1OX5A 3FCUB 5CUQA 4K9QA 5LUAA 3CVOA 1DI0A 3IEPA 4CTMA 1ZR4A 2O8VA 1CNFA 1XIVA 3SOZA 2HJVA 1XMOB 1WQ1R 2ZPTX 4IIFA 4NCIA 5ALZA 3HV2A 1XEWX 1O6BA 3MJSA 5AVJA 2DBQA 5NULA 1RJEA 4ZPXA 4D3ZA 1PQYA 4BQQA 2JAXA 2Q1WA 1EFCA 1CFJA 2DR0A 1CF4A 3UK1A 4XKTA 3AUUA 4DF3A 4JC4A 2BY4A 3JPWA 3D2AA 5GU2X 1WPGA 1Q50A 3PVSA 3UFBA 1OYYA 1T9GS 5FAXA 4BB5A 4I50A 3D3QA 3AF9X 4XSGA 3T94A 1KJYA 1B00A 2IY8A 2H3EA 2WSIA 3IV6A 2PG3A 3BIXA 4WJLA 2X13A 2XIJA 2V6GA 4TODA 1MB2A 1XDBA 4JIMA 1W0JA 2BMVA 1PFWA 2CNWA 2IOHA 2B6NA 3HB7A 1ZCJA 3L8YA 1GGHA 2PK3A 3G2KA 1U0OC 5JBNA 3TLGB 2C04A 3ZGOA 4G8DA 2ZRHA 3UXEA 4LXHA 1AQIA 1CY7A 5JNTA 2D3TA 1XPRA 3ZW9A 1UQTA 1WNFA 3T7TA 4BZXA 1K6EA 1SIUA 1C81A 1L7BA 3IQWA 3BMCB 1V45E 2D7CA 4FYXA 3ZGXA 5FWXB 1H65A 1W0KD 2HNBA 2QYHA 4MW2A 3B7GA 3TK1A 3VR4H 3IPRA 1IC6A 1ORHA 5A6VA 1UC8A 3OJLA 2IOFK 3K2IA 4RGQA 5HS6A 4RPGA 3WZMA 3GEBA 2EX1A 3H1EA 2ZWIA 5H0IA 3RQIA 3SFZA 4GLOA 4RL6A 2VHTA 3VV3A 4EATA 8OHMA 4WBXC 1XJ0A 1ONNA 1FUKA 3QHPA 1WPXA 4UTOA 4F85A 3ITEA 2A0UA 2X23A 3X1YA 2HU8A 4WXMA 4B71A 3QWBA 1PT9A 4OYRA 1G8FA 1LK7A 2AI2A 2PKYX 3LIIA 3PFGA 5FOWA 3S2FA 2WF7A 4I14A 3V8EA 3COZA 4B6QA 4EG6A 5KX5B 5ERYA 2B7LA 1DJQA 2C96A 4MV3A 4EPTA 3FDIA 4H3SA 3BGWA 3K0BA 3M1YA 5CH8A 3F49S 5A03A 4X1IB 1FRNA 4BX9A 1ZL0A 2ZSIA 5CEEA 1B8OA 5TB5A 1XQ1A 2Z2XA 1O57A 4JVSB 2VDWB 4RQTA 5TPZD 1MKYA 2HY7A 2Q49A 5JSFA 2O0HA 4XWAA 3FI9A 2PLWA 2XRFA 3GFQA 1N6RA 4EB6A 1JAIA 2W90A 5LOVF 4INZA 3KYCA 3PXEA 4PBTA 3NPMA 2C3UA 3OIFA 3ONNA 2QRGA 4D45A 2X5OA 4L27A 2B83A 3FJYA 4JJ6A 5TQ0B 4H7DA 2EQAA 4AQ7A 1NHGA 4WQMA 1K6MA 2BYTA 3H87A 3PLAE 1G0OA 2WFMA 3EZLA 4MR7A 3MAAC 5AKZA 4PGAA 10MHA 4AY5A 1RRMA 1U9YA 4H6WA 1HDEA 4W4LB 3DUWA 1UC5B 3CNBA 2D54A 4H9GA 2GXAA 4O8ZA 4AJ2A 2D59A 4GUDA 1ISGA 4DHEA 2J3QA 1ORIA 3HXPA 1E94E 2ILVA 3KHTA 3B1XA 2GA8A 1WETA 2WAYA 3EZ2A 1X1QA 4F4IA 1U3FA 3WK7A 2FPUA 3KT8A 16PKA 4JJEA 3MRXA 4RMHA 1QGHA 5BWBA 2IX9A 2BHRA 3MA0A 1UVHA 1NUTA 2C07A 2EGGA 2G5GX 1EXNA 1L3BA 2NVBA 2OXEA 4N7MA 4JYCA 2CCKA 4NMWA 1SM4A 2NGRA 3F6RA 4H31A 4WLNA 1L7VC 4J91A 5JQGB 4TZ0A 3QHCA 4PYIA 1L7PA 5CFZA 4Z4EA 1CK4A 5AI6A 1ZUNB 4DLUA 3ROTA 4Q0MA 4X84A 1NLMA 4JA2A 2VHWA 3QKIA 3N5CA 1N2EA 2JVJA 1E1RA 3CF4A 4L3WA 5JXJA 4ID9A 2V7BA 5J63A 1IBRA 5EQTA 4MRPA 1XCMA 1A8SA 1CS0A 3AFOA 4G5GA 4KWCA 1UXGA 2Q5QA 3C7DB 3L0IB 1WTAA 2WC1A 3ZJ4A 2O3UA 4RK0A 3QVXA 2P9FA 2ZJ0A 5KSPA 4FT4A 3AKCA 3KXKA 3D7LA 4R83A 4MTLA 3OZEA 1QIJA 1KXJA 3WTCA 3I39X 1CUUA 3TVYA 2BKEA 3HVIA 1NM5A 1E77A 3QNMA 5AR1A 4BVFA 1T24A 4YRRA 5HSGA 4UBKA 3G8BA 1RCEA 1JQLB 1FEZA 3IT3A 5ALHA 1A9QA 3M5CA 3VMMA 4A0RA 4DYVA 5IZCA 3AFGA 1S8FA 4C21A 2IH5A 1ORVA 5A3VA 3Q3GE 4K3VA 1UZLA 4QL3A 2NXJA 2VQ3A 4ZJUA 3OHMA 4WINA 2VHEA 1CUFA 2XOKA 1DUSA 3ABIA 3OZRA 5BV8A 3F6BX 3K70C 3GA0A 3VM6A 3B9QA 1ZKMA 4S24A 1M2OA 2VDVE 3O9VA 4DCOA 5IS2A 1OBOA 4QHTA 4Y7DA 4DZTA 5KJ6A 2VTBA 3E5NA 4IX9A 4Q9NA 2IHTA 2W2NA 4UDNA 1CUCA 1LXCA 1MO4A 3JYHA 1ILWA 2YZ7A 5LLSA 4BRWA 5IASA 2Z6VA 4ND8B 3H4VA 3LT5A 2C2UA 2V7XA 1F60A 3R40A 5HKBA 1J7JA 1R03A 1IEXA 2Z2JA 3TB4A 2WSLA 1KBQA 1KOFA 1EGMB 2E82A 4B75A 3T9JA 1T2DA 5LNK6 4BXOB 4HNQA 2WIKA 3FDXA 4YR9A 1PYGA 4GQBA 2VJQA 3STYA 4RTOA 2CYCA 1VHLA 2NU7A 3N0VA 1Y5LA 1FP4A 3JALB 3IUMA 5GY7A 2Z0MA 1CY0A 2ATCA 2YOHA 4W9RA 2GK6A 5JSHA 5AW5A 2VHYA 4I66A 1KMHA 1GJRA 2Y99A 1WDKA 3E03A 2I55A 3NHYA 3BE6A 4KUHA 4DIMA 4E15A 1PQPA 5AQ1A 4TL6A 4U4AA 3KHKA 3HKEB 3LCMA 5IDVA 4UE2A 2OC4A 1OXVA 2Z58A 3KJFA 1RI1A 2HA6A 4MQ4A 1VG8A 5LYJA 3D2BA 1XMXA 4PRLA 3X1DA 2IU6A 3N2GB 4OHCA 4EAQA 3QW4B 2CFRA 1CJCA 2O5CA 3LKVA 1MG0A 3NJRA 4FHFA 3UXHA 1QE0A 1QIGA 2QPOA 3AK4A 3NIBA 5A7GA 2WTAA 3ORFA 1RKVA 2ERYA 4QGFA 5J2UB 4OFXA 5KNLA 4HZUB 2IU0A 5EEHA 1L5SA 2XE8A 4KSBA 2B1RA 1ZFNA 4GBJA 5HBGA 3A70A 4C4ZA 3DZ8A 1K98A 2FFJA 2FMKA 1HM5A 1IXYA 2A0KA 5C4IA 4HXFB 4R2IA 2QBYA 1TI7A 4PAMA 1SU4A 3TNJA 3SZUA 2YXDA 1A5ZA 3VNAA 2QLFA 4CR6A 3G5UA 5HWSA 4YRIA 3BMNB 4JI6B 5KC8A 2QU7A 1K6XA 4TUYA 5DNCA 1RYHA 4FN5A 3R44A 2Q2WA 2FPOA 1BU5A 2OHXA 2F3RA 1MQAA 2V2MA 2DJ5A 1TO2E 2A5DA 3CCFA 3HBMA 2CB0A 1A5SB 4JEIA 1CUIA 1DQYA 3TTXA 4OAPA 1UADA 2F9MA 2HK7A 4I08A 1SU7A 2R1VB 2JGRA 3HB4X 1AG9A 1QR6A 2JAWA 1GZSA 4NQZA 3WDSA 4BVLA 2BOVA 3MCAA 4PLGA 4NX2A 4OQYA 4U8HA 3M1LA 5EIOA 1RI4A 3FPBA 4FYWA 4KJZA 4D5EA 2HC9A 3RC3A 4EJMA 1EESA 4AP9A 3PNYA 2G07A 4LBYA 4JXKA 3FRJA 5CLJA 4CWAA 3A06A 2NMVA 4Q02A 1F4VA 4LGCA 2QV7A 2YWRA 2PT7A 2A86A 3C4JA 4X45A 1AZSC 2CL5A 3AYZB 3K1JA 3VPXA 3F74A 4AP6A 2Q1SA 2FV8A 5BUQA 5KWEA 3ISFA 1ZO8A 3ZHQA 3EGXB 2PA0A 5HIAA 4BLTA 3DDZX 3U4CA 4ZKWA 2PLFA 1V1JA 3F35A 4KTTE 4ZPJA 2C7RA 1MIOB 3F3MA 3ER8A 1N9KA 3VO8A 2JJYA 3ZQJA 4YVZA 3EEFA 3WGUA 3A6GA 3ZJUA 1RC8A 4RHFA 2F3QA 3QF4B 3ZWAA 4Y08A 4B4UA 1IJFA 5DHSA 1O94A 1WB9A 3F46A 4R9RA 2OFWA 4K86A 4YJGB 4YEDA 2CL0X 4JUCA 2XF2A 4R7GA 2HA0A 1BD4A 2E2WA 3O4IA 4Q3KA 1NF3A 3QBTA 3PI6A 3RBZA 3OZWA 3H5IA 2NU8A 3T99A 1T9KA 1NJGA 1K8RA 4CF5A 1E7MA 1LQ2A 3UT5A 1W44A 1ZJYA 3PD0A 2QN3A 2CD7A 2YHIB 3K9HA 4KC0A 4XLZA 3AEUA 3PQCA 1U3UA 3UCFA 2BONA 2MYNA 3FJOA 3R9KA 1KK0A 1PZMA 2ZI9A 3CRW1 3NHUA 2JD1A 3U7RA 2BLLA 1UAGA 2A94A 3CZRA 4XSVA 3UXMA 1CUGA 1H94A 1I1NA 4TKUA 2G71A 3FPCA 4YRMA 2J6IA 5ILGA 4Z2AA 2HRBA 1WULS 2KBEA 1NFFA 3E9MA 1OXTA 1JJFA 1T91A 2I2DA 3HR4A 4UHHA 3UATA 4CDRA 5KMGA 5KTOA 3U3RA 1UQUA 1T5OA 3H0CA 3OOEA 3ACBA 3ZI0A 4DY6A 5B3KA 3QUCA 1QFMA 3IXMA 4GXTA 4KVSA 1ZMBA 4YJDA 4PLWA 1H05A 2EGUA 1YQ9A 4QDXA 5EPUA 2DU8A 1LY1A 1SELA 2FOIA 3TOCA 4D4HA 4W63A 3I32A 1ZQ9A 4Q9JA 2WJ3A 5J2TB 3ZDCA 4E7PA 1A9SA 5M7EA 1Z73A 5A5GA 3D0KA 1HE1C 2QD4A 4JWTA 2F64A 4N8DA 4US0R 4GGMX 5FH9A 5BUZA 2FZLA 1R4MA 3D43A 3BD6A 2VXIA 3U37A 3Q3IA 4CL3A 4O2AA 1Y6RA 1Z6GA 3NWJA 4OHBA 2WHRA 3VSAA 1ZOSA 2RHBA 1MH1A 2BKCA 1P7ZA 3KQWA 4LQLA 4PIPA 5CFQA 4CCSA 1E3SA 2ZLBA 3K96A 2D1FA 1CFZA 2B8TA 3IT0A 4KEAA 4KZPA 3LQ1A 3GNLA 2WILA 3KM0A 4HO1X 5BWCA 5A6SA 5CJPA 1GAQA 2O7QA 4F9EA 4F1JA 3DDHA 1RWNA 2XT6A 1QCCA 4LDQA 1YKFA 4TV9F 1D2RA 4ZHQF 4GS5A 4UVGA 4Z4HA 3RTEA 3ZZ1A 1CUDA 4ALIA 3R3SA 1KWKA 4IDOA 3ZG6A 5F52A 4F38A 1EWVA 1USIA 4IVQA 1ZVJA 5D8YA 1ECLA 4HNAA 2OCKA 5FWDA 4PZ9A 4BLSA 3QJYA 1KVSA 3RBAA 1GCAA 2I7CA 4DMFA 5AVRA 3ZWYA 1VCOA 3FPFA 4JOQA 1IQ0A 1GAXA 3WQRA 2OK8A 5H7XA 4EEKA 3THOA 3B78A 2P9QA 4XI9A 1XP5A 2FDRA 3PWZA 3FPLA 1ZINA 4NTZA 2NTNA 3C14C 2W4QA 5AESA 4MLPA 5T67A 3S70A 4NIMA 4C2TA 3ORHA 3ECAA 4GZ5A 4L78A 2ZYUX 3MWFA 2GESA 4ZN6A 2X19A 3VR4D 4G1CA 1P8JA 3ZE0B 4ALNA 3GCGA 2JFWA 4TLCA 4I1RA 1TJPB 3KYJB 4WK6A 4NATA 3U49A 3QWHA 1BEEA 3V1MA 1UDRA 1ZUJA 4MLDA 4RANA 5IC6A 1L1FA 3WYBA 1OWMA 2FL0A 3GT3A 4CMKA 1A9XA 1M1NB 1LNSA 4EG7A 1T1SA 5T4HA 4Q34A 1XXHA 1U0EA 1G20E 1E8MA 1MG5A 2FWMX 4A27A 1PLJA 4HAOA 4P3YA 4YCBA 4LFBB 4E5SA 5EA2A 2J9XB 1SIOA 3G8AA 2DTXA 1DQZA 3AEXA 5B7QA 3WGVA 1DVBA 2R00C 1QQ5A 2AK3A 3E6SA 3O5AA 1U7WA 3B6JA 4OQDA 1E62A 2AOTB 1T4CB 1X94A 4UUAA 4ZVPA 3HXMA 2WZQA 3ETJA 1KSFX 1ZRNA 3DR5A 4QUJA 5KREA 5MGNA 4ZEOA 5FTLA 1JKJB 5K3FB 1Q0SA 3IS8A 4KDRA 2I2AA 1NU8A 4MR8A 2GEKA 3B2QA 2WY2D 4DDWA 3H9QA 5F23A 4N5MA 3DLHA 3L0OA 1J33A 2R751 3IRVA 5J9FA 5FTMA 3L0DA 1SY7A 1GEGA 5LZ5A 4AJ4A 1ECPA 2RGNA 4J16C 5DMXA 4ASUD 4E70A 1OIWA 1RAFA 3UJ7A 4QZVA 4NMLA 4QE3A 5LU9A 4TLDA 2AN3A 4AM8A 4DBLC 5GN8B 3LTEA 2IW3A 4BMZA 4AKEA 1DEXA 1JB1A 1UBKS 3ITKA 1Q5PA 1YE8A 3UMYA 5K01A 3BXEA 1R9GA 3HJCA 3CRMA 4I3GA 3VZQA 4CKCA 1UM9B 1NM5C 1C4XA 4OKSA 3C3XA 1F4LA 2CLKB 4GDMA 2CY0A 4ITVA 2Z6UA 4W1RA 3E1OA 2ZIWB 5CVDA 2IYAA 2ZI6A 1NLYA 4I55A 3L8CA 3SLRA 4TTQA 3W9BA 2FEPA 2WF6A 4LQDA 3THXB 4DLAA 2HLHA 1BDBA 3ZVRA 4EW6A 2ZE5A 3H6HA 5CX1B 2C8JA 2ROQA 3A4TA 2HYIC 5E4TA 1X8LA 4I4NA 5DNAA 3SBXA 2DQSA 1VE5A 4DCUA 4ZVOA 4DBLE 1SZPA 1AN9A 3M33A 5LIRA 2FPRA 5AIAA 4EB8A 3F9IA 2DWQA 4URHA 3AXSA 1B0AA 2WF8A 4NE2A 4EP1A 3UWPA 5EGNA 5KB3A 1MJHA 2H1FA 4MDHA 3GDFA 4RH3A 5CYGA 5ICEA 1H96A 2BW0A 1TECE 5G1NA 5JALA 2W8BA 4PINA 1E1QA 2VDPB 3Q7RA 1KE1A 1SU8A 1GKLA 2R7NA 2W6IA 1ICEA 3H8SA 2VNHA 4DRXA 4QDKA 5AVKA 2FPGA 2WOOA 2P2GA 4PSKA 3ENWA 5J43A 4DLWA 4KOAA 3BCRA 5HCNA 5FR1A 1M67A 1E63A 1UBJS 3GRVA 5GONA 1AEWA 4E4TA 4L5CA 4P3KA 1NWHA 2R44A 3STUA 1V8FA 1X7ZA 2H2DA 1IM2A 1E2FA 4BRZA 1UKEA 2QI9F 2Q29A 4TW3A 5DX8A 4YMLA 3G8CA 3SR3A 3PGMA 1P74A 4OBBA 1RE1A 4A0HA 5EKUA 1KFJB 3G2QA 4TYQA 2FKAA 5HKLA 1IJEA 2ERCA 2O2YA 1KI7A 5CR9A 2C5GA 1JX6A 2O23A 3M6AA 4LAFA 1FUIA 3UNOA 5IABA 3WYDA 5A1TA 1Q20A 2GX6A 4KR3A 4JB3A 3C5EA 3EWNA 1O95D 2VPXA 3LM8A 2H5EA 3NQ41 3U26A 3H2YA 3NM6B 3DGFC 3RKRA 2QKYA 4FILA 4M86A 2LRHA 3PTAA 1WBBA 2LKCA 3CS3A 2DTEA 3DM5A 1UUFA 3L8GA 4DHWA 1K4KA 1UKYA 2HWYA 3SP1A 1VXRA 2R96A 3SXJA 4PCLA 3TL6A 1EUZA 4MQUA 5ERGB 4M1WA 3U4HA 3QPCA 4OH7A 2P9CA 1PJRA 3H86A 4LOHA 1K5DA 1GY8A 1L1RA 4HX2A 1ONOA 3TLZA 3X3HA 3CA8A 4P33A 5F7XA 1FLAA 3LBIA 2QMUA 1NNSA 3A26A 3HN7A 3KVYA 4KMMA 4MXDA 2OCBA 3ANNA 4ZAVA 2IUEA 1CUAA 2P68A 2SKCA 4YCAA 1JF8A 1SXJA 2WWWA 4YUZA 3WLRA 4XD7D 3CR7A 1EE9A 3EG9A 1REQA 3C1TA 3GLVA 3ZE8A 4JKIA 2HW8A 1KAGA 1E7WA 4ZV7A 3GP5A 4JLOA 4OLHA 3I92A 5KQGA 1HLGA 1DEAA 1YHYA 2Z3WA 3C3AA 3E3OA 4JBLA 1E2KA 2CMKA 3ZWMA 2RI1A 5CG1A 4PICA 2IUFA 4NNJA 3B85A 4IGFA 1D5WA 1LLCA 1WLYA 2ZWPA 2V8TA 2B6HA 2R2GA 4LCJA 3D6JA 4CHGA 3L7JA 2GZMA 2QE6A 1ORTA 4Q9LA 4ZQFA 2XITA 1CZUA 3EQ7A 1GGEA 1EG7A 3AV3A 3BQNB 3LO5A 5BQPA 1KEVA 3PC7A 3X2FA 5B4TA 4O4IF 2FOXA 3CPSA 2ACKA 2QG9A 3EB9A 4M8KA 1A9TA 3IA7A 1JHZA 3DLTA 3AHJA 4N3CA 1KP9A 4M6WB 3S1AB 2HFKA 3T5GA 4IXTA 3TSYA 2IL1A 3JQ8B 4KXUA 3P94A 4PCVA 5AUOB 2QTNA 1ID1A 2A78A 1Z4MA 1FNCA 1R8YA 1SCNE 2LVBA 4WIAA 3W5IA 2GEDA 2JD0A 3FKSA 4WJG4 4EW2A 4DR3B 1CNMA 2O2HA 1SK8A 1R9NA 3DYIA 3JD1A 3BVEA 5AJVB 3BAFA 4NYMQ 4ZODA 3FTPA 1O94C 5I7FA 4OA8A 4M1OA 3TNDA 3I8XA 4FFOA 4HLQB 4L57A 1E5VA 1AVTA 1SUCA 4L0DA 3WWYA 1SQ3A 3QPWA 4ES6A 2EXXA 3K09A 2EX0A 3T95A 4N6GA 4F04A 2JFFA 5HZGA 1T8SA 5D01A 1ORRA 4A6DA 1BQ3A 5I7VA 3AUTA 3JYOA 3B70A 4BFYA 5J4KA 4K9LA 2C6RA 3AK9A 2XMDA 3WO0A 3I6ZA 2G7ZA 4ZEVA 1MAHA 3DT6A 4Z5SA 4F6CA 3CLVA 2PXCA 2XD4A 1C41A 1DKOA 3F4KA 1D1PA 3JQAB 3JXEA 4LY3A 4NYJQ 4R4JA 2BBSA 4G2NA 5ILQA 3DZCA 4UUQA 2Y0CA 4L3VA 3TD9A 3GJ4A 4RHUA 3R2LA 4Y2SA 1BWQA 3PZBA 2H4JA 5ECWA 4IXNA 1I14A 4IDPA 4O0LA 5JSUA 3ADOA 3ROGA 3SEAA 4PEVA 2I62A 4ITTA 4XASA 5ES3A 3ZHSA 4QHSA 3QU7A 1CZNA 1NVUQ 2AC2A 2KI5A 3FTNA 1NNI1 3KEQA 3P1JA 4WEQA 1AKMA 2OEPA 5FPTA 1FRQA 5TNXA 2HKIA 2XH8A 3MAJA 5E6SB 3BJMA 3JTEA 3LVQE 1PGOA 421PA 1K8YB 3IQFA 3RSLA 1AUPA 2RHWA 5IBRA 5DLYA 1YQDA 4R5MA 1BTOA 3V7YA 4Z4GA 4PZAA 3G0BA 3FOEC 1R66A 1J0EA 3ZY2A 4AMZA 2I1VB 1P8AA 1R6BX 3RK0A 2IEZA 2Y1DA 1U8TA 3P8ZA 4KQ6A 5EWLA 1PWYE 2BTQB 3ENKA 4C88A 2AEFA 4MYDA 4AMGA 4TLEA 1SKAA 3K1AA 4BBAA 5LZ2A 1FFWA 1XMVA 2H0QA 2J33A 2XA2A 3UJ9A 4YH1A 5CVEA 4GDFA 1D04A 2CEAA 2CLEB 3UMBA 3SSNA 4PYKA 2VC2B 3KZXA 3WLPA 4A6EA 3CIOA 1OE0A 5TLSA 4YV2A 1L3IA 2VUSA 1LPOA 1QAMA 2RKBA 4YV0A 4HB0A 1N9GB 2QT1A 3AP2A 5IFKA 2VZ0A 3MT0A 3ANSA 2B4RO 3E81A 3PW1A 4I36A 4X00A 1JVNA 2Y66A 2JEYA 2PKQP 3CISA 1I7QB 3NORA 1A98A 1D1SA 4DQLA 2IEAA 4FDVA 4EY8A 3T1HB 3RVSA 2HWKA 1FYDA 4NY1A 3T41A 3DO5A 3K3PA 3CW9A 2HUPA 4LQNA 1KYZA 2QM7A 4I1PA 2P9BA 5IANA 4W1PA 5FBRB 4HI0E 1QJCA 1A1SA 3A3NA 3ZGNA 5K5EA 4NCBA 2JLAA 1IZ8A 1NJ6A 1DAKA 4FJ1A 1HNNA 2ID4A 2YZGA 3KU1A 4V0KA 2B36A 5DNWA 3M3HA 3L6OO 6CHYA 3I64A 3L4JA 4H15A 1QO0A 2LDXA 1XJCA 1ZVQA 1GOTA 2HSJA 2IVZA 4UQLA 5HUHA 2DUNA 2FG7C 1UJ6A 1ELOA 3KJNA 3DWGA 3PJDA 2V2SA 4OP2A 3I9JA 3EF3A 2JASA 3VHQA 2PX0A 3GFSA 5HJ5A 1TMGE 1DXYA 3KRTA 1C1DA 1EM8B 1KBOA 1OAOA 1Z8DA 1P62B 2HA4A 5B1HA 3OZBA 1H23A 4OIFA 5DNYB 3HUDA 1JFSA 1MQSA 3GY0A 3UYKA 3KFLA 2W5UA 3TE6A 1PFVA 2OORA 1BDMA 4LMBA 1V95A 2XF8A 3ADPA 2VPIA 4OFBA 3T1VA 2CNBA 1Q95A 4OP3A 1J56A