3FSEA

Crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
352
structure length
336
Chain Sequence
KKVAILIEQAVEDTEFIIPCNGLKQAGFEVVVLGSRMNEKYKGKRGRLSTQADGTTTEAIASEFDAVVIPGGMAPDKMRRNPNTVRFVQEAMEQGKLVAAVHGPQVLIEGDLLRGKQATGFIAISKDMMNAGADYLDEALVVDGNLITSREPGDLAIFTTAILSRLGYGGKDAALPDEKDRNAEWWKLADAWGGSTKGDIVRGLNTALGGERYSLEALEKYTEKESDVEAKALFQEMITNKQRHIEYLETYLTRLGEKPSLSANDDIYQIRSALGDIQTGIGDIGNLCAMYTDPIATAIFKEIYKDLVKYEQRLVSLYRTRTNATVQPPKPTTGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of two-domain protein containing DJ-1/ThiJ/PfpI-like and ferritin-like domains. (YP_324989.1) from ANABAENA VARIABILIS ATCC 29413 at 1.90 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Hydrolase
molecule keywords two-domain protein containing DJ-1/ThiJ/PfpI-like and ferrit
total genus 123
structure length 336
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3fseA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fseA01
5J8SA 3O7SA 1ONSA 1OY1A 1JTSA 1TKPA 5JZMA 4XKTA 1YUZA 2R1VB 3ZR4B 3D54D 1YUXA 1CE8B 4RKWA 2V2LA 5SY9A 3TTYA 4LYUA 1LB3A 3UNOA 1Z6OM 4ENRA 2CEIA 3RD0A 5SY4A 3E6SA 5J8WA 1R03A 2FZFA 2FG8A 2ZUTA 3QVDA 2C41A 2GS4A 2Z6MA 3NONA 2Z5PA 5D8PA 4DYYA 4ISMA 1JVNA 3PWQA 3ER6A 1QWSA 4P35A 1TJOA 4MN9A 3EZ0A 1T3TA 4ZKHA 4ERUA 1PV2A 1KWGA 1PE0A 3IS7A 2V2NA 3OT1A 2OC5A 4PG1A 3PW1A 1JYBA 3EJ6A 5IX6A 3SH6A 2R1TB 4OGFA 4LPMA 2RK3A 3PZAA 4CYAA 2A9VA 4XKSA 2VKTA 4E5VA 2C2UA 5FEJA 1SOAA 4MNTA 3SF8A 5D8SA 5FFEA 3KXUA 1TKOA 4E6KA 3F35A 4EVBA 3PW8C 4PGIA 1VCOA 1F33A 3Q4OA 2Z5RA 4DYUA 3OGHA 4B31A 2OH3A 5GOUA 1CS0B 3EFEA 2CN7A 5HJFA 3QD8A 1OI4A 1DATA 3BVIA 3GE4A 4Y1EA 4P2GA 4DYZA 3SHXA 3R74A 5GN8B 1T0BA 2CHIA 3O7RA 2IY4A 1QVZA 4UCFA 4ZGGA 3R2KA 1MOJA 5LBHA 4CY9A 3BHNA 1SOFA 4L95C 4TOEA 4CMYV 5J93A 3F39A 4TOAA 4OQ4A 4I4NA 2XGWA 1U9CA 3GRAA 4WINA 1Z6OA 1JI5A 5DFAA 3WNWA 4B5KA 5E1UA 1S1MA 3BVKA 5GU0X 2OR3A 1KWKA 2BKCA 5K52A 1BG7A 1KRQA 3GVYA 3L7NA 4ZL5A 5FFBA 4ENSA 4QYXA 4LPJA 3AF8X 4ZMCA 3KA8A 3NP0X 4R7GA 3B36A 5J9VA 1RCCA 3HL1A 5CMQA 3AK8A 4CVPA 2GHRA 3R75A 2CLBA 2ABWA 5SYAA 3F71A 1NF4A 4LGYA 1GGJA 5FFAA 2QF9A 4LYXA 1RYTA 3KA4A 4Y1RA 1JKUA 4PGKA 4Y1GA 3TTWA 2RBDA 5GU2X 1P7ZA 3BVLA 4IWJA 1R9GA 4L78A 1UMNA 3RHTA 2D5KA 3Q4NA 4EVEA 1BCFA 3NVAA 4I46A 5D8OA 4MJYA 3M3PA 3F5DA 1G2IA 4IWKA 1ZUJA 3EZUA 3F34A 3NOOA 3TTTA 1O9IA 4TOHA 4CYBA 3E1QA 1JIGA 1P80A 3F37A 1GPMA 2IUFA 2IU2A 2PYBA 4ZL6A 3NOZX 2Z90A 3BVFA 3PQ3A 4MGHA 2YW6A 1JGCA 1LKOA 4MY7A 1C3OB 2VPIA 2ZUSA 4ZDKA 4P36A 1NNQA 1QVVA 4ZTTA 1VJXA 1VEIA 2GK3A 1OX4B 3KWOA 2RK6A 2C2FA 3PVTB 1IERA 5JZOA 3PVRB 3MIIA 1J30A 2FKZA 1DVBA 2YWBA 1SY7A 4JQSA 1AEWA 1QYBA 3E6RA 1NFVA 3CY6A 1QF7A 4ENQA 5I4JA 1GPWB 5ERKA 1RCGA 4TW3A 1VCMA 4N0MA 4ENPA 4XKUA 1ZS3A 2VRNA 3KA6A 2D7JA 3R76A 3L4EA 1O1YA 1B71A 1S3QA 3GHQA 4M34A 1I7QB 3PW1B 4DASA 3MPSA 3PWQC 4II4B 5GU3X 1RCIA 3BWEA 2CHPA 4EVCA 1JDBC 1GGFA 1PDWA 3AK9A 1Q2UA 4RC5A 2Z5QA 1LKMA 5E9AA 3SF8B 2V15A 3RAVA 3A9QA 1I1QB 4DZ0A 4P18A 3HIUA 1UVHA 3FI6A 3T9JA 3NOQA 2XJNA 4P5PA 4L8FA 4ZKWA 2XKQA 3R2MA 1YV1A 3UMMA 3RBCA 1DPSA 2YJKA 4EVDA 4RC7B 1XZ1A 2V2OA 4XGSA 1C30B 3EN0A 3PQ8A 2ZA8A 1J42A 4OGGA 4ENVA 1IZYA 1JKVA 1L8IA 3U90A 4Y0NA 2WJZB 1FY2A 3OJ5A 1QGHA 2ITBA 4AJ9A 3QHBA 2XF2A 5HQOA 3B38A 4MTCA 2JD60 3NORA 4I2NA 1EUMA 4M33A 1P5FA 4ZDIA 2G4HA 3PQ2A 2YWDA 4AULA 3AJQA 1OX5A 3ES3A 2V2PA 2F7NA 3FSEA 4S0ZA 4MUDA 3QB9A 3AF9X 3R2OA 2BJYA 1VEQA 3KA3A 3UK7A 2R1UA 2FFXJ 3PW8A 5IP5A 2BW1A 4RC8A 4L8WB 3PVYA 1O9RA 5D8QA 2WTLA 2YW7A 4OJYA 4Z5SA 1SQ3A 3WVVA 2XJOA 1OTKA 1TK6A 4LQVA 2VDJA 3PQ6A 3EWNA 3NP2X 2LXNA 2CLUA 4ITWA 3PQ4A 4GE3A 3F38A 3ERZA 2V2IA 4ENUA 2R1VA 3BKNA 5FFCA 1RCDA 5D8RA 2YWJA 3IS8A 2AB0A 5LG8A 4K2HA 3E1NA 2V4UA 2ZUVA 3SIDA 3VU3A 4CMYA 1P81A 2V2JA 2H2WA 2HTNA 4TOCA 4CVRA 2RK4A 4TOGA 3ZJ4A 2FHAA 1KA9H 5SY6A 1N57A 4QUWA 1GWGA 2Y3QA 3SE1A 3R2SA 2ZG7X 3WVUA 3UJNA 4RC5B 1GG9A 3EZGA 1FYEA 4CVTA 5C6FA 1A9XB 5E2DA 3E1OA 3P9SA 1Q7RA 4AUEA 3A68A 3ISEA 5HJHA 4ENWA 2VXOA 2R1TA 2W0OA 3R2HA 5JACA 3PVTA 2YWCA 4B40A 3AJPA 4ITTA 2V2RA 4UZSA 4XLLA 2BK6A 4Y08A 4RC7A 2GYDA 1IESA 4LQHA 1QVWA 2NV2B 2NV0A 4GE0A 3Q4QA 3B3AA 2ZA6A 4L7QA 4A25A 4B2YA 1CF9A 3TTVA 4QYTA 4OIFA 2WLUA 2XJMA 5D8XA 4B7AA 4ZJKA 3KKLA 1KEEB 1L9XA 4ISPA 1PDVA 3TTXA 1VELA 4ZDJA 2CIHA 3CZ9A 4Z3BA 5LS9A 3P9PA 4DI0A 2WLAA 4PXYA 1Z4AA 3OT1B 2VXIA 2VXXA 5D8YA 3R2LA 4BIMA 1H96A 4L8YA 3QZ3A 1S2ZA 1P7YA 4UOQA 4LQNA 2YJJA 2ZG8X 1OX4A 3WVWA 1IZZA 5CMRA 4LPNA 2FG4A 3VNXA 3P9QA 4UNIA 5BV2P 4R42A 4CVSA 1FHAA 3PQ7A 4ZKXA 3KA9A 1JI4A 4RC6B 5JKLA 3H7GA 4YKHA 3UOFA 2AD5A 3L3BA 1OX6A 4U3GA 1IPHA 1GGEA 3CYFA 2JD70 5GU1X 4LQJA 3KX9A 3TQIA 4ENTA 3UOWA 3AJOA 4UOZA 2FJCA 4Y1FA 3N7TA 4AUMA 3FIJA 2CN6A 4OYNA 5JKLG 4RC6A 2JD80 4DYXA 4M35A 5K53A 1L8HA 4KVRA 1M6VB 4BFLA 4TODA 5CZUA 3F33A 2CF7A 4II4A 3TTSA 1UCFA 3CNEA 2C2JA 5LG2A 1MFRA 3E2CA 1XZ3A 3PWFA 1KXJA 4LRUA 4N12A 4AM5A 2ZURX 3QHCA 3F36A 4AM4A 1I7SB 1LKPA 4BTEA 4AM2A 4ZLWA 4RKYA 2IB0A 2V2SA 1VCNA 3RE7A 2VZBA 1HRSA 5JKMG 3ZJ5A 3FVBA 5LIRA 2C6RA 4GUDA 3CZAA 1NF6A 2ZUWA 4OFWA 2FL0A 1BXRB 1WL8A 4E08A 3F32A 2ZUUA 5K4AA 1QDLB 3TA8A 4P34A 3RGDA 4HCJA 2HR5A 1S30A 3Q4RA 4TO9A 3NOVA 3AF7X 4TOFA 2UX1A 4AUNA 3BVEA 3BT5A 3PQ5A 3SOZA 3UOIA 3PVYB 5AXSA 2FEXA 4KVQA 4Y1RB 2ZG9X 4KVSA 1GGKA 5JKMA 1N1QA 2W7TA 5FFDA 3IQ1A 3E1MA 2ISSD 1VLGA 3ISFA 3PVRA 1VHQA 3UGJA 5GN8A 4DE6A 4IXKA 2V2MA 3E1JA 1F30A 2ZA7A 3E1LA 2X170 4D1YA 3WFZA 3R2RA 4PG0A 2QQYA 3EGMA 1BFRA 4TOBA 2GYQA 1T36B 3TTUA 4WXYB 1RCEA 4ML5A 4MKUA 4REUA 1K9VF 4ADSG 3MGKA 4ETRA 1GGHA 3P9RA 4M32A 3E1PA 3L18A 5ERJA 1JREA
chains in the Genus database with same CATH superfamily
1UXOA 4HEA1 1D03A 2P4SA 4WK6A 4YGXB 3RSQA 3H5OA 2CLFB 1ZCZA 4RF4A 2LP4Y 2XE6A 3FCOA 2Q8NA 3IPAA 3RKRA 5KNDH 3CEMA 1RJ9A 3RJMA 3TLCA 3CVXA 1KYWA 1HDIA 1NT4A 2B4YA 3MRVA 1THMA 3WOVA 3GNSA 4L27A 3OPNA 5GJCA 1C29B 3ZU3A 4LCBA 1CEYA 4NCNA 3M9WA 3F3YA 2EBWA 5TMEA 5L3SB 1HQCA 3M6WA 1H9BA 3ZZMA 1VDZA 1O95A 2GK4A 3UNOA 5JSKA 3AWDA 2C2BA 1JSXA 1I1HA 4LZAA 2JLSA 3W4JA 1Y9EA 4GLJA 4Y2YA 1SUEA 4OB8A 1T3ZA 4G5FA 1BHQ1 3EZXA 3PI7A 1R03A 1HFWA 4NIMA 5CNMA 2HJHA 3T1QA 4BO0A 3TEMA 1F3OA 3V7YA 2BEUA 2RB4A 4MGYR 1MNQA 3U09A 1XZBA 3NEJA 4HLUA 1XD2B 3QQPA 3EEIA 5FTMA 3LKVA 3RKSA 5AK0A 4BZZA 1FFEA 1JZSA 2JAWA 3G3EA 1RAEA 1R6XA 1W2WB 3VSCA 1P6UA 4DV4B 1ZCJA 1PV2A 1C1XB 5BN5A 1RVDA 1T1SA 1A9XA 1XMQB 1XSEA 3KLMX 1I6KA 1NWHA 2F1OA 5ALKA 2OK8A 2JLAA 4C4RA 3PUJA 4U9HS 2J6BA 3DLPX 1JYBA 4EYQA 1OU0A 1ABFA 1TYCA 2NUPB 1GITA 3TRFA 3KC2A 3TPFA 4OHWA 2ZBQA 2F1JA 2C2UA 4Y9UA 1Y7IA 1SUDA 1Z12A 4U7DA 3BT7A 2WB4A 2IUUA 3S1AA 1GR0A 3AIMA 2Q0SA 3BIXA 1VA4A 3WJ1A 3WP0A 4EDFA 4ZXPA 4N5HX 3TX2A 5IXSA 3ZNQA 4TKZA 3CF4G 4TT3A 4H18A 4NF2A 1QHFA 3E84A 3VSEA 2Z5RA 1ESNA 4IXNA 4YCJA 4FUQA 3PG5A 1QO9A 4WCFC 2A3RA 2JJ8A 5H9WA 5IN4A 2VPPA 5HJFA 2GBCA 2IW1A 1ID1A 1PK8A 3O75A 2Y1FA 2Z98A 4V0ME 3B5EA 2HNBA 3GE4A 2I66A 4KX3A 5ITWA 2UU9B 4BQIA 4CL2A 3G7SA 1BFKA 2QX9A 4V0NA 1EX1A 4RK5A 1UT8A 4PCLA 3S68A 3VVBA 3Q85A 4HUQA 4X8OA 4CM1A 2WFMA 2Z6UA 4PQRA 2Q7XA 3EZYA 5A0FA 5LZ5A 4MKGA 2C8VA 2XUKA 3CEHA 1ZR2A 4TOEA 1XKLA 2QR2A 4CLOB 4JLDA 3PNPA 4X1YB 3ZGVA 4MVYA 3FNQA 2ZSUA 3RC9A 1ZIDA 5FPPA 4XFJA 3GRAA 1XGKA 1YUMA 2OMKA 5A0VA 1Y37A 3NGLA 1Y3CE 2AFHE 2AFHB 4ABYA 2JFYA 8ABPA 3DO5A 4IKEA 1HLGA 1KH3A 1N5DA 3D7KA 4BO6A 4WOCA 2XYGA 2JRCA 1AY0A 1TQ8A 1Z4KA 4AJIA 2PMFA 4FOSA 5JDIA 2PL9A 1ZJZA 1P61B 2O07A 4P3OA 3KQNA 1FFAA 2EZUA 1FYDA 2O7VA 5E0KB 3RADC 1WW8A 4RCVA 2EL9A 1H05A 2GAIA 1CR6A 1H5QA 5F7ZA 4G0MA 5L51A 1CQJA 3FOWA 3KHUA 3N6OA 2ZUFA 4MRNA 2Z5FA 4LPSA 4N1AA 3QKUA 3KDQA 2QD2A 2XZTA 4PO9A 4PSVA 1FX0A 1ZSYA 2AOVA 4KGDA 3W0LB 1EFHA 4DWJA 4X61A 1VM6A 1UJ2A 2HGZA 1B8NA 4ZALA 3OJLA 3JD1A 2HPZA 2OGTA 4IXDA 1ZD2P 3FZGA 1VIAA 3EMBA 3DBRA 1E9DA 2BISA 2BRUC 4CCAA 1KEVA 2Y6UA 2WD7A 1WULS 2QGFA 3NVAA 3TZBA 1QONA 4G1VA 2FW9A 4L57A 3Q9NA 4LOKA 4TKVA 3W7VA 2ZI7A 3F5DA 4GRDA 2BFDB 4UTRA 3HMKA 1F17A 1EWTA 1L4FA 3P20A 1QAQA 3R6TA 2Z8YM 3IAFA 5HKBA 1HNNA 3V9PA 2V7UA 3NOOA 3UOGA 3KWFA 5EGNA 1WPQA 1JIGA 4IOKA 1LDNA 4RM2A 1V7QA 1KYZA 1FFYA 2JCSA 3PR3A 3ZKWB 2PPLA 4FFSA 1Z6TA 1XPRA 1NULA 3HBAA 5KNBH 2GHQA 2XMZA 3H97A 1MENA 2HK9A 3QF4B 2NM0A 3R4CA 1L5HB 4O2LA 3AERB 5IC4A 2C7VA 3UPUA 1SAYA 5ALOA 5DYWA 4AICA 1JGCA 4M99A 4TMVA 4E2YA 2ILVA 5EJEA 4YCNA 3KFVA 3ZK7A 1BDJA 3AR7A 5JOQA 1BE6A 1PG0A 3A2LA 3FH0A 3IVCA 4CUJA 4KITB 1NYRA 4LWOA 3H9QA 2QTNA 4PC7A 1GTZA 4HBZA 3RUDA 3RFTA 2IYPA 1KEPA 3B6ZA 1OTHA 3LQFA 3UG7A 4H27A 3PVRB 1TM5E 3VISA 4AKHA 1JKJA 2C2OA 4HDMA 1YS4A 3DB2A 3GZNB 1TKCA 4GOND 4WBNF 3GARA 1QYBA 2VPXA 2GD0A 3OKPA 1GPUA 5A2QA 4QG7A 1E7MA 2PZFA 4HWPA 4KQFA 3EC2A 5ERKA 1KAQA 1JHAA 1MN6A 1FFBA 4J4HA 3W1VA 1IVNA 1T36A 2NU8B 5F2KA 4H15A 3VO8A 5AUNB 1P4SA 1WB4A 1YVRA 1CUIA 1PSWA 2IKQA 3BD7A 1IN7A 2FMHA 4Y6GB 2YJZA 1NGSA 3NAMA 3I64A 3LC1O 4FI3C 5FXMA 1VLMA 3PA6A 3OQ6A 3SICE 4QGAA 4GC9A 4RSMA 3EVNA 4O4LF 1NUSA 4PYRA 3ZE2B 1HOTA 1O94D 1A4IA 3ED5A 3NTLA 4P7KA 4HXYA 5F1PA 4OAQA 3P94A 1PCXA 3D1JA 4ZGWA 5HQTA 2DM6A 2BEKA 1NAHA 2YZ7A 1WCIB 5EQDA 4MYHA 4ZOLB 1G8FA 1KEZA 4PYMA 4QVKA 4WADA 4C7BA 1JVBA 2H0QA 2HCTA 4FN4A 5ADHA 1ZI6A 2B7CA 4IW3B 4V3CA 3W5HA 4X8HA 3G13A 5CNJA 4EVCA 4IILA 1PQUA 1DC4A 4ZZ1A 4BNVA 4EF6A 3W5DA 1CY2A 1O9HA 1KH1A 3NAZA 4JUDX 1EHYA 3HJGA 5ILOA 2ZBDA 3BGSA 4J1TA 2CNNA 1WSDA 4M8IA 1Z7YA 4HC4A 4JMLA 4MVCA 5AOBA 1DZIA 3AIIA 3TKAA 1RM4A 4CM8B 2FAXA 2OC9A 2YHUA 3N1UA 1CETA 1OMOA 4FYWA 4V03A 1XG5A 1TCUA 2I87A 3BKXA 3UEOA 3WL7A 1ZMBA 2WEKA 1SUPA 3KD3A 5EOVA 3Q40A 1BKSB 2GBFA 2PV0A 3W6UA 4D92A 1Y3IA 3G1UA 4K6HA 4BNNA 3BGVA 1E9AA 2PRJA 1CUXA 3L1KA 1B41A 2WABA 5DZSA 1IN5A 4IIJA 3I9FA 1YBVA 5CA0A 4F1JA 3IR6A 3C8UA 1W73A 4INPA 4L0DA 2BM1A 3TQFA 2O2YA 2A0FA 4RS4A 3KOWA 1R66A 2ZWAA 4PGFA 2CLOB 4QRDA 3I9V1 3IMEA 4YCLA 1VLHA 1MT3A 3KPVA 1N2CE 1N2CB 3QBEA 4TLMB 3ZE7A 4LJ5A 4MI9A 2GERA 3QY0A 2FZVA 1FPMA 3QU5A 4EAAA 1MUUA 2CMFA 4B6SA 2O3SA 3BRSA 2UVQA 4HDRB 4BYGA 4IICA 1YJAA 4PCVA 4A6XA 4BO8A 1XEWY 3DSRA 4GPBA 1E7RA 1RLOA 4CQMB 2J5RA 4F11A 2V7XA 2H59A 2VZEA 4K03A 4XH9B 2CMKA 3GPDG 1LDMA 4RWEA 4ZDIA 1FX1A 1U65A 2JVJA 2VO1A 3OSZA 4Z4CA 5KWJA 1YJ8A 4EUSA 1Y34E 3NHJA 4F6RB 2IF2A 1JJFA 1PQWA 4RF3A 3RF6A 3QBVA 4HFJA 1XU9A 1Z39A 3ZWWA 1YBHA 2F48A 5J59A 4BVEA 4HDKB 1Y7TA 2OOSA 5CAEB 3ZJTA 2H1HA 1OU4A 2DOKA 1H1LB 1EQ2A 2BJYA 2AJTA 2QYSA 5HE9A 3NM5A 4QGSA 2YVKA 3UJ3X 2RIPA 3O83A 1XKXA 3QIVA 2O5RA 2ZJ2A 3IIKA 3MTGA 1V8ZA 2XH8A 4CUZA 4K6KA 1G8PA 3EGXA 3AI1A 5EMLA 3FYCA 2WTLA 3WIBA 4C0BA 3DZIA 4PAGA 3FOFC 4C3ZA 4EHIA 2HMUA 3IP1A 5M04A 3SYMA 4G5XA 3AKDA 3GF4A 3L93A 5F7JA 4L3OA 1QJCA 2GXUA 3JRXA 4NHOA 1IHYA 4KOAA 4WCVA 1JFSA 3ONVA 1KK0A 2MMCA 1RCDA 4LBZA 4Q1VA 5CNKA 1L9KA 3TMAA 1CEEA 3MTBA 2DUNA 1TVMA 2CJPA 3P4XA 3JARB 2IL1A 2C0PA 1OT3A 5IM4F 4YCSA 3K9GA 4G97A 1VIVA 3EXIB 3GOQA 1TDJA 5JSZB 3SDSA 1SD5A 3GDWA 3TIXB 3FBGA 5M5BA 4MAMA 5KNDD 1SWVA 5EMMA 3HLYA 5SY6A 2XMRA 4KKVA 1CUSA 1RJEA 2HQRA 2W2LD 1H0SA 3JVIA 4AKTA 4C2UA 1CHNA 3AF1A 4EG0A 1EUDB 4GSKA 4KMSA 1L8AA 5I9LA 1NSTA 3SS7X 4OATA 1R00A 1V6CA 3FVQA 1XYYA 3S99A 3G2PA 3TI9A 4BX3A 5B4VA 2HWUA 4GMXA 4WNCA 3K4PA 4RV5A 1SBNE 2XVZA 4RYLA 1ISHA 5LQAA 2B5VA 2PD4A 4MEBA 4XDHA 1VIMA 4DLSA 2BPOA 1XVLA 1MW9X 2GETA 1BE1A 2QRUA 1OFVA 1G4HA 3COWA 2BM0A 1BKDR 2EZ9A 2YWCA 1A8HA 2VJMB 4B40A 2GZHA 2V65A 1YBFA 1NBMD 4RJ2A 3SBXA 2DH5A 4DLBA 5LZ2A 2ZA6A 1U3WA 5FWXB 1N5KA 1DBQA 3Q0TA 5JAIA 2BONA 2H1LA 4ZI3A 1M34E 1M34B 5HMMA 3TTVA 2XKKA 2PX5A 3ADDA 1CZLA 1KOLA 5LP6C 4HYYA 3FPBA 4DIBA 3M4NA 4H7FA 2PBLA 3A1FA 1QFSA 4MYTA 2JHPA 4FX2A 2ZM5A 3G7NA 3VBEA 2R6CA 3AEQA 3HB7A 5KYKA 2CIHA 5C1DA 1E7SA 3O4IA 2PEYA 4ZK2A 2Z3WA 4NAHA 1HV8A 2P3LA 3FGNA 4J1SA 4MVJA 3SKVA 1PTJA 5EAIA 1DIAA 1EIWA 4W4LB 4BBZA 3FN4A 1Q7BA 4C22A 1J5EB 2WNHA 5FUBA 5GGXA 2C1XA 4W7IA 4H6WA 1E89A 3ESAA 4REMA 3TSOA 5C7LO 2IPNA 4A2WA 3PXCX 3B6IA 4D6PA 5I9SA 1UKYA 1YZLA 3F4BA 5AKIA 1JBEA 2JFNA 4J7XA 4E1VA 1AM4D 4MUMA 5BV8A 4BMNA 1KYIA 3AFMA 3D6MA 3BA1A 2XKBA 2B8WA 3N75A 3OY7A 3ZVMA 2ANBA 1PT7A 1C1YA 3A6FA 2PJRA 2YQ4A 3TAXA 3W05A 5DBHX 3G2IA 3IPCA 3OCUA 3OOJA 4ND1A 3E1SA 3PEEA 2F00A 4D3SA 2QZSA 5K3DA 4X6UA 4ENTA 3M6IA 1M1UA 3EW7A 1GY8A 3GFGA 4E7PA 2PIAA 1TW2A 3SYNA 3NDBB 2VOJA 3QPUA 5EHZA 4NQZA 4OYNA 1FJXA 3FMFA 3D6JA 1USUA 4HGQA 4RXUA 3WNVA 4ZD6A 5T4HA 3KLOA 1DAPA 3WRYC 3DMYA 2QM0A 3SMQA 1IHXA 5HA5A 1IJEA 4Q7MB 2VP2A 1SRRA 1ZGAA 3J7AC 1Z4OA 2UYQA 5LUAA 4RBNA 1A95A 1P91A 4K1LA 1ZMXA 1RLTA 3H4TA 1V8FA 3RSFA 5F7XA 3ZHOA 4QQFA 4LRUA 4CQNA 2ZURX 4PG7A 1U7HA 1W0JA 3LDGA 1TPZA 1ZZEA 3TKYA 2YJNA 3ZQUA 4ZLWA 2YC4C 4TTVA 2C2KA 1D1TA 2GILA 2JCGA 1CJCA 2AXPA 2W11A 4M1MA 4EG3A 5HZMA 4H3VA 2RGWA 3LHIA 3VR6H 1HC7A 3PQFA 4CKEA 2J3QA 1TK3A 2P2DA 3LVFO 5EZYA 3CSDA 1DO0A 4YREA 1VKNA 3FCEA 1OAKA 4DG9A 1E2IA 2AN3A 3EOBI 2Z9DA 1T1IA 1C9MA 1UT6A 4D4IA 5AVRA 2Y99A 1DBSA 3SZMA 3FSJX 3RYFB 1G3MA 1B8PA 1U1CA 4EELA 4U2CA 4L3VA 4LXGA 2Q6TA 4JASB 3AF7X 1XU7A 4TXLA 3BT5A 4GPD1 3ICCA 2XQIA 2A30A 1X7WB 4KLAA 5FWYA 2R6JA 4FN5A 1A69A 3QA9A 5K0JA 4JI4B 4CJXA 1GZ7A 2IS4A 1BKYA 2DCMA 3KBBA 2ONKA 2A0YA 4BBJA 5FTWA 1R6TA 2Y2VA 3VR3A 3RJZA 2WU1A 1Q0RA 3BEDA 4I6GA 4CCWA 4ZEMA 1JEEA 3SM3A 1HMPA 2JHCA 2OCKA 1Z6AA 1TECE 4NMWA 3PF9A 2JIPA 2FHPA 3KDPA 2BGIA 2BAGA 5DM60 2C5LA 3HDHA 4AG3A 5HU6D 1M6YA 3PKZA 1V26A 1WTCA 3WFZA 4XJTA 2SHKA 5K8CA 3GJ6A 1IVYA 5HEKA 4PS1A 5CX4A 3P9NA 5FO1A 2C4UA 4C4SA 2PXAA 2ZE8A 4MW4A 3MMPA 3JASB 1RCEA 4W9NC 2GZRA 4RVSA 2HH9A 1ZQ1A 2Q4DA 1KIAA 1NKVA 3HI6A 2FEKA 2J3KA 2L82A 5DTQA 2P8SA 3B9BA 5HDBB 3VYWA 3UPTA 4CEJB 4PLCA 1HL7A 1FW6A 1ONSA 2GBPA 1BJRE 4UPVA 1GV0A 4N3NA 2QP9X 2VTVA 1X7GA 3SEAA 2XUIA 3U9LA 2MU1A 2ZJAA 1Q22A 4DC9A 2QNIA 2BVNA 1U0LA 4TKLA 5ENDA 4IG4A 3ZIUA 3ROZA 1TZCA 1KJQA 2EGGA 4I1OA 4Q19A 1VIDA 2ANCA 3OKFA 3FJYA 4MQ5A 4NV3A 4X97A 3UJ6A 1NP3A 2RGXA 3A4LA 3I05A 5HF5A 1W2HA 3U56A 1WB9A 3ZV4A 4M1WA 3ZS8A 4LHYA 5A03A 1NJGA 1OOEA 2PRYA 2HSDA 1T25A 3AHIA 5E6SA 3WFIA 1PT5A 4WWHA 2L19A 5JNUA 1YZYA 1U3VA 3DTVD 4KXLA 1F1BA 3S2YA 4KXFB 2DLNA 4OQPA 2XT6A 3C3WA 5HP4A 2XPCA 2I6TA 1Y3HA 1SCQA 2X7HA 3UK1A 3CRW1 2OTCA 4EJ2A 1RZ3A 1QH0A 4DBZA 1JTVA 3VV2A 3RS5A 2PHZA 3CONA 4ES6A 3N8GA 3E2MA 2NSYA 3DTTA 1KHTA 2AEEA 4O5AA 1UQRA 3BXHA 3NYIA 2V98A 1UJ4A 4FU0A 4YRPA 1P2FA 1OREA 1JZTA 3WADA 2WC1A 4MS3B 1M1YE 1M1YB 1YRAA 1QP7A 2GK6A 2BUCA 4S05A 4HI0E 2A58A 4UFOA 4LHZA 2X9GA 3WRXA 4B9EA 2H4ZA 4WDQA 4MNTA 3S27A 5D87A 4X0JA 1P1FA 1XTKA 2FUCA 5BV2P 1GCOA 5FFEA 4RM3A 4X3OA 2HJSA 3DTVA 1JHVA 1THZA 2ZJFA 1SC9A 1VFPA 5B2ZA 3QLUA 5AVQA 3BXZA 4S1VA 2B21A 2IE0A 4B83A 1GUFA 3DMRA 3EEOA 1U9YA 1MAVA 1NR1A 2QNRA 1AXGA 1QYDA 4GKBA 1IM2A 1EFPB 1DAMA 1RRFA 2WJVA 3MCWA 1GA6A 3OF2A 3GLIA 4WE3A 2P6NA 2NTJA 1G3RA 3BXXA 3WYBA 5C1OA 1ZBQA 3H2IA 1UFRA 3O2NA 3AC0A 5B1DA 3ZY5A 2G36A 2IZ1A 3W2FA 4OKSA 4AYWA 2G77B 2JW5A 4FYYA 2H65A 3DR3A 1FQWA 3BKWA 1NOKA 4RVNA 5DHQA 3K71B 1KFEB 2IY4A 1U0SY 1ZD9A 3PUVA 1KZ6A 5KQGA 4HWTA 4DQVA 3R1IA 1AD2A 4E5KA 1R5OA 2B6HA 2VYFA 4I19A 4LJAA 3LYHA 2JLUA 1XQ1A 4YCMA 3Q8LA 3AL0C 2BDEA 2BD0A 2ZQ5A 5IEBA 2IDMA 3ND8A 5BSHA 2BH2A 4LFBB 1F6BA 3E27A 1Z6OA 1Q50A 3AKEA 4Q12A 5DFAA 4X3CA 1CJTC 3S2GA 4KPUA 5U9CA 1UZAA 2PMDA 5IRCD 1E1QA 1R18A 4ZAWA 4B4OA 2OV4A 1D3AA 1U3TA 1XCLA 3DHNA 1FLAA 5FBWB 3VFDA 1XT6A 2I33A 4M9SA 5BPFA 4LZJA 3UAZA 3DMDA 4KR9A 4FMCB 3GPBA 2PWAA 5A02A 5CDUA 1WLYA 5IBCA 2X6QA 1GL6A 2FN3A 1EUCA 3VKVA 4JI5B 1F20A 3H5NA 4CKZA 4MHTA 2JCYA 1CZRA 1N9ZA 3RK4A 3MTJA 2HXGA 4GPEA 5ALUA 3R75A 3KUUA 3W7AA 2DJIA 2GPYA 4ER3A 5I7EA 3F71A 1C0IA 2MTBA 1RPTA 2PR7A 2QK4A 2R00A 4ON9A 5JPIA 5JQWA 2XLCA 4OX9B 5FFAA 1WB5A 2ZK7A 4LJSA 4PNHA 1TEXA 1JKUA 4CN8A 1R6AA 4LVNA 5EKUA 3SG0A 2AFRA 4N4AA 1GG5A 3KOYA 1E7QA 3A06A 1U8FO 4BXOB 1JA0A 3U7FB 4L78A 1MABB 3V1NA 1QPZA 5EHXA 1LU9A 3PXUA 2PLRA 4L22A 3T7CA 2QSYA 1IZ0A 3PHCA 4FKMA 4HWKA 2HM7A 4XAQA 1W7AA 3MZ0A 3PC8C 4GGPA 1X7DA 2PH7A 3B7WA 4E6EA 1PVDA 4WVFA 1WMDA 4I8IA 1P4GA 1KTVA 3PFIA 3TTTA 1B43A 1GTMA 1L1EA 4CF4A 2ZJZA 3SNHA 3Q0EA 3GPCA 4HS4A 1T8PA 5D6NA 3AXTA 2ZR9A 4LJ4A 2AR0A 4Y9SA 2QRZA 2IU0A 2PYBA 3GGZA 1OZ0A 4C2TA 4LFAB 3RS2A 1UL1X 3RREA 1TYDE 1Y8AA 2XHEA 1SVIA 1AKYA 2KYRA 3ELYA 3JRWA 1YULA 4GX0A 5CP8A 4X24A 2V6MA 2RHWA 5FFNA 5FOUA 4ALNA 3GJQA 3FTFA 2CBZA 5DGDA 2Y8EA 1EX7A 3OMXA 4MO2A 4YP0A 4QRHA 1FNMA 3V8EA 5JYDA 3FYUA 4TSKA 4KQEA 1CR2A 4FQ7A 2A9OA 5F5LA 3L4JA 3I83A 1P73A 2I29A 1GVHA 1VPDA 3AUUA 5JO9A 5CCEA 4QULA 1Z0FA 4JKOA 1SBYA 5L3SA 1JR4A 1UBKS 2JIMA 2W2PA 4RHUA 4YRSA 2EAUA 2PYDA 1S2MA 4M55A 2WY2D 2NX2A 2WILA 3UQYS 1TM1E 1POXA 1X19A 4BWFB 3U60B 2IBTA 3WKAA 3K70B 3WRVA 2OO3A 2GEFA 2QL9A 1JQJC 2HWKA 4KXXA 5HM6A 4FEGA 4P83A 2WVGA 4U1RA 2QDXA 2P30A 3T3IA 1IJFA 2C59A 1HDEA 2I1LA 2N46A 4FJ1A 4UE2A 1RXWA 4C6TA 4L8VA 4PPQA 1O95C 1QRRA 2ZI3A 3NHKA 3THXB 4KPGA 4R5MA 4OX9Y 3LNCA 4RJKA 3CR7A 4L73A 5JH7B 5B4UA 3KVVA 2LDXA 1Z18A 3LP5A 4Q18A 4UUAA 4OI0A 1OHHA 5ARCA 5FPTA 3JXEA 1XLUA 4BRSA 1FDUA 1ZOIA 1PHRA 3MPSA 3QVGB 3CVWA 2TSYB 3URKA 3CR8A 1TEZA 3DBHA 3DD5A 3IJEB 1KMQA 4KV9A 2JHAA 1V37A 2NUPA 5EXSA 4EI9A 2WG0A 2BFOA 4JVLA 4KU4A 2VYCA 2HMWA 3ZWAA 3HABA 1KL7A 1L3CA 4BP3A 3I5MA 2Q5LA 4RZ3A 3RVOA 2P2SA 2V15A 2WM8A 3TZKA 1GAQA 3VHRA 1OILA 2DFLA 2Z5LA 13PKA 3FBWA 2B5WA 1FQOA 1IRIA 3I09A 5G4KA 2NZXA 1JR3D 5K0CA 1IHOA 3SFTA 4QHTA 4KSYA 1RBYA 4G23A 2CVPA 1GTVA 1ZJ5A 2OSBA 4L8FA 5C53B 1QH9A 3LY8A 5EXTA 2CLKB 3DXFA 2YY7A 3M2PA 4YAEA 2AG0A 3H9GA 4EEXA 4XW2A 5DSTA 2GARA 2OV3A 2QD3A 2BGMA 2AX3A 2GRUA 2J0EA 2PZEA 2OYSA 2QAGC 1CRPA 1A9SA 1FNCA 3T3EA 4M9XA 1PZXA 4LBYA 1LRJA 5KHAA 5C5IA 2OHHA 4OLAA 1IMOA 1IZYA 2XIQA 1ZOPA 4HUQB 1W87A 3VR6D 2FEMA 2HA4A 3W5VA 1XXHB 1XXHE 4I2VA 3ONNA 5E6RB 3SGLA 1SXQA 3BB1A 1YB2A 1NG1A 3R0VA 4OD0A 3SSNA 5J47A 4BZPA 4DUPA 4TKUA 1EX6A 3G85A 3PIRA 5ENZA 5ESXA 2X1HA 3TDKA 4F97A 1MGOA 3LCCA 1EUMA 4M33A 1L4EA 2Z1NA 2P6PA 1WUTA 3E6AA 4Q4DA 3W2GA 2ZT5A 2XDAA 2PZMA 5AVZA 2GO7A 4CG2A 4XCXA 3AETB 4C0SA 1RCUA 2IRWA 3RRFA 1AGNA 4KWCA 4R2IA 1E1RD 3UKJA 4X66B 1FQJA 5JBNA 4PTYA 2VSXA 3FLBA 5LZ8A 4MUDA 3FCYA 3OE7A 1Y1LA 2GKOA 4FYPA 1Q74A 3VHQA 2XWQA 4OG2A 4X1KA 3UMSA 3OOEA 4W5NA 3EH2A 3U61B 1CR0A 2FFXJ 3T5DA 3TUIC 3UWSA 3KJHA 3IV7A 2A35A 5HK9A 2VDWA 2KPOA 2ZVJA 2M6LA 1BZYA 3HCPA 3OFNA 3I45A 2RH9B 4Y2GA 3P9YA 2B25A 1M2VA 2HJGA 5HX7A 1X86B 1MT0A 1XNGA 4E4RA 2CT8A 1YCGA 2CK3D 3D4IA 3KVNA 2ZPUA 2FLKA 1UMCB 1VOTA 1UZUA 2HFJA 3OCZA 4Y7DA 3RC7A 4WGGA 2NPOA 5KVAA 3NS7A 4YMUA 4QHSA 4WGFA 1KOFA 3S40A 2WD7B 4TZ6A 2XOEA 2XSZD 4LY3A 1RIFA 3RBAA 4F3TA 3JAKB 5JAPA 1LTKA 3I34X 2VXYA 2QVCA 3F73A 1GAEO 4L3WA 4G24A 2HIAA 3G0CA 3RBXA 2OV1A 1KPHA 3F5QA 4PS0A 5AW8A 1N3BA 2IHJA 3BM5A 2SNIE 1ZM7A 2VJDA 2DSNA 1PSZA 3QWFA 1PT9A 2FW1A 2QTHA 3IQZA 4D2IA 4B3XA 3ETGA 1L5HA 3AEYA 3CTMA 1QH1A 3SC2A 4KN9S 1X87A 3FPJA 3KU4A 1OYOA 3UMRA 2YZ2A 3O2JA 1CEXA 5CT9A 5I7RA 1NQOA 1OLXB 4II3A 1B7GO 1VMIA 1B3RA 4WERA 3QPCA 3SLGA 4YVZA 1YQ9A 3W2EA 1CRWG 1M5TA 2ZJ4A 3AR5A 1E9EA 1MXFA 2R1TA 1RHKA 4QDXA 4BLTA 2OB1A 3HCDA 5CYGA 3M8KA 1NMSA 2BHTA 4L1KA 4LCEA 2G70A 3N87A 3AJPA 5FNZA 3R9IA 4B3SB 2V2RA 4XLLA 3R20A 2D1TA 1BROA 1UAYA 4RK0A 4LQHA 1DRVA 2HNKA 3L46A 4U2FA 3AOEC 5IUKC 1U1EA 4AS2A 2WQ6A 2JBAB 4KIGA 4DA6A 3BN3A 1GM5A 1JIQA 3DKKA 2A1IA 4XZ3A 1CF9A 2JASA 1ZH6A 1K3UB 1X7YB 2CHVA 2R1ZA 2QTVA 2Y68A 2NU8A 3RVNA 1EVQA 1TZMA 3CX4A 3ZNNA 4D9JA 3VQTA 4RULA 2YJ4A 3PTZA 3U1VA 3HCFA 1QRUA 4JLBA 4B0OA 2VBFA 1ONBA 3MJFA 4DLYA 1ZD4A 5HW0A 2WWXA 3LS2A 1I30A 3ZHYA 1UQUA 5KTRA 1YIDA 4OHPA 1X92A 4MUBA 5HF9A 1XJQA 4K9LA 5C1PA 3LT5A 1I4OA 1BMTA 1IY1A 2FWJA 2C3OA 4JI8B 2PGLA 3UAGA 3NNSA 2C3MA 4XOIA 4F4DA 1CLEA 4HZGA 4QFDA 4BMDA 1XROA 1E6KA 1YFJA 3COVA 2PUBA 2A9RA 1GCUA 4C14A 1N7IA 4RMNA 1YIAA 2W93A 3IT2A 2IP1A 1Z56C 2AK3A 3RFFA 3TB4A 4EHFA 4UEQA 5CB0A 3AHFA 1TQ6A 3QVWA 2ROQA 3H42B 4NWIA 4MRSA 2O19A 2E1PA 3LG2A 4MLPA 1GEGA 1TAQA 4Q3EA 4D99A 1NLMA 4Z1MD 1GTRA 3ZXYA 4WXMA 4Z6KA 1ZU5A 5BR4A 1IY8A 1F0KA 4H08A 2GO1A 4A0SA 2H11A 3R5KA 5BN1A 2XI4A 2DT5A 3GBPA 4LTDA 4IIJB 5I48A 4KR2A 4I4CA 1RXUA 5FR2A 4EHBA 3E23A 1RWNA 1MB2A 1ZU4A 4RPHA 5IG2A 3D3WB 2Z57A 3SVTA 4EWLA 1JLMA 3HC7A 4MQFB 2Q29A 2IYUA 4C76A 4BFWA 3IL2A 2GXAA 4MVJH 2C2JA 3D7SA 4IIHA 3DOOA 3M3HA 4N12A 4AM5A 3C7AA 1I7SB 2XMSA 4PX9A 2WG1A 1T0PA 1IBLB 1EMDA 1LI5A 3HJRA 3BWCA 4PIPA 4RKYA 3L4BC 2IB0A 3NIDB 3K8YA 521PA 1H93A 1TM7E 1MLDA 1KC1A 3CG4A 4BQSA 4C89A 4Q7QA 5AVYA 5JKMG 4HX5A 1ZC3A 4OQXA 5DP1A 3TLBA 2P62A 3IEPA 1FU7A 3INNA 5G0VA 1Q14A 4KZPA 5BOSB 5KTPA 3VKGA 3G8CA 1CSEE 2Q6KA 4F6RA 4M0KA 1N2SA 2J5QA 3VKHA 1T2UA 2IYOA 3SQLA 4OH1A 4P80A 3VZSA 8ATCA 1Y63A 1FNSA 2HRDA 2ZUUA 4HDKA 3K9LA 5E2AA 1L7AA 4DBLC 2A3NA 4EO4A 5CAEA 3HEMA 3PPXA 3NPAA 3RGDA 4P86A 3BWVA 4Z8YA 3M3DA 3VOSA 3VPFA 4B4KA 5K6RA 2VT6A 3IKLA 1L7XA 4TO9A 1LGYA 3JWJA 4Y98A 5HKKD 3BVEA 5ALHA 1WKCA 2PH5A 2F7SA 1KEUA 3NTQA 2H1WA 4QIHA 2H85A 1XD9A 5J40A 4KVQA 1O6ZA 3C97A 1ZD8A 1GCAA 2EJVA 4A3SA 2QRLA 1UMKA 3E1MA 3RNOA 1DXOA 5BSGA 4XPIB 2W6QA 4NMLA 4DDUA 3O26A 1XRQA 4U00A 3B48A 5DU2A 3T1OA 4BEBA 1XF9A 3C21A 2ID9A 4CW7A 2JC3A 3H18A 2EX0A 4ZTBA 3T5MA 2ZIUB 4YDHB 3BTVA 1U2DC 3DTYA 3F4KA 3PNOA 4LHSA 1DHTA 2C4NA 4Y2XA 4KNYA 4I08A 1E32A 4EVRA 1IBMB 1YHNA 2GUGA 4TV9B 2Q7OE 3WMEA 3L7AA 2ZRNA 2ZDGA 3K2BA 2GYQA 2J0UB 4WXYB 1COZA 4HAIA 3RIMA 3PIDA 5B4TA 4YI5A 1K9VF 3IOCA 3ND9A 3MTAA 3EVFA 3T3PB 2FP4A 4XWTA 1XL0A 2UZAA 4CV2A 4DCOA 1FVXA 1ZA1A 3E1PA 5KJFA 1GFWA 2UAGA 4G0YA 1E2UA 3LGSA 5T3YA 1Z17A 2H29A 1N3LA 3VC3A 1NW9B 1RYZA 3DYIA 5C18A 1KIMA 2O2JA 3DMHA 3ZY6A 2A14A 5AWFC 1SXJE 1SXJB 3E1GA 3LFUA 5AR1A 1BVUA 4YAFA 3M6JA 5FCDA 5JZMA 1T0HB 3UA3A 1RZVA 3T7KA 1O4VA 1V1JA 3HWSA 2ZTSA 4QNMA 4CKWA 3EHEA 3W8NA 1EHIA 5C46F 5H4GA 2ZT7A 5AJWA 5KYVA 4TQAA 3U48A 1L7VC 1PUJA 3GCDA 4LF8B 4ALIA 3DDHA 4BQPA 2V58A 4B76A 3WLRA 4E5UA 1G38A 4YJGB 2WMDA 2VTEA 2H2GA 4X20B 4O3MA 3HBJA 5D8DA 2HZ7A 3K6SB 1CC1S 3HYSA 5JDIC 3TIVA 5DGIA 5KJCA 3EX7C 4F2GA 3OPYA 3Q7QA 2G06A 1G3IA 1F51E 1PJLA 2SKEA 1CKEA 3FMVA 2FG5A 2BI8A 2F3SA 1I14A 2PSJA 3M49A 5CIQA 1GT91 1ZI9A 4B2LA 4U2DA 1U28C 3OQVA 3R7DA 3LIIA 1ADFA 1O03A 2V3VA 1P5RA 5G1OA 1Y1SA 4ZQBA 1UDCA 1USIA 3DKPA 1GQOA 1N1DA 3JYOA 4RV9A 5HJ2A 4PTZA 5E4FA 4LQLA 4CM5A 4IUBS 4NONA 1CQXA 4IYRA 4XGRA 2JFPA 3X1ZA 4RNDB 5BRNA 1ZN8A 4GKVA 3OEHD 3WKDA 2ZSDA 2OCLA 5AUQA 4DZTA 2RK3A 2AG5A 2ERYA 1X1DA 1SCKA 4HGYA 3WK6A 2CV0A 1NNUA 2R60A 2Y0EA 4FOOA 1Z6YA 2C7PA 2ZZNA 1XRSB 2YMLA 4UD2A 5AO9A 5SZHB 3ESRA 1IY2A 2IS2A 3G2HA 1GJRA 3A6PC 1F3LA 2FF5A 4C6SA 2JNWA 1PEKE 2ZIXA 4XM2A 2DR3A 2O2SA 2WKQA 3GC6A 1SM4A 4EVBA 4REOA 1CNFA 3PW8C 3LL4A 4X71A 1W9MA 1L5YA 4NNPA 1QHHB 4MOWA 2M9MA 4Q39A 4G0NA 1ZK3A 2QHXA 4E3ZA 1KO7A 2BV3A 2D5IA 3C2QA 1NR5A 2CN7A 3MF4A 1P60A 3ASZA 1ZFNA 4RPIA 4ZQIA 1TJ3A 4GWLA 3HO8A 3B1ZA 4FMBB 3K0CC 5LQDA 1D2RA 1V3TA 4AJ2A 5K20A 1H85A 3NIFB 4HX9A 2XQKA 2C2GA 3MGAA 4M1EA 3ZW8A 3IUSA 3JZIA 4UCFA 4XQ9A 1QRAA 5J5CA 3USES 4US1R 3S2ZA 1JQEA 2ZSJA 5CLHA 1JEQA 4GI2A 5AVUA 1NT2A 1OPXA 2YX1A 3N2LA 1Z07A 4WXRA 3GHHA 2WU3A 3C87A 5FPKA 2FW8A 1Q77A 2VT2A 4XUEA 1XMXA 1HI9A 3OPVA 4GU5A 1G8JA 5CLLA 2QOEA 1JECA 4BJ1A 1VCIA 1JI0A 2YVQA 3DE5X 4LYFA 3RG8A 4BMPB 3L8ZA 1OXTA 2WT8A 4B5KA 1ZR4A 1XLWA 3S5JA 1V2GA 4W9MC 1IPFA 3I9JA 5TPZD 4ABTA 3COPA 2RKWA 1N7HA 3AB8A 4MWEA 1K88A 4ZL5A 1XA3A 2HBZA 3A9VA 1H2AS 1QK4A 2RGEA 4ZMCA 2V03A 5JWHA 1C7FA 1L5ZA 1T5OA 2QP4A 3KFLA 5A3VA 1ZN7A 2FWMX 3NQ41 1DV2A 4ZANA 3NFYA 3CZ4A 5J9VA 1XTZA 1CQZA 1Y98A 2BW0A 4U8GA 4L5AA 3WTBA 5CFLA 2AGVA 3GNQA 4M1TA 4AURA 2IYXA 5DJ5A 3MYRA 3K0BA 4TSRA 5F3RA 4WTOA 4BKMA 4E5YA 3ANNA 1X7WA 3N3BC 5HYVA 1U4OA 1A4RA 1WHTB 2UUCB 121PA 4E2XA 3HKDA 2VH2A 3OETA 5FAXA 4QU0A 3U40A 1SXHA 2QE7A 4WY5A 4A8TA 1J39A 1JE0A 3LPCA 3K9BA 1GZ6A 1R0ZA 2ZTLA 4HH1A 5F1YA 1YI1A 4N39A 3RUIA 1NVTA 1LJLA 2ZUBA 1WQ3A 4I46A 3GGGA 3NHBA 5ERGB 4XWAA 2V7TA 4EGCB 2GJKA 1HYQA 2Q6IA 5HZKA 1O5OA 1W76A 3D2BA 5TT0A 3W6ZA 1JLRA 3DVRX 4IDEA 3TFQA 4EJMA 3FRSA 1U5BA 5HOQA 3LVRE 1J97A 1D2CA 3KPUA 4MW5A 4EM6A 1Q95A 5KB3A 1GPMA 1QANA 3LWNA 4QU5A 5EFOA 3I6IA 4P4TA 2HCFA 4MRMA 5A9TA 3RUCA 3AINA 4GYYA 2IPMA 3NOZX 4B3BA 1DBPA 2IIVA 2Z90A 3GUCA 4B4VA 2VTBB 2RHGB 4RLHA 4UQLA 2WYOA 3NEYA 2W0SA 3INGA 2JGAA 2XYQA 4ZDKA 3LC0A 2GNPA 3TIFA 5BNZA 4WD3A 5E8JA 5LP6F 2WDPA 4W8GA 2WSMA 3A9CA 3HDGA 3RROA 2IS6A 5ALSA 4D4KA 1BIFA 1BYUA 5K3BA 4KDCA 2C2FA 3KZKA 1TAGA 3GH1A 4NY1A 3ER9A 3QNWA 4NYJQ 5TQ2A 1NNLA 1SY7A 3ZDCA 4HDQB 1C0PA 3G2LA 1VDMA 3BWDD 1UC8A 3AJRA 4DDTA 2GTIA 4GR4A 4KBYA 2YOGA 4YDRA 3UC9A 3W8RA 2YZKA 3MBIA 1P0FA 1W44A 2ZRHA 4GFDA 1YFLA 1K2WA 1MO2A 3EXEB 5ESRA 1XDWA 2QTBA 2HT1A 1NM5C 3NBQA 2SKDA 4AZSA 2FZWA 4OHOA 3VHLB 1EGHA 4X60A 5F52A 3PEFA 4OUKX 2AZXA 2QPTA 3I2GA 2KB0A 3K9HA 2R48A 4X64B 4M7OA 5ILQA 2LPMA 2HRRA 4LA4A 1YMQA 1G8AA 5IU6A 5HIIA 3X1MA 4DASA 4YMIA 2A5LA 4CGYA 4PBSA 2GK7A 2Q2VA 3CB2A 5HRCA 2I3GA 1IM5A 2CKMA 4BUJA 1LKMA 1BD4A 1UXHA 3DVSX 4Z9YA 3NIGB 2Q0HA 3PE3A 4O2BF 1DG9A 1W0KA 1DC8A 4X6YA 1YDFA 3ON5A 2ALJA 1T10A 1C1DB 1NVWQ 3ND6A 4MPRA 2XDYA 3GN2A 4ZCIA 3BULA 5IAKA 1YNSA 2CVZA 2HA5A 2BDTA 4I50B 4R2LA 5EIHA 3N7AA 4KMOA 4ZVNA 1QIMA 1TJ4A 2XADA 4MV0A 5ALLA 2O2XA 2ADFA 2R84A 5IC5A 1U0RA 4BP8A 1EFPA 4D82A 1TKAA 2NO6A 2YJKA 2WIFA 2C9OA 2QN6A 1OIVA 4X7RA 2OFFA 4XPZA 1TE2A 3PX3A 1CZUA 2CVHA 5IKXA 4MKRA 2AMYA 3UJ9A 3LYUA 4J3NA 1KSFX 3TLAA 1G63A 1P45A 2PJUA 1F38A 2BZ0A 4JJEA 4QAJA 1M0TA 3I9V6 4CUKA 1IXKA 1Y9ZA 3GQBB 3DEJA 1EVLA 3PSHA 1P2SA 4GOXA 3EFOA 3EQ8A 4MUKA 2ORIA 3HA3A 3EC7A 5D2CA 4P08A 1XLVA 2W6JD 3N07A 1DAOA 2PN1A 4W8HA 5H81A 4LJ9A 3SHFA 5HE8A 2PD3A 3BZWA 3N86A 3ECCA 1YR3A 5HCUA 4NSNA 5K3OA 4F45A 3VKUA 1ODCA 1QFMA 4G26A 5KI6A 5C34B 3WK5A 1UM8A 4G37A 4KQ9A 1N5IA 1QO7A 1QP4A 2DJ5A 3WLSA 3K8OE 4X8LA 3HHPA 1GU1A 4CVNA 1A8UA 2HW8A 4R2KA 4FUTA 5BR8B 1ZAYA 3RWOA 1VP9A 1S2IA 5DVZA 1KQ3A 1V45E 4HAOA 3URMA 5ADUS 3IVMA 1U8UA 3RAJA 2NW6A 4EPYA 1W8IA 3CBGA 4IINA 1E2LA 4RW0A 4DM4A 1Y1TA 1X1RA 2BLNA 4QYMA 5BSRA 4H3KB 3PVYA 1J24A 4CKCA 2J6HA 5A5FA 3ZXUB 1PL0A 3U2QA 1B0UA 4L8GA 2JATA 4R8SA 3RS9A 2FX5A 3E70C 1OTKA 1VLJA 3MJ4A 4MUYA 5BW8A 1RC1A 1LXCA 1C7EA 4WLEA 4RTJA 1J9GA 3IP9A 1T3GA 2PQ6A 3AESA 5DHRA 1IOWA 2HN9A 3GCWA 4RPJA 1IEWA 1YDMA 4AY6A 5B37A 4MKHA 5D8RA 3IVAA 1LB1B 1MABA 2Y3IA 2IPOA 3HXTA 4IP0A 2Q6LA 4K2HA 4LK2A 3FDFA 4AB1A 4B44A 5JADA 5CFRA 7ADHA 2BC9A 4PN7A 1ILEA 1RZUA 1VSBA 3LBFA 4YAKA 2R8YA 5M7EA 4IEIA 3CXRA 3BJMA 3LBYA 1Q1AA 3TDMA 3MLAA 1U2ZA 3P2IA 4O25A 4HZIA 2YYSA 1E9RA 4A8HA 1ECPA 3UT6A 1A97A 3PWKA 1AKTA 4MJ3A 3VO9A 4ARCA 2HOQA 5I5EA 2P2GA 3T6KA 1NAIA 4CVTA 2JFVA 1W19A 4Y0VA 3A36A 4ZCQA 1QPGA 5B1IA 3R0JA 3T41A 1S0UA 1IQUA 3ZBTA 3FDIA 3THYB 4DT1A 4GBGA 3A68A 1LQUA 1OFTA 2ZRLA 5AJTA 1UJ5A 3I0MA 2R5FA 3LD9A 4FYHA 4J76A 4MWTA 3RS4A 1TF2A 3NP7A 4CZ2A 1J1ZA 1JHOA 4OHRA 4YRBA 2VZ8A 4IDDA 4DZRA 1YA8A 4RU1A 5JYEA 5GAJA 3VH3A 4MDFA 2GYDA 3IAM6 4N03A 5F3WB 1NC1A 5GGYA 3ETLA 3Q11A 3FY4A 4BMCA 4B75A 2I54A 1URPA 1XNHA 2J31A 1P7WA 2ZR0A 4F9GA 3AEKB 3PR1A 1UXKA 5ALZA 5LQJA 1MC5A 4D3XA 1UP7A 4JA2A 4L76A 2XJMA 2YBDA 3LA6A 1YI0A 4XJXA 3LLUA 4GICA 1EJBA 3HJTA 4C4TA 5K0SA 4KR7A 3DCNA 3C5HA 3CO0S 1PDVA 1D1QA 2NWQA 4EMBA 1FS5A 2OLKA 4PGAA 6REQA 3ZWPA 1Y5MA 3HTXA 3VTKA 5DLYA 4DI0A 2QVGA 4MW0A 4NH0A 3RYFA 1K92A 2ZVPX 1LVGA 1ISIA 1Y1KE 3DDCA 4OBEA 2ZP1A 5AVTA 1WU8A 2FEOA 5J23A 2IH4A 3FOZA 3DCJA 3RRZA 2Q3DA 5KAPA 3QVGA 2AEFA 4XUDA 1IZZA 2PNFA 3SZ3A 1QDEA 3DBHB 2JL1A 1PW7A 3MRTA 2H5EA 2V9ZA 3ME5A 3KA9A 4DUGD 1N8NA 1DWQA 1R8SA 1V4NA 2PCJA 3MQFA 1XLTA 1NL3A 1VSUA 2F8LA 2H1RA 2BE9A 1ZH4A 2LTAA 2AD5A 3BTUA 3CUUA 3EQ9A 1PZGA 1KORA 2LR0A 3CX8A 4J0KA 1N78A 1Z2NX 2QW0X 4R68A 1Z0UA 3NTRA 3AB3A 4HLCA 4IRUB 2ZWVA 5BYJA 4AO7A 4B3CA 5TLSA 1XCGB 2ZYUX 2JIZA 2W2VA 2XVMA 3NC1C 5JG7A 1JYFA 3C3EA 2WTNA 4DJDC 2WVJA 3NV7A 5FV7A 1JEJA 3M1IA 3BFPA 1DFGA 3N5CA 3T7IA 3EE6A 3CKMA 2LCFA 2WT9A 1SGWA 3RODA 1F4LA 3CQ9A 1XYVA 2GVZC 2WV7A 4CMHA 4R2MA 2XEXA 1PWHA 1BXGA 1ETUA 1L8QA 1PS0A 4PSDA 5EXDA 1KVQA 3ORHA 3CWCA 2QTFA 3B12A 1G3UA 4CKBB 5AW0A 3CNEA 2NUAA 1YQQA 1XXHA 4PNPA 4W5TA 1SXPA 1FVHA 4FCWA 4FT2A 2HHJA 4ZVMA 2NUTA 1PK9A 2VDMB 3TAUA 221PA 2HMAA 9GPBA 2WA2A 5E4JA 1XTIA 3E5MA 3AONB 3QPBA 3NHSA 2JIOA 4L6IA 4PINA 2ZR8A 3RE7A 1HZZC 2ATEA 4ZREA 1BCSA 4ZTZB 4I1PA 2DUMA 2HDNB 3I6MA 2VDNB 3LFHA 3RDPA 1TOAA 2ZRFA 1DT3A 2B4QA 1BSVA 5C2JB 1A7JA 1JHMA 3TG2A 1N5MA 3IPYA 3AETA 1JALA 3KT3A 3KJZA 1E5VA 2R7AA 4X00A 1ISRA 2P2ZA 4OU4A 1H1TA 1N75A 2GYUA 1GR1A 4JP5A 3ZXIA 4AU1A 3F78A 4COKA 5JYCA 4H1WA 3DAFA 4X1KB 1VZ2A 4DCJA 3WLLA 2MSEB 3UIEA 4L6AA 1V39A 5JQGF 2DF8A 4FHEA 5E6UA 1GZ5A 1AHHA 3OC6A 1M2VB 4WFQA 3AVOA 2GUWA 4DLUA 4MEAA 4M0FA 1V9CA 3FNEA 1B2RA 4AS1A 4BN0A 1LBTA 4HSGA 3G8YA 1E9CA 4ZYTA 4IHJF 2HZBA 1B76A 5ALEA 1H3NA 3H3XA 4ZU3A 2N0SA 4BLRA 3U4CA 4L8LA 3HN2A 4DMRA 5CW2A 1KTIA 2D6FA 1JG4A 1IXZA 4JUFA 4U2KA 3JWIA 3IAAA 1TIBA 4ZRNA 4PG0A 3CZCA 4NE9A 4B6GA 3B85A 5D5HA 1I94B 1VLQA 4RA9A 2W0MA 3LJKA 1BFUA 5F3DA 2SBTA 1GPJA 2ATIA 2OZKA 4NCXA 4ND6A 2VUUA 2YIVX 4NV0A 2A9JA 3X2EA 4G0VA 2WWFA 3DAPA 2D54A 3UCXA 3HI4A 4BVBA 2A9FA 1E0AA 3WLTA 2O8DB 4DNQA 2WM2A 1BDMA 4L4ZA 2ORED 1T4MA 1SEVA 1ISFA 1N7GA 1TKPA 2HBQA 1M6WA 2HMYB 1KI1A 3BL6A 3LT4A 4M22A 1L4NA 1JG6A 4IJKA 4P6VF 1GNTA 2MSNA 1SMKA 3ETNA 4EW1A 1YUZA 1YRHA 1W25A 4Y2TA 5CIYA 4RKWA 1W4ZA 3EWSA 2EVWX 1DMSA 3KKOA 2GI4A 1NM5A 2FK7A 3DE7X 3PHLA 4GLFA 3B1JA 4ID9A 2H1OA 1KVRA 4D0SA 1ADBA 5C4MA 1Z28A 3D0RA 3AUAA 3ZQ6A 4EHNA 1NQTA 4BJ5A 1P8JA 4DLZA 4EW2A 4GC5A 1FYVA 4A03A 3BAFA 3VR2A 1MJFA 4KQ1A 2FG8A 1AU9A 1KJWA 4OMDA 1PL7A 3ABZA 3PUXA 2J6IA 4YJ2A 1JPNA 3A9UA 3D19A 1IFXA 1KGDA 4OFBA 4MZDA 2Y9PB 4HXFB 1EHCA 2H07A 3HKCA 1U4SA 3U80A 3MJSA 2GEKA 5B2FA 3H8VA 5C8ZA 5KU1A 2YWGA 1S9HA 2D5CA 1M2HA 3CINA 3Q7PA 4AYXA 5ESWA 3ICWA 2V2NA 2Z04A 3QBTA 4FOTA 3AFGA 5TPWB 3EXHB 2PUFA 4X94A 1NXWA 2H4FA 4QNRA 4Z9AA 5TJ9A 3R7NA 2CEAA 4ZOQI 3HSYA 4OQMA 2YDYA 4Q9HA 4LPMA 3O3OB 3HKEB 4E5VA 1H2WA 1P9LA 4TZTA 4RHFA 3FOBA 4JWTA 2NO0A 2QU8A 1OAAA 4PQFA 4CMGA 2QVLA 1QH8A 2HXYA 3ZHTA 5CFPA 5IX8A 4BMVA 3JQ7B 5I8ZA 3NYRA 4KFUA 3HLKA 5K03A 4UE6A 4DCNA 1JU3A 4KE9A 1CS0B 1LBSA 2OILA 5CVCA 4JS0A 1DATA 1WWKA 3WFJA 1GZVA 4ZJUA 4IR7A 5DLQC 2VOEA 1ZNZA 4BIIA 4HBGA 1DINA 5MF6A 5FA8A 3K6JA 1O7JA 3OM1A 3O90A 5KNCH 3TQQA 3G5TA 3RG2A 3ZY2A 5LWHA 4NMHA 3DLCA 3BA6A 3IUPA 5ITZA 2QMZA 2JI8A 3IEVA 3GUVA 1EGMB 1QGDA 1T8UA 3QKRA 4GX1A 3X44A 2W58A 3V1KA 1BYIA 4KN5A 2HR1A 1UBMS 3GAFA 4QUEA 4F7WA 2C0QA 4AM8A 2FEWB 1GPAA 1KRHA 3I2IA 2P77A 3T9EA 3TLZA 1V3VA 3FTNA 3ZV6A 1XDSA 4DCCA 5BT8A 3O5AA 4L5CA 3QG5A 2PO5A 2G9UA 5E3IA 1EG2A 4D43A 2C00A 1KDPA 1NG9A 1QS0A 2CFRA 4P4SA 3ZBQA 4BVJA 1WE2A 4RY9A 3OAAD 1CFZA 3ABOB 4TMFA 4BFYA 3QVMA 1SOWA 3OURA 5TF0A 3EIUA 4QVIA 3SE7A 3QGMA 4C04A 5GZ3A 3STVA 4EZEA 2VEDA 4NULA 1U0HC 4UNPA 1UK6A 3IHTA 3LUDA 4JU8A 5KX5F 10MHA 3HB9A 2J3JA 4E5PA 5BORA 4NMXB 2FSIA 5KVSA 5BO5A 5AHRA 1KXZA 4C1BA 3EBOA 1F8XA 1QJ4A 1Y4UA 4JJ6A 3RVJA 1E6EA 1N4AA 4Q37A 1OJ7A 1QG4A 1VL8A 2QXUA 3BICA 3EEYA 5LWQA 3U19A 1OYWA 4GR5A 4AY3A 2FWPA 3F1LA 2J9RA 2NZWA 4DKJA 5L3QB 5LLDA 2FG7C 2QUHA 4RLSA 5L6MB 3PCTA 5GU2X 1HYHA 2HA7A 2FTKE 1R9GA 1YAHA 5B3JC 1OUMA 2J1LA 5LXTB 1CIJA 2F6RA 2OV2A 3ONWA 3ORQA 3QOWA 4U2GA 2LCQA 1MQAA 5CA0F 2E37A 1PLKA 2Z2YA 1G6KA 3LUPA 2OV8A 4MLDA 4MYRA 3R77A 2H31A 3VZCA 3K3PA 3H5TA 4QXMA 4UC0A 4A1FA 1GZ3A 4LJ8A 5TEWA 821PA 4G1CA 1O9IA 3TNDA 4JZYA 1FSPA 2FN4A 1RKBA 4QUBA 2BHSA 4TV9A 3RYCB 1R4AA 5AVXA 2NAPA 5JDOB 3O95A 1EGVB 1U0EA 2RHLA 3FA2A 4X7PA 1OXSC 3SHWA 5LMCA 5DMHA 4AZ0B 2JGEA 1LV8A 2FP4B 4CMJA 1Q12A 3L06A 1SVSA 3G82C 4K6OA 1GDDA 2R5WA 4MTLA 2ZUSA 1GNPA 4MV8A 1R7RA 2OT3B 4RNCA 4R0MA 1NNSA 1V3UA 2K7ZA 3UFXA 1WBJB 3C3JA 5KTYA 4PTLA 1ZRNA 2IZ7A 3EVTA 1I2MA 2ETVA 2VDQB 1H2HA 4MVJM 1Z34A 3BSWA 4LDJA 3TN7A 5J2TF 1VKJA 2B4AA 1R1DA 5TRTA 4KW7A 1GU0A 2WZDA 3W5CA 5DHPA 2XMQA 1F6WA 1HA3A 1QGZA 3GLRA 4MICA 4Z3OA 1D2GA 2QVZX 3QNMA 4C7JA 1GKIA 3BF7A 3FTEA 5EXXA 1E3DA 1YZTA 3DF9A 2H63A 3SR3A 2FZEA 3AT1A 1DZ3A 3IAS1 3MPOA 4UNNA 3VTFA 5I51A 5EGSA 4AP6A 3B1KA 5DNUA 4O4HB 4A23A 3ZD9A 3CR3C 4JX8A 1KEEA 3QPWA 5JMPA 4R3UC 4F6CA 4JK3A 1DWUA 2JK0A 2OQ2A 2V7QD 3COYA 4ESHA 3UMBA 4ENPA 1KK2A 1Z4JA 2W6ID 3N8KA 4U2EA 2VJYA 5EKSA 1MQ8B 4U5XA 5K0GA 1M7BA 3P9XA 3R3SA 1GD1O 1KS2A 4AXXA 3REQA 4O2AB 4D3ZA 3CT4A 4LYEA 4YXFA 3FJOA 4FBGA 4XX1A 3UWMA 4QDTA 2BBOA 1A98A 1EZ4A 5IANA 3QXXA 3C98A 1M66A 4JB8A 5E1BA 3VRHA 3GRZA 3GVHA 1CERA 4RDCA 1A2OA 1GRRA 1QQBA 2QTZA 5HFJA 1Q21A 4Z86A 3SFVA 1BWPA 4YLGA 3UAYA 4LG1A 4HDNA 1JEDA 1W6RA 2PPVA 1O57A 3LDUA 3WLEA 3GNLA 5FBQB 4ZI7B 5JAMA 4D26A 2B83A 1MOZA 2O4UX 1HLDA 3KEMA 3SSMA 3HQ4O 4B33A 3S1SA 5IVDA 5ELXA 1PZFA 1OBVA 5JXGA 3T9CA 4P93A 1VE6A 2OBBA 1ZAKA 4XLZA 4X62B 3FPAA 3ILHA 2YXPX 4BTLA 1QBGA 3DV2A 1Z0AA 1A8SA 4ZICA 5GV7A 2B9EA 3NHPA 4P5PA 2HF2A 5JJLA 2RGUA 1ZQ9A 5B58T 1E3MA 5HFNA 2W22A 5JAQA 1V41E 5JS2A 3ILVA 1DTEA 2PUDA 1QKJA 3ICQB 1DPSA 4NARA 5DBIA 5KOHB 4DW8A 4LYHA 3HV0A 4JR1A 5SYMA 1PWXA 1U04A 2XVXA 3V4RA 4JV5B 1RPJA 5JS8A 2V2OA 5FDFA 4DS3A 1D4FA 1M5UA 4NG4A 3T3GA 1KZ1A 4B79A 2G08A 3F2IA 1GZUA 2EJBA 1II9A 4OGGA 5TXGA 1FTQA 1RLMA 2FFRA 2PMBA 4CDRA 5LCXA 4EY3A 1V1MB 2YJ5A 3ONEA 2C9DA 5M29A 2B37A 2PUVA 5AW5A 4GXRA 1AHIA 3FHTA 3ZXSA 1KF0A 3TG8A 5EHQA 2ZETA 3OJXA 3FZEA 4UMDA 3A4TA 3AHDA 3NORA 4C05A 1VJRA 1U6JA 2PWYA 2NXWA 3N0TA 1L5OA 1KI3A 1ZZGA 2R7MA 1P5FA 3MCZA 4J9UE 2KBFA 3PQ2A 1YDGA 3TF5A 1I3OA 4IEFB 3NXKA 1ES9A 1ZOOA 4TWJA 1U7OA 4WKOA 1C4XA 2FQ1A 3OEED 4NZOA 4EGJA 2LIVA 4DHWA 1AGPA 4DM7A 1N34B 3ES3A 3QJ5A 4ISBA 4KP7A 2HUNA 1O77A 2REBA 4WVLA 5ICSA 4FS8A 2BEWA 3QIAA 3U49A 2J9FA 1QYVA 3AF9X 5IMSA 1I6WA 3IMFA 2Q4EA 1Z37A 5AUOB 1Y6ZA 2YH2A 2P1ZA 3W3AH 5AK3A 1YL6A 4N6NA 1BXZA 3QVVA 4UJ5A 5DT9A 1P19A 1WCYA 4FGUA 4JEHA 2HIHA 1GXSB 2PS1A 4OPMA 4CG1A 1Z4IA 2EOAA 3RC3A 3ET5A 4M53A 1B0ZA 5IH7A 2HLPA 3LKZA 4L6CA 4O4JF 4EFMA 3U44A 1UBGA 1UJNA 1N25A 3FUXA 2D2EA 3IP7A 2OXCA 4FGLA 3ETDA 1O6FA 1XX6A 3HZZA 1G8KA 4RA6A 3LK6A 4QARA 3WLQA 1HLPA 3ADCA 1M6EX 4LF9B 2HQBA 5BWBA 2HSGA 2W4IA 2QXYA 3QW2A 4GDMA 1QE0A 2ZJ7A 3QKIA 1UWKA 4J75A 4LZOA 4D9GA 4G1FA 4PHHA 4NK4A 1R5BA 2E4VA 2PU7A 3PHIA 1K75A 2HMVA 2I5PO 2Z2JA 1KPGA 1ADYA 2OAEA 4RD4A 4Z4EA 1Z5ZA 2CLDX 4YYEA 3T52A 1BU5A 3EAGA 3B5JA 4M38A 3I4LA 1F1JA 4CRWB 5B53A 2ZJ3A 3WHLA 3TNJA 2A5FA 3WVUA 1E2HA 1WW3A 4EAQA 3UVEA 2PA0A 2O2GA 3QMPA 3JZDA 2A8YA 1SFRA 4MI6A 3AV0B 2GYYA 1JYSA 3REGA 3LW8A 4EJ6A 3FB1A 1FU8A 4ZCTA 2QM7A 4QXOA 5JNRA 3OZXA 2NOAA 3GYGA 5IMBA 5GTDA 3S29A 1V0JA 3S55A 5K0TA 1WHSA 4JUBA 2ZI9A 3K1YA 4GECA 3N7UA 4OAOA 2FN7A 3L7OA 3WLKX 1R5NA 4O0MA 3R2HA 1TVKB 4TN5A 1F48A 3KJNA 4B81A 5T8KC 1FTNA 3CEJA 1DIOB 3ZDZB 3IAM1 4K9PA 3H3FA 5FT9A 1VBNA 1VCHA 5TQ2B 4LDPA 4C2AA 3HYNA 1ODFA 1OJLA 1FDSA 1YR2A 1F0NA 2AA3A 2HRQA 2NV2B 2BFWA 2ZKIA 4G86A 5I7SA 1HRDA 1N1MA 1G291 1B26A 2A4MA 2WK1A 4ONEA 1TAUA 1W4AA 3UWPA 4DMFA 2FI1A 4KRXA 3O8QA 4YBRA 4TTJA 4RK1A 1G4AE 4MLZA 2DVMA 2AMFA 4M0CA 5EE0A 1HY3A 3KKLA 4DCPA 1RACA 4IAOA 4GI7A 5F33A 2W6OA 3TTXA 1HDCA 1CY1A 2IGBA 5LS9A 3P9PA 2JLYA 2GYWA 2PGIA 3BE4A 2ZOSA 1Z4AA 3IVGA 2Q1TA 5K51A 3RSGA 5LJIA 1RYFA 1UODA 2QXTA 2ZZKA 3K8QA 3DBLA 3QENA 3PXBA 3R2LA 3RE1A 1WXEA 1SUCA 4C20A 1XTRA 3VV9A 3IV6A 2OORA 1F6DA 3N6VA 4L8YA 3FNGA 4DLLA 4B43A 1OX4A 3ENWA 2KI5A 3PNLA 1XRJA 2JH8A 4IHJA 4F86A 1MAHA 4U63A 2BM8A 3L5OA 2RKBA 3IIMA 2PM8A 4KWTA 3LOPA 2AFVA 5DWVA 2ZJ5A 5EPEA 5JSYA 4OQDA 1EXWA 3UPDA 2FZCA 3P5SA 2XT9A 4A5SA 4LRWA 3L1IA 4XSHA 1FMCA 3WLPA 2Z09A 1OX6A 1WSBA 2D0IA 2XAUA 3GGJA 1OGYA 4RMJA 4GI5A 5DX8A 3SXUB 2D3TA 2OOKA 2CZQA 3L6CA 3UUEA 5H3LA 2C77A 4GWGA 1LLUA 5TC4A 3IR5A 3W78A 4ETWA 1YH3A 1TA9A 5GU1X 1J2JA 2X3UA 3DFIA 3FCUB 3GU3A 3QEMA 4BNUA 4GH5A 4NYMR 5F5NA 1ULHA 3IHWA 1YS6A 3GEMA 1ZCBA 2GN0A 2I6XA 2D1RA 3N8NA 4MVJD 1HKUA 5AM0A 1KQFA 3BC1A 5JKLG 1QX3A 2OBNA 4QUJA 3UXEA 3O8CA 2JD80 3KVYA 1OGJA 2C4WA 2AG6A 4G81A 4JDPA 3KT8A 4DOMA 2CXPA 3TNYA 1CB0A 4BS9A 4OSOA 4WDRA 1E5XA 4ETNA 5KKNB 2BTEA 1Z3IX 3WGYA 4N48A 1GL7A 2I3ZA 1EFUA 5JFOA 4WX2B 1ZD3A 1G6Q1 2BEUB 3PUYA 3X1XA 3Q8KA 1TZBA 2L69A 4LBWA 5I7VA 3N05A 4HJRA 1JPJA 2E7ZA 3L7DA 4BVHA 2RGYA 2CNOA 2IVZA 5FO0A 3G88A 1UFKA 1V47A 1VCNA 3Q98A 5FNVB 4L5IA 1KP2A 4A36A 4B3IA 2HY7A 4YAWA 4F5WA 2H1IA 2A59A 5L9AA 2PKQP 3MPUA 2J32A 4KXQA 4U4AA 2ZUWA 2J45A 2XEDA 2A57A 1ND5A 5EESA 2Z8ZA 4XB2A 3LF1A 4LVOA 5FWAA 1WV0A 4JBLA 1BXRB 3A4MA 5IJ9B 3IXQA 3DYBA 3KVRA 5IYZF 1W5SA 3FHOA 2HR5A 1Z4QA 1PWYE 3CRQA 3PR2B 2HGSA 3EUWA 5I5GA 1PFUA 2GCEA 4EK9A 4PPGA 2X0EA 1EFVA 3PVYB 3HHEA 1BRTA 4R7TA 3WGNA 2IY8A 1X0VA 4PFJA 1FVFA 1WSAA 1X1SA 1UK7A 2XUHA 2OPHA 1GGKA 2BKEA 4R8KA 2IVFA 5LZ7A 3W9BA 2QAGA 1VLGA 1K27A 1L1QA 1E5TA 2VP5A 5SZIA 4BFSA 5KJ6A 4N3CA 1JFVA 2WU8A 4KN8A 1NXXA 2CXNA 1C8KA 2XMCA 1I2CA 4QX6A 3PPIA 4LZZA 3LZDA 4KIFA 4JAVC 2R7KA 1RWKA 2EYQA 2WWHA 5EKTA 4BFCA 1GEEA 4DPKA 1D6SA 3KAPA 5EMNA 1XZDA 2QQYA 5F1KA 2C82A 1Z26A 3GEIA 1W47A 3L05A 4KTVE 1N8SA 3SXPA 4C7KA 7REQA 4TOBA 4DKXA 3FPKA 4EGAA 2AZMA 5KNCD 1YD7A 2JANA 1UP4A 3A9TA 5EMHA 5K45A 4W8OA 1OFHA 5MN5A 4C5BA 2Q9CA 2AFHA 1Y4SA 3IXLA 4J7CA 5IVKA 4OQZA 3KSBC 3GV0A 4HNQA 4HWRA 1QYRA 4K86A 3PDHA 1UMDB 1N2EA 2CGEA 2RGNA 3KSAC 1CVRA 1AUXA 1OFUA 2ZPTX 3I52A 4LOAA 3TNFA 4B3FX 3TD9A 5I45A 4GI1A 5JMOA 2CYCA 4IY1A 2WVHA 1NTOA 3T7DA 2Z4TA 1UPAA 1WR8A 4YO8A 4EEKA 1CQJB 5P21A 5LJLA 3U7HB 1LB3A 4C5CA 1DTWB 8MHTA 2O2ZA 3PVZA 1N5OX 3EARA 1OH5A 1E64A 1X3SA 2Y1WA 2GVNA 3ESQA 4NLLA 4TT8A 1RJDA 2VDKB 3V4LA 5IDQA 2QSJA 2FZFA 1U0BB 5E9JA 1H8HD 4M4SA 4NV1A 4U7JA 5KX5A 3BSSA 3DBRB 2PEZA 1QUFA 4PAMA 2ISQA 2DQSA 4FLFA 2D1SA 4QEDA 5JC8A 1TJOA 5CH5A 4IBOA 3OCWA 4XX0A 4AIRA 3B2NA 2IUYA 4JLAA 4Q9KA 2AIRA 3G5UA 2YL2A 4RIGA 1G21E 1G21B 1N6HA 2BFDA 3W5BA 3JTMA 1T3SA 2KHZA 3IAUA 5ALDA 2IFTA 3QTBA 2VA9A 4EB3A 5LOVB 2ZJ6A 1AXRA 1NUTA 2I2BA 2ASEA 4K9RA 4PRKA 2EKDA 2DE0X 4G09A 5F23A 4JEMA 4W4KB 4JENA 1K5DA 1T4CB 1RABA 4DRXB 4TLAA 3ESCA 4X45A 5IS2A 1GTL1 2GD2A 4KH1A 3WOHA 1LSOA 2QPAA 3PDIB 1Y5LA 1G8MA 3WDKA 2CHUA 4HYTA 4JMPA 1WCWA 1NHWA 3KNZA 3QMWA 5CXQA 1CYDA 3J7TA 3WKEA 3FPHA 2JVKA 4DYUA 4LZNA 5JVDA 2K6GA 4GPTA 2QT0A 3E5NA 2ADMA 4YAUA 4MWCA 1E6UA 1NNI1 2O3RA 2YW9A 2I2CA 2Z5GA 5AI0A 4M0DA 4BU0A 4WUTA 5J4LA 3WLJA 4DYZA 3Q3HA 5T4BA 5B36A 1PYDA 1ORVA 1I4LD 1C14A 1ZVKA 2EF0A 2WJGA 3A25A 3EISA 1YRLA 1ECGA 4WH0A 4X85A 4XQGA 3GMIA 3RWMB 1TA4A 1Y82A 3WMFA 4IX9A 2X8JA 1C7RA 4PPNA 4PZCA 4B3MB 4YLYA 1DQYA 2XWSA 3FI9A 5ITVA 2CLLB 1FFGA 1HQDA 3DHWC 4PYLA 2JEOA 5JCPA 1XTBA 3JQDA 2WJJA 2YXNA 4H16A 3ESXA 3P45A 4J9VA 1A7KA 4I4NA 1M76A 4QRIA 5ALYA 3UYLA 4RTKA 1U9CA 2I99A 2IV2X 5HCNA 1ISGA 5BSVA 2QBYA 1IE3A 3OZEA 2F8SA 2QYHA 1WD5A 1WCIA 4MWGA 1D2EA 4RGVA 2MMGA 3WNZA 3LIPA 5ES4B 1ATIA 3TINA 4YHHB 2D4AA 2ZANA 4J0QA 1M6NA 3WBFA 5IJ0B 3AF8X 2ZVQX 3AF0A 1TO6A 2KQUA 1PKEA 1TKBA 3LQ4A 1C41A 2QV0A 4O1MA 1EFRA 3KD2A 4NBVA 4WK4B 1RHMA 4UTNA 1MEEA 1HYEA 3KEOA 3W1EA 2KBEA 1J22A 1JIKA 2WMYA 1YZUA 2D06A 1WDTA 1NF4A 4XARA 4NFYA 1AMNA 4BB0A 3HNPA 1E1KA 1R0WA 4LYXA 5DHTA 4Y1GA 2IHKA 4QFMA 1P2TA 3OJFA 4XD7A 3PGLA 1P31A 3RVSA 1DI0A 3P9KA 2RAFA 1V16A 5ALQA 3F3MA 4IKPA 4QFCA 5L3ZA 5TQ0B 2FR8C 1Z2PX 2WV9A 4KXNA 4NS4A 1QORA 1YV9A 1KBOA 3M3PA 4DR6B 1DWOA 2QYOA 1YF3A 3FPSA 4DB4A 1RQXA 2GYVA 1Q0HA 2O2DA 3PQDA 1MEJA 4BE4A 1U99A 1P80A 4Q4HA 4B35A 1XAHA 1ODKA 3OP4A 3A05A 3QV1A 4R8MA 2PKEA 3D6TB 3QELB 1T2NA 4G4SO 1T4DA 3ZLVA 2XE7A 2JARA 5CUQA 5I9IA 4HAXA 3LWZA 3AUJB 4NECA 3BILA 4UTXA 2ZLBA 3RIHA 1KH2A 3Q10A 5JO0A 5LMZA 3G9XA 4G0XA 1L4LA 3QBDA 5ECGC 4RC9A 2OZLB 3WMWA 2HYDA 4IGEA 1DVRA 4W7SA 2WAMA 3MM4A 4JP8A 3NRBA 5HIJA 4C0KA 3UGTA 5HK8A 1ZD1A 4PEVA 4FJ2A 1VEIA 3SM9A 3PYXA 1PGQA 3LX5A 4KB5A 1CUFA 5HF6A 1UOEA 2GQ0A 1Q15A 2UVDA 3GJXC 4P7FA 4C43A 1FBTA 2WI8A 3U1TA 1VKHA 1KBZA 1DQRA 3LP8A 3R5XA 3ZZ0A 3MJRA 5JSHA 4DV2B 1SKMA 1DQZA 3CPJB 4JQSA 3NYWA 4ZU6X 3NHZA 4FGKA 4W5HA 4DY4A 1KQOA 4ZAYA 1HK7A 4CLXA 1XDDA 4HQOA 1TU0A 2AUMA 1SUSA 5G0UA 1WQ1R 4HXGA 4QASA 2JDID 1DQSA 3CF2A 3KALA 2ORWA 3JZAA 2EZTA 3NCHA 1QQTA 4ACBA 4EP1A 3ZWDA 3M5CA 3M83A 3S44A 4E5DA 4ZYLA 5HTOA 1MX3A 4ZJYA 8LDHA 2PX6A 1J70A 3GEHA 3Q8XB 3M6VA 2X0JA 5H3CA 5IAOA 1CJSA 2IYLD 2XYVA 4FFNA 4DDWA 2B8NA 4GOKA 2IYEA 3IBGA 2HLDD 1ZRMA 3BMQB 4OEHA 3UV7A 1FUYB 5CYFA 1RCFA 4Q9DA 3KKMA 4II4B 5FR1A 1F2TB 2Y1KA 1Q11A 4ARVA 3KHKA 1XQ6A 2WHEA 1F0YA 1LLCA 4TWRA 1EUDA 5EJ4A 5A6SB 1Z62A 3TW8A 3CH6A 3ICOA 1ZVVA 3T34A 3E4CA 1QQ6A 1WZUA 3K94A 4UEWA 5BRAA 2EDAA 2G0AA 3O2SB 1J5XA 1TO2E 1NBIA 1QH8B 1TT7A 2VLIA 3KOZA 5A7GA 3T9JA 1KE1A 3SIXA 3NOQA 4CQJA 5C52B 4HQNA 3QX3A 4TVOA 3GRCA 5HRUA 1NNEA 1RE1A 1TW3A 1XTTA 4JVMA 1MH1A 4I4IA 3UMMA 1TTHA 1EXDA 2VJMA 3DW1X 2D74A 4K26A 1DJPA 3U4AA 4F85A 2PZLA 1LJ8A 1JKMA 4A0QA 3GDHA 1N0WA 5JHHB 1E3QA 3M6LA 5JTUA 1ZIOA 1FIUA 5AW9A 3LFTA 3PC2A 1C50A 1V7ZA 1XN1A 4Q4AB 5C0OE 2XX3A 5KZMB 2KW5A 5LP6B 4A16A 1YQGA 5G41A 3NBZC 2QQGA 4NZYA 5FUYA 3Q3CA 1RWWA 3WK8A 2XXAA 5HQOA 1UC9A 3K53A 2GCOB 4X63A 2AKAB 1IONA 1U8AA 2IE8A 4DYHA 2A0KA 3RV4A 5JANA 4Z9XA 1XC7A 2H7CA 1ZP6A 1NRWA 2QY9A 4TX1A 1QS0B 4TLLB 5FBRB 3SQDA 2Q07A 4JL6A 1AQYA 1U1FA 1YS7A 5HG0A 5HFAA 4C0XA 5IASA 5JIBA 1THGA 4JELA 4IJVA 1EFAA 1OX5A 1TJYA 2ZSKA 5ALRA 1YR9A 4PHGA 1SU7A 1ZVMA 2UKDA 2ECQA 2ZE5A 5C81A 1X42A 1AQ6A 2ZRMA 2P9YA 3HRHA 3C8ZA 2Q3BA 5ERYA 5C8YF 1W5TA 4FW8A 5A05A 1FEZA 3LAWA 3KQSA 3PW8A 1R6BX 4AJJA 1F2DA 2DLCX 2A6PA 3RTCA 2GB4A 2OQIA 2CNDA 1Y3AA 3S2IA 2H00A 4TUYB 1ZWLA 5CT6A 5MN6A 1JH8A 3UUGA 1PJZA 3V1YA 4B73A 5ICGA 3PWTA 1ZUWA 3DEFA 5KJ1A 1OI3A 1QVAA 2XITA 4RIFA 2LXNA 3N8DA 2ZWPA 4Q9NA 4EKGA 5FKJA 3NNNA 5L3QA 4H7EA 3L8HA 1BW9B 2C98A 1QKKA