1JI5A

Dlp-1 from bacillus anthracis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
142
structure length
142
Chain Sequence
QVIEVLNKQVADWSVLFTKLHNFHWYVKGPQFFTLHEKFEELYTESATHIDEIAERILAIGGKPVATMKEYLEISSIQEAAYGETAEGMVEAIMKDYEMMLVELKKGMEIAQNSDDEMTSDLLLGIYTELEKHAWMLRAFLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Dlp-1
publication title Structure of two iron-binding proteins from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 60
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1ji5A00
2G4HA 4RC7B 1VEIA 1UMNA 3RE7A 5LG2A 3E1QA 4TOHA 4IXKA 3QZ3A 3AF8X 3QHBA 3R2HA 5CMRA 4RC5A 2V15A 4LPMA 3Q4NA 3PW1A 3F32A 4PG0A 3AF9X 1LKOA 5HJHA 4TOEA 1NF4A 3WNWA 4E6KA 2FG8A 1EUMA 3FVBA 4CYBA 3UOIA 3NP2X 2FL0A 3BVFA 1JI5A 1RCDA 4MJYA 4EVDA 1IESA 4Z5SA 3E1NA 2ZA8A 1DVBA 3EZ0A 1MOJA 1KRQA 1S3QA 1XZ1A 4II4B 1ZS3A 4OYNA 4MN9A 4ZTTA 2VZBA 3EGMA 2WLAA 3E1OA 5FFCA 2CEIA 4AM2A 2YW6A 2UX1A 3AK8A 4KVSA 2Z5RA 4CVRA 4KVRA 3PZAA 4TOCA 5D8XA 3Q4RA 3RD0A 2V2NA 1QYBA 2Z90A 3AJPA 3FI6A 4TOFA 3PVRB 3RGDA 4RC6B 2GYQA 3Q4QA 4M32A 4AM4A 4M34A 4P18A 4ERUA 5HQOA 2ITBA 3WVWA 2FFXJ 3F33A 4ZLWA 3WVUA 2WTLA 1FHAA 4CYAA 1OTKA 3NP0X 4PGKA 5D8QA 3RBCA 5FFDA 2F7NA 5AXSA 3SHXA 3T9JA 3R2LA 3BKNA 5JKMA 1H96A 5FFAA 5J93A 1LKPA 4LYUA 1S2ZA 4ZL5A 2HR5A 2Y3QA 1RCIA 3F35A 1RCCA 4XGSA 4XKTA 2V2LA 2CLUA 4ML5A 3F37A 3PWQC 3F36A 4ZJKA 4MKUA 1O9IA 2CHIA 2FG4A 2JD80 2ZA7A 1IERA 3KA8A 3FSEA 3UOFA 3F39A 4TO9A 3PVYA 2FKZA 5JKLG 5HJFA 3Q4OA 3IS7A 2V2PA 3AF7X 2BKCA 4M35A 5I4JA 3E2CA 3BVKA 2D5KA 3GE4A 1NNQA 4PG1A 2VXIA 2C6RA 3F34A 3PVTA 3U90A 5E2DA 4LQNA 3KA9A 2Z5QA 5LG8A 4DZ0A 4DYUA 5GU1X 4RC8A 4TOBA 5ERKA 4RC5B 4IWJA 4M33A 3E1PA 1VELA 2BK6A 1JGCA 2C41A 3BVEA 3O7RA 1J30A 1Z4AA 3QD8A 2JD70 1JIGA 3E6RA 1L8HA 4ZKWA 3AJQA 4XKSA 2V2SA 1DPSA 1YUXA 3OJ5A 2CHPA 3PW8C 2FZFA 2V2MA 3IS8A 3R2MA 1JI4A 2CN6A 3EZUA 3A9QA 1BCFA 1F33A 2CF7A 4LYXA 4TW3A 4DI0A 4DE6A 4XKUA 2QQYA 1RYTA 2W0OA 1SOFA 3KA6A 2ZG9X 3R2RA 3RAVA 4DYXA 4Z3BA 3QVDA 4U3GA 5FFEA 3R2OA 1LB3A 1LKMA 4PGIA 1L8IA 2ZG7X 2ZURX 4IWKA 4EVCA 1F30A 2XKQA 2V2RA 4DASA 3H7GA 4EVEA 5JACA 3MPSA 3WVVA 5JKLA 1N1QA 5D8RA 3ISFA 1MFRA 4EVBA 1JTSA 1VJXA 3BVLA 3BT5A 3IQ1A 1GWGA 3E6SA 1Z6OA 1NF6A 1O9RA 2ZA6A 3PW8A 5FEJA 5D8YA 2HTNA 4ISPA 4RC7A 1BG7A 2FJCA 5CMQA 2XJNA 3HIUA 4REUA 1JKVA 2IU2A 2C2UA 1TJOA 1AEWA 5GU3X 1ZUJA 1JREA 4CMYA 5GN8B 3ERZA 4AM5A 4LPNA 3PVYB 3QB9A 2V2IA 5J8SA 2YJKA 2JD60 1BFRA 2GYDA 3AK9A 1RCGA 3ISEA 4CVTA 4A25A 1HRSA 2FHAA 1RCEA 2XJOA 5GOUA 3AJOA 2RBDA 4LQJA 2V2OA 3PVTB 3R2SA 3F38A 3E1MA 2PYBA 4ETRA 3PW1B 2X170 3PWQA 5C6FA 4TODA 5D8PA 4II4A 5LS9A 1YV1A 3ES3A 4TOAA 5K53A 4ZL6A 1Z6OM 2GS4A 2XJMA 3O7SA 4ISMA 4MY7A 4Y08A 3VNXA 4MUDA 5K52A 2VXXA 4CVSA 3KX9A 2YJJA 5IX6A 1DATA 5CZUA 2OH3A 2QF9A 4CMYV 1UVHA 3HL1A 4ITWA 4QUWA 5D8SA 4LQVA 2V2JA 3KWOA 1NFVA 3PVRA 2C2FA 4RC6A 1QGHA 1YUZA 3GVYA 2WLUA 1R03A 4LQHA 1VEQA 2CLBA 2CIHA 2Z5PA 3KXUA 3GHQA 1TKPA 5J8WA 2BW1A 2Z6MA 4R42A 1SQ3A 2C2JA 3KA3A 4ZMCA 4ITTA 3TA8A 4KVQA 3PWFA 2OC5A 4LPJA 1XZ3A 2IB0A 5J9VA 3SIDA 5E1UA 1S30A 5D8OA 4DYZA 1JYBA 1VLGA 4ZKXA 5FFBA 3BVIA 3KA4A 4CVPA 3R2KA 4TOGA 3E1JA 4DYYA 2CN7A 4YKHA 5GU0X 3NOZX 2BJYA 2IY4A 5ERJA 5GU2X 1TKOA 3A68A 1TK6A 1JKUA 1B71A 3E1LA 3SE1A 3QHCA 5LBHA 2ZG8X 2XGWA 3UNOA 4CY9A 3SH6A 4ZKHA 2YW7A 3OGHA 5JKMG 5GN8A
chains in the Genus database with same CATH superfamily
2V8UA 2G4HA 4RC7B 1VEIA 1UMNA 3RE7A 5LG2A 3JZ9A 3KHKA 3E1QA 4TOHA 4IXKA 3QZ3A 3AF8X 3QHBA 3R2HA 3N6OA 5CMRA 4RC5A 2V15A 4LPMA 3Q4NA 3PW1A 3F32A 4PG0A 3AF9X 1LKOA 5HJHA 4TOEA 3C21A 1NF4A 3W54A 3WNWA 4E6KA 2FG8A 1EUMA 4YXJA 3FVBA 4CYBA 3UOIA 3NP2X 2FL0A 3BVFA 1JI5A 1RCDA 4MJYA 4EVDA 1IESA 4Z5SA 3E1NA 2ZA8A 1DVBA 4W4LB 3EZ0A 1MOJA 1KRQA 1S3QA 1XZ1A 4II4B 1ZS3A 4OYNA 4MN9A 4ZTTA 4YVZA 2VZBA 3DBYA 3EGMA 2WLAA 3E1OA 5FFCA 2CEIA 3GGZA 4AM2A 2YW6A 2UX1A 3AK8A 3GGYA 4KVSA 2Z5RA 4CVRA 4KVRA 3PZAA 4TOCA 5D8XA 3Q4RA 3RD0A 2V2NA 1QYBA 2Z90A 3AJPA 3FI6A 4TOFA 3PVRB 3RGDA 4RC6B 2GYQA 3Q4QA 4M32A 4AM4A 4M34A 4P18A 4ERUA 5HQOA 2ITBA 3WVWA 2FFXJ 3F33A 4YXMA 4ZLWA 3WVUA 2WTLA 1FHAA 4CYAA 2Y44A 1OTKA 3NP0X 4PGKA 5D8QA 3UFBA 3RBCA 5FFDA 2AR0A 2F7NA 5AXSA 3SHXA 3T9JA 3R2LA 3BKNA 5JKMA 1H96A 5FFAA 5J93A 1LKPA 4LYUA 1S2ZA 4ZL5A 2HR5A 2Y3QA 1RCIA 3F35A 1RCCA 4XGSA 4XKTA 2V2LA 2CLUA 4X0JA 3VVAA 4ML5A 3F37A 3PWQC 3KDQA 3F36A 4ZJKA 4MKUA 1O9IA 2CHIA 3JZAB 2FG4A 2JD80 2ZA7A 1IERA 3KA8A 3FSEA 3UOFA 3F39A 4WJG4 4TO9A 3PVYA 2FKZA 5JKLG 5HJFA 3Q4OA 3IS7A 2V2PA 3AF7X 2BKCA 4M35A 5I4JA 3E2CA 3BVKA 2CWLA 2D5KA 3GE4A 1NNQA 4PG1A 2VXIA 2C6RA 3F34A 3PVTA 3U90A 5E2DA 4LQNA 2OKCA 4W4KB 3KA9A 2Z5QA 5LG8A 4DZ0A 5JDOA 4DYUA 5GU1X 3L0MA 4RC8A 4TOBA 5ERKA 4RC5B 4IWJA 3VV9A 4M33A 3E1PA 1VELA 2BK6A 1JGCA 2C41A 3BVEA 3C1YA 3O7RA 1J30A 1Z4AA 3QD8A 2JD70 1JIGA 3E6RA 2G38B 1L8HA 4ZKWA 3AJQA 4XKSA 2V2SA 4E40A 1DPSA 1YUXA 3OJ5A 2CHPA 3PW8C 2FZFA 2V2MA 3IS8A 3R2MA 1JI4A 2CN6A 3EZUA 3A9QA 1BCFA 1F33A 2CF7A 4LYXA 4TW3A 4DI0A 4DE6A 4XKUA 2QQYA 1RYTA 2W0OA 1SOFA 3D19A 4MXPA 3KA6A 2ZG9X 3R2RA 3RAVA 4DYXA 4Z3BA 3QVDA 4U3GA 5FFEA 3R2OA 1LB3A 1LKMA 4PGIA 1L8IA 2ZG7X 2ZURX 4IWKA 4EVCA 1F30A 2XKQA 2V2RA 4DASA 2V8TA 3H7GA 4EVEA 5JACA 3MPSA 3FRSA 3WVVA 5JKLA 1N1QA 5D8RA 3ISFA 1MFRA 4EVBA 1JTSA 1VJXA 3BVLA 3BT5A 3IQ1A 1GWGA 3E6SA 1Z6OA 1NF6A 1O9RA 2ZA6A 3PW8A 5FEJA 5D8YA 2HTNA 4ISPA 4RC7A 1BG7A 2FJCA 3C23A 5CMQA 2XJNA 3HIUA 4REUA 1JKVA 2IU2A 2C2UA 1TJOA 1AEWA 5GU3X 1ZUJA 1JREA 4CMYA 5GN8B 3ERZA 4AM5A 4LPNA 3QB9A 3PVYB 2V2IA 2N02A 5J8SA 2YJKA 2JD60 1BFRA 2GYDA 3AK9A 1RCGA 3ISEA 4CVTA 4A25A 1HRSA 2FHAA 1RCEA 2XJOA 5GOUA 3AJOA 2RBDA 4LQJA 2V2OA 3PVTB 3R2SA 3F38A 3E1MA 2PYBA 4ETRA 3PW1B 2X170 3PWQA 5C6FA 4TODA 5D8PA 4II4A 5LS9A 1YV1A 3ES3A 4TOAA 5JDOB 5K53A 4ZL6A 1Z6OM 2GS4A 2XJMA 3O7SA 4ISMA 4MY7A 4Y08A 4KXRB 3VNXA 4MUDA 2WWXB 5K52A 2VXXA 4CVSA 3KX9A 2YJJA 5IX6A 1DATA 5CZUA 2OH3A 2QF9A 4CMYV 1UVHA 3HL1A 4ITWA 4QUWA 5D8SA 4LQVA 2V2JA 3KWOA 1NFVA 3PVRA 2C2FA 4RC6A 1QGHA 1YUZA 3GVYA 2WLUA 1R03A 4LQHA 3M6JA 1VEQA 2CLBA 2CIHA 2Z5PA 3KXUA 3GHQA 3V3KB 1TKPA 5J8WA 2BW1A 2Z6MA 4R42A 1SQ3A 2C2JA 3KA3A 4ZMCA 4ITTA 3TA8A 4KVQA 3PWFA 2OC5A 4LPJA 1XZ3A 2IB0A 5J9VA 3SIDA 5E1UA 1S30A 5D8OA 4DYZA 1JYBA 1VLGA 4ZKXA 5FFBA 3BVIA 3KA4A 4CVPA 3R2KA 4TOGA 3E1JA 4DYYA 2CN7A 4YKHA 5GU0X 3NOZX 2BJYA 2IY4A 5ERJA 5GU2X 3LKDA 2MGYA 3C1ZA 1TKOA 3A68A 1TK6A 1JKUA 3FRRA 1B71A 5HU6D 3E1LA 3SE1A 3QHCA 5LBHA 2ZG8X 2XGWA 3UNOA 4CY9A 3SH6A 4ZKHA 2YW7A 3OGHA 5JKMG 5GN8A
chains in the Genus database with same CATH topology
2V8UA 2G4HA 4RC7B 1VEIA 1UMNA 3RE7A 5LG2A 3JZ9A 3KHKA 3E1QA 4TOHA 4IXKA 3QZ3A 3AF8X 3QHBA 3R2HA 3N6OA 5CMRA 4RC5A 2V15A 4LPMA 3Q4NA 3PW1A 3F32A 4PG0A 3AF9X 1LKOA 5HJHA 4TOEA 3C21A 1NF4A 3W54A 3WNWA 4E6KA 2FG8A 1EUMA 4YXJA 3FVBA 4CYBA 3UOIA 3NP2X 2FL0A 3BVFA 1JI5A 1RCDA 4MJYA 4EVDA 1IESA 4Z5SA 3E1NA 2ZA8A 1DVBA 4W4LB 3EZ0A 1MOJA 1KRQA 1S3QA 1XZ1A 4II4B 1ZS3A 4OYNA 4MN9A 4ZTTA 4YVZA 2VZBA 3DBYA 3EGMA 2WLAA 3E1OA 5FFCA 2CEIA 3GGZA 4AM2A 2YW6A 2UX1A 3AK8A 3GGYA 4KVSA 2Z5RA 4CVRA 4KVRA 3PZAA 4TOCA 5D8XA 3Q4RA 3RD0A 2V2NA 1QYBA 2Z90A 3AJPA 3FI6A 4TOFA 3PVRB 3RGDA 4RC6B 2GYQA 3Q4QA 4M32A 4AM4A 4M34A 4P18A 4ERUA 5HQOA 2ITBA 3WVWA 2FFXJ 3F33A 4YXMA 4ZLWA 3WVUA 2WTLA 1FHAA 4CYAA 2Y44A 1OTKA 3NP0X 4PGKA 5D8QA 3UFBA 3RBCA 5FFDA 2AR0A 2F7NA 5AXSA 3SHXA 3T9JA 3R2LA 3BKNA 5JKMA 1H96A 5FFAA 5J93A 1LKPA 4LYUA 1S2ZA 4ZL5A 2HR5A 2Y3QA 1RCIA 3F35A 1RCCA 4XGSA 4XKTA 2V2LA 2CLUA 4X0JA 3VVAA 4ML5A 3F37A 3PWQC 3KDQA 3F36A 4ZJKA 4MKUA 1O9IA 2CHIA 3JZAB 2FG4A 2JD80 2ZA7A 1IERA 3KA8A 3FSEA 3UOFA 3F39A 4WJG4 4TO9A 3PVYA 2FKZA 5JKLG 5HJFA 3Q4OA 3IS7A 2V2PA 3AF7X 2BKCA 4M35A 5I4JA 3E2CA 3BVKA 2CWLA 2D5KA 3GE4A 1NNQA 4PG1A 2VXIA 2C6RA 3F34A 3PVTA 3U90A 5E2DA 4LQNA 2OKCA 4W4KB 3KA9A 2Z5QA 5LG8A 4DZ0A 5JDOA 4DYUA 5GU1X 3L0MA 4RC8A 4TOBA 5ERKA 4RC5B 4IWJA 3VV9A 4M33A 3E1PA 1VELA 2BK6A 1JGCA 2C41A 3BVEA 3C1YA 3O7RA 1J30A 1Z4AA 3QD8A 2JD70 1JIGA 3E6RA 2G38B 1L8HA 4ZKWA 3AJQA 4XKSA 2V2SA 4E40A 1DPSA 1YUXA 3OJ5A 2CHPA 3PW8C 2FZFA 2V2MA 3IS8A 3R2MA 1JI4A 2CN6A 3EZUA 3A9QA 1BCFA 1F33A 2CF7A 4LYXA 4TW3A 4DI0A 4DE6A 4XKUA 2QQYA 1RYTA 2W0OA 1SOFA 3D19A 4MXPA 3KA6A 2ZG9X 3R2RA 3RAVA 4DYXA 4Z3BA 3QVDA 4U3GA 5FFEA 3R2OA 1LB3A 1LKMA 4PGIA 1L8IA 2ZG7X 2ZURX 4IWKA 4EVCA 1F30A 2XKQA 2V2RA 4DASA 2V8TA 3H7GA 4EVEA 5JACA 3MPSA 3FRSA 3WVVA 5JKLA 1N1QA 5D8RA 3ISFA 1MFRA 4EVBA 1JTSA 1VJXA 3BVLA 3BT5A 3IQ1A 1GWGA 3E6SA 1Z6OA 1NF6A 1O9RA 2ZA6A 3PW8A 5FEJA 5D8YA 2HTNA 4ISPA 4RC7A 1BG7A 2FJCA 3C23A 5CMQA 2XJNA 3HIUA 4REUA 1JKVA 2IU2A 2C2UA 1TJOA 1AEWA 5GU3X 1ZUJA 1JREA 4CMYA 5GN8B 3ERZA 4AM5A 4LPNA 3QB9A 3PVYB 2V2IA 2N02A 5J8SA 2YJKA 2JD60 1BFRA 2GYDA 3AK9A 1RCGA 3ISEA 4CVTA 4A25A 1HRSA 2FHAA 1RCEA 2XJOA 5GOUA 3AJOA 2RBDA 4LQJA 2V2OA 3PVTB 3R2SA 3F38A 3E1MA 2PYBA 4ETRA 3PW1B 2X170 3PWQA 5C6FA 4TODA 5D8PA 4II4A 5LS9A 1YV1A 3ES3A 4TOAA 5JDOB 5K53A 4ZL6A 1Z6OM 2GS4A 2XJMA 3O7SA 4ISMA 4MY7A 4Y08A 4KXRB 3VNXA 4MUDA 2WWXB 5K52A 2VXXA 4CVSA 3KX9A 2YJJA 5IX6A 1DATA 5CZUA 2OH3A 2QF9A 4CMYV 1UVHA 3HL1A 4ITWA 4QUWA 5D8SA 4LQVA 2V2JA 3KWOA 1NFVA 3PVRA 2C2FA 4RC6A 1QGHA 1YUZA 3GVYA 2WLUA 1R03A 4LQHA 3M6JA 1VEQA 2CLBA 2CIHA 2Z5PA 3KXUA 3GHQA 3V3KB 1TKPA 5J8WA 2BW1A 2Z6MA 4R42A 1SQ3A 2C2JA 3KA3A 4ZMCA 4ITTA 3TA8A 4KVQA 3PWFA 2OC5A 4LPJA 1XZ3A 2IB0A 5J9VA 3SIDA 5E1UA 1S30A 5D8OA 4DYZA 1JYBA 1VLGA 4ZKXA 5FFBA 3BVIA 3KA4A 4CVPA 3R2KA 4TOGA 3E1JA 4DYYA 2CN7A 4YKHA 5GU0X 3NOZX 2BJYA 2IY4A 5ERJA 5GU2X 3LKDA 2MGYA 3C1ZA 1TKOA 3A68A 1TK6A 1JKUA 3FRRA 1B71A 5HU6D 3E1LA 3SE1A 3QHCA 5LBHA 2ZG8X 2XGWA 3UNOA 4CY9A 3SH6A 4ZKHA 2YW7A 3OGHA 5JKMG 5GN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G4H A;  4RC7 B;  1VEI A;  1UMN A;  3RE7 A;  5LG2 A;  3E1Q A;  4TOH A;  4IXK A;  3QZ3 A;  3AF8 X;  3QHB A;  3R2H A;  5CMR A;  4RC5 A;  2V15 A;  4LPM A;  3Q4N A;  3PW1 A;  3F32 A;  4PG0 A;  3AF9 X;  1LKO A;  5HJH A;  4TOE A;  1NF4 A;  3WNW A;  4E6K A;  2FG8 A;  1EUM A;  3FVB A;  4CYB A;  3UOI A;  3NP2 X;  2FL0 A;  3BVF A;  1JI5 A;  1RCD A;  4MJY A;  4EVD A;  1IES A;  4Z5S A;  3E1N A;  2ZA8 A;  1DVB A;  3EZ0 A;  1MOJ A;  1KRQ A;  1S3Q A;  1XZ1 A;  4II4 B;  1ZS3 A;  4OYN A;  4MN9 A;  4ZTT A;  2VZB A;  3EGM A;  2WLA A;  3E1O A;  5FFC A;  2CEI A;  4AM2 A;  2YW6 A;  2UX1 A;  3AK8 A;  4KVS A;  2Z5R A;  4CVR A;  4KVR A;  3PZA A;  4TOC A;  5D8X A;  3Q4R A;  3RD0 A;  2V2N A;  1QYB A;  2Z90 A;  3AJP A;  3FI6 A;  4TOF A;  3PVR B;  3RGD A;  4RC6 B;  2GYQ A;  3Q4Q A;  4M32 A;  4AM4 A;  4M34 A;  4P18 A;  4ERU A;  5HQO A;  2ITB A;  3WVW A;  2FFX J;  3F33 A;  4ZLW A;  3WVU A;  2WTL A;  1FHA A;  4CYA A;  1OTK A;  3NP0 X;  4PGK A;  5D8Q A;  3RBC A;  5FFD A;  2F7N A;  5AXS A;  3SHX A;  3T9J A;  3R2L A;  3BKN A;  5JKM A;  1H96 A;  5FFA A;  5J93 A;  1LKP A;  4LYU A;  1S2Z A;  4ZL5 A;  2HR5 A;  2Y3Q A;  1RCI A;  3F35 A;  1RCC A;  4XGS A;  4XKT A;  2V2L A;  2CLU A;  4ML5 A;  3F37 A;  3PWQ C;  3F36 A;  4ZJK A;  4MKU A;  1O9I A;  2CHI A;  2FG4 A;  2JD8 0;  2ZA7 A;  1IER A;  3KA8 A;  3FSE A;  3UOF A;  3F39 A;  4TO9 A;  3PVY A;  2FKZ A;  5JKL G;  5HJF A;  3Q4O A;  3IS7 A;  2V2P A;  3AF7 X;  2BKC A;  4M35 A;  5I4J A;  3E2C A;  3BVK A;  2D5K A;  3GE4 A;  1NNQ A;  4PG1 A;  2VXI A;  2C6R A;  3F34 A;  3PVT A;  3U90 A;  5E2D A;  4LQN A;  3KA9 A;  2Z5Q A;  5LG8 A;  4DZ0 A;  4DYU A;  5GU1 X;  4RC8 A;  4TOB A;  5ERK A;  4RC5 B;  4IWJ A;  4M33 A;  3E1P A;  1VEL A;  2BK6 A;  1JGC A;  2C41 A;  3BVE A;  3O7R A;  1J30 A;  1Z4A A;  3QD8 A;  2JD7 0;  1JIG A;  3E6R A;  1L8H A;  4ZKW A;  3AJQ A;  4XKS A;  2V2S A;  1DPS A;  1YUX A;  3OJ5 A;  2CHP A;  3PW8 C;  2FZF A;  2V2M A;  3IS8 A;  3R2M A;  1JI4 A;  2CN6 A;  3EZU A;  3A9Q A;  1BCF A;  1F33 A;  2CF7 A;  4LYX A;  4TW3 A;  4DI0 A;  4DE6 A;  4XKU A;  2QQY A;  1RYT A;  2W0O A;  1SOF A;  3KA6 A;  2ZG9 X;  3R2R A;  3RAV A;  4DYX A;  4Z3B A;  3QVD A;  4U3G A;  5FFE A;  3R2O A;  1LB3 A;  1LKM A;  4PGI A;  1L8I A;  2ZG7 X;  2ZUR X;  4IWK A;  4EVC A;  1F30 A;  2XKQ A;  2V2R A;  4DAS A;  3H7G A;  4EVE A;  5JAC A;  3MPS A;  3WVV A;  5JKL A;  1N1Q A;  5D8R A;  3ISF A;  1MFR A;  4EVB A;  1JTS A;  1VJX A;  3BVL A;  3BT5 A;  3IQ1 A;  1GWG A;  3E6S A;  1Z6O A;  1NF6 A;  1O9R A;  2ZA6 A;  3PW8 A;  5FEJ A;  5D8Y A;  2HTN A;  4ISP A;  4RC7 A;  1BG7 A;  2FJC A;  5CMQ A;  2XJN A;  3HIU A;  4REU A;  1JKV A;  2IU2 A;  2C2U A;  1TJO A;  1AEW A;  5GU3 X;  1ZUJ A;  1JRE A;  4CMY A;  5GN8 B;  3ERZ A;  4AM5 A;  4LPN A;  3PVY B;  3QB9 A;  2V2I A;  5J8S A;  2YJK A;  2JD6 0;  1BFR A;  2GYD A;  3AK9 A;  1RCG A;  3ISE A;  4CVT A;  4A25 A;  1HRS A;  2FHA A;  1RCE A;  2XJO A;  5GOU A;  3AJO A;  2RBD A;  4LQJ A;  2V2O A;  3PVT B;  3R2S A;  3F38 A;  3E1M A;  2PYB A;  4ETR A;  3PW1 B;  2X17 0;  3PWQ A;  5C6F A;  4TOD A;  5D8P A;  4II4 A;  5LS9 A;  1YV1 A;  3ES3 A;  4TOA A;  5K53 A;  4ZL6 A;  1Z6O M;  2GS4 A;  2XJM A;  3O7S A;  4ISM A;  4MY7 A;  4Y08 A;  3VNX A;  4MUD A;  5K52 A;  2VXX A;  4CVS A;  3KX9 A;  2YJJ A;  5IX6 A;  1DAT A;  5CZU A;  2OH3 A;  2QF9 A;  4CMY V;  1UVH A;  3HL1 A;  4ITW A;  4QUW A;  5D8S A;  4LQV A;  2V2J A;  3KWO A;  1NFV A;  3PVR A;  2C2F A;  4RC6 A;  1QGH A;  1YUZ A;  3GVY A;  2WLU A;  1R03 A;  4LQH A;  1VEQ A;  2CLB A;  2CIH A;  2Z5P A;  3KXU A;  3GHQ A;  1TKP A;  5J8W A;  2BW1 A;  2Z6M A;  4R42 A;  1SQ3 A;  2C2J A;  3KA3 A;  4ZMC A;  4ITT A;  3TA8 A;  4KVQ A;  3PWF A;  2OC5 A;  4LPJ A;  1XZ3 A;  2IB0 A;  5J9V A;  3SID A;  5E1U A;  1S30 A;  5D8O A;  4DYZ A;  1JYB A;  1VLG A;  4ZKX A;  5FFB A;  3BVI A;  3KA4 A;  4CVP A;  3R2K A;  4TOG A;  3E1J A;  4DYY A;  2CN7 A;  4YKH A;  5GU0 X;  3NOZ X;  2BJY A;  2IY4 A;  5ERJ A;  5GU2 X;  1TKO A;  3A68 A;  1TK6 A;  1JKU A;  1B71 A;  3E1L A;  3SE1 A;  3QHC A;  5LBH A;  2ZG8 X;  2XGW A;  3UNO A;  4CY9 A;  3SH6 A;  4ZKH A;  2YW7 A;  3OGH A;  5JKM G;  5GN8 A; 
#chains in the Genus database with same CATH topology
 2V8U A;  2G4H A;  4RC7 B;  1VEI A;  1UMN A;  3RE7 A;  5LG2 A;  3JZ9 A;  3KHK A;  3E1Q A;  4TOH A;  4IXK A;  3QZ3 A;  3AF8 X;  3QHB A;  3R2H A;  3N6O A;  5CMR A;  4RC5 A;  2V15 A;  4LPM A;  3Q4N A;  3PW1 A;  3F32 A;  4PG0 A;  3AF9 X;  1LKO A;  5HJH A;  4TOE A;  3C21 A;  1NF4 A;  3W54 A;  3WNW A;  4E6K A;  2FG8 A;  1EUM A;  4YXJ A;  3FVB A;  4CYB A;  3UOI A;  3NP2 X;  2FL0 A;  3BVF A;  1JI5 A;  1RCD A;  4MJY A;  4EVD A;  1IES A;  4Z5S A;  3E1N A;  2ZA8 A;  1DVB A;  4W4L B;  3EZ0 A;  1MOJ A;  1KRQ A;  1S3Q A;  1XZ1 A;  4II4 B;  1ZS3 A;  4OYN A;  4MN9 A;  4ZTT A;  4YVZ A;  2VZB A;  3DBY A;  3EGM A;  2WLA A;  3E1O A;  5FFC A;  2CEI A;  3GGZ A;  4AM2 A;  2YW6 A;  2UX1 A;  3AK8 A;  3GGY A;  4KVS A;  2Z5R A;  4CVR A;  4KVR A;  3PZA A;  4TOC A;  5D8X A;  3Q4R A;  3RD0 A;  2V2N A;  1QYB A;  2Z90 A;  3AJP A;  3FI6 A;  4TOF A;  3PVR B;  3RGD A;  4RC6 B;  2GYQ A;  3Q4Q A;  4M32 A;  4AM4 A;  4M34 A;  4P18 A;  4ERU A;  5HQO A;  2ITB A;  3WVW A;  2FFX J;  3F33 A;  4YXM A;  4ZLW A;  3WVU A;  2WTL A;  1FHA A;  4CYA A;  2Y44 A;  1OTK A;  3NP0 X;  4PGK A;  5D8Q A;  3UFB A;  3RBC A;  5FFD A;  2AR0 A;  2F7N A;  5AXS A;  3SHX A;  3T9J A;  3R2L A;  3BKN A;  5JKM A;  1H96 A;  5FFA A;  5J93 A;  1LKP A;  4LYU A;  1S2Z A;  4ZL5 A;  2HR5 A;  2Y3Q A;  1RCI A;  3F35 A;  1RCC A;  4XGS A;  4XKT A;  2V2L A;  2CLU A;  4X0J A;  3VVA A;  4ML5 A;  3F37 A;  3PWQ C;  3KDQ A;  3F36 A;  4ZJK A;  4MKU A;  1O9I A;  2CHI A;  3JZA B;  2FG4 A;  2JD8 0;  2ZA7 A;  1IER A;  3KA8 A;  3FSE A;  3UOF A;  3F39 A;  4WJG 4;  4TO9 A;  3PVY A;  2FKZ A;  5JKL G;  5HJF A;  3Q4O A;  3IS7 A;  2V2P A;  3AF7 X;  2BKC A;  4M35 A;  5I4J A;  3E2C A;  3BVK A;  2CWL A;  2D5K A;  3GE4 A;  1NNQ A;  4PG1 A;  2VXI A;  2C6R A;  3F34 A;  3PVT A;  3U90 A;  5E2D A;  4LQN A;  2OKC A;  4W4K B;  3KA9 A;  2Z5Q A;  5LG8 A;  4DZ0 A;  5JDO A;  4DYU A;  5GU1 X;  3L0M A;  4RC8 A;  4TOB A;  5ERK A;  4RC5 B;  4IWJ A;  3VV9 A;  4M33 A;  3E1P A;  1VEL A;  2BK6 A;  1JGC A;  2C41 A;  3BVE A;  3C1Y A;  3O7R A;  1J30 A;  1Z4A A;  3QD8 A;  2JD7 0;  1JIG A;  3E6R A;  2G38 B;  1L8H A;  4ZKW A;  3AJQ A;  4XKS A;  2V2S A;  4E40 A;  1DPS A;  1YUX A;  3OJ5 A;  2CHP A;  3PW8 C;  2FZF A;  2V2M A;  3IS8 A;  3R2M A;  1JI4 A;  2CN6 A;  3EZU A;  3A9Q A;  1BCF A;  1F33 A;  2CF7 A;  4LYX A;  4TW3 A;  4DI0 A;  4DE6 A;  4XKU A;  2QQY A;  1RYT A;  2W0O A;  1SOF A;  3D19 A;  4MXP A;  3KA6 A;  2ZG9 X;  3R2R A;  3RAV A;  4DYX A;  4Z3B A;  3QVD A;  4U3G A;  5FFE A;  3R2O A;  1LB3 A;  1LKM A;  4PGI A;  1L8I A;  2ZG7 X;  2ZUR X;  4IWK A;  4EVC A;  1F30 A;  2XKQ A;  2V2R A;  4DAS A;  2V8T A;  3H7G A;  4EVE A;  5JAC A;  3MPS A;  3FRS A;  3WVV A;  5JKL A;  1N1Q A;  5D8R A;  3ISF A;  1MFR A;  4EVB A;  1JTS A;  1VJX A;  3BVL A;  3BT5 A;  3IQ1 A;  1GWG A;  3E6S A;  1Z6O A;  1NF6 A;  1O9R A;  2ZA6 A;  3PW8 A;  5FEJ A;  5D8Y A;  2HTN A;  4ISP A;  4RC7 A;  1BG7 A;  2FJC A;  3C23 A;  5CMQ A;  2XJN A;  3HIU A;  4REU A;  1JKV A;  2IU2 A;  2C2U A;  1TJO A;  1AEW A;  5GU3 X;  1ZUJ A;  1JRE A;  4CMY A;  5GN8 B;  3ERZ A;  4AM5 A;  4LPN A;  3QB9 A;  3PVY B;  2V2I A;  2N02 A;  5J8S A;  2YJK A;  2JD6 0;  1BFR A;  2GYD A;  3AK9 A;  1RCG A;  3ISE A;  4CVT A;  4A25 A;  1HRS A;  2FHA A;  1RCE A;  2XJO A;  5GOU A;  3AJO A;  2RBD A;  4LQJ A;  2V2O A;  3PVT B;  3R2S A;  3F38 A;  3E1M A;  2PYB A;  4ETR A;  3PW1 B;  2X17 0;  3PWQ A;  5C6F A;  4TOD A;  5D8P A;  4II4 A;  5LS9 A;  1YV1 A;  3ES3 A;  4TOA A;  5JDO B;  5K53 A;  4ZL6 A;  1Z6O M;  2GS4 A;  2XJM A;  3O7S A;  4ISM A;  4MY7 A;  4Y08 A;  4KXR B;  3VNX A;  4MUD A;  2WWX B;  5K52 A;  2VXX A;  4CVS A;  3KX9 A;  2YJJ A;  5IX6 A;  1DAT A;  5CZU A;  2OH3 A;  2QF9 A;  4CMY V;  1UVH A;  3HL1 A;  4ITW A;  4QUW A;  5D8S A;  4LQV A;  2V2J A;  3KWO A;  1NFV A;  3PVR A;  2C2F A;  4RC6 A;  1QGH A;  1YUZ A;  3GVY A;  2WLU A;  1R03 A;  4LQH A;  3M6J A;  1VEQ A;  2CLB A;  2CIH A;  2Z5P A;  3KXU A;  3GHQ A;  3V3K B;  1TKP A;  5J8W A;  2BW1 A;  2Z6M A;  4R42 A;  1SQ3 A;  2C2J A;  3KA3 A;  4ZMC A;  4ITT A;  3TA8 A;  4KVQ A;  3PWF A;  2OC5 A;  4LPJ A;  1XZ3 A;  2IB0 A;  5J9V A;  3SID A;  5E1U A;  1S30 A;  5D8O A;  4DYZ A;  1JYB A;  1VLG A;  4ZKX A;  5FFB A;  3BVI A;  3KA4 A;  4CVP A;  3R2K A;  4TOG A;  3E1J A;  4DYY A;  2CN7 A;  4YKH A;  5GU0 X;  3NOZ X;  2BJY A;  2IY4 A;  5ERJ A;  5GU2 X;  3LKD A;  2MGY A;  3C1Z A;  1TKO A;  3A68 A;  1TK6 A;  1JKU A;  3FRR A;  1B71 A;  5HU6 D;  3E1L A;  3SE1 A;  3QHC A;  5LBH A;  2ZG8 X;  2XGW A;  3UNO A;  4CY9 A;  3SH6 A;  4ZKH A;  2YW7 A;  3OGH A;  5JKM G;  5GN8 A; 
#chains in the Genus database with same CATH homology
 2V8U A;  2G4H A;  4RC7 B;  1VEI A;  1UMN A;  3RE7 A;  5LG2 A;  3JZ9 A;  3KHK A;  3E1Q A;  4TOH A;  4IXK A;  3QZ3 A;  3AF8 X;  3QHB A;  3R2H A;  3N6O A;  5CMR A;  4RC5 A;  2V15 A;  4LPM A;  3Q4N A;  3PW1 A;  3F32 A;  4PG0 A;  3AF9 X;  1LKO A;  5HJH A;  4TOE A;  3C21 A;  1NF4 A;  3W54 A;  3WNW A;  4E6K A;  2FG8 A;  1EUM A;  4YXJ A;  3FVB A;  4CYB A;  3UOI A;  3NP2 X;  2FL0 A;  3BVF A;  1JI5 A;  1RCD A;  4MJY A;  4EVD A;  1IES A;  4Z5S A;  3E1N A;  2ZA8 A;  1DVB A;  4W4L B;  3EZ0 A;  1MOJ A;  1KRQ A;  1S3Q A;  1XZ1 A;  4II4 B;  1ZS3 A;  4OYN A;  4MN9 A;  4ZTT A;  4YVZ A;  2VZB A;  3DBY A;  3EGM A;  2WLA A;  3E1O A;  5FFC A;  2CEI A;  3GGZ A;  4AM2 A;  2YW6 A;  2UX1 A;  3AK8 A;  3GGY A;  4KVS A;  2Z5R A;  4CVR A;  4KVR A;  3PZA A;  4TOC A;  5D8X A;  3Q4R A;  3RD0 A;  2V2N A;  1QYB A;  2Z90 A;  3AJP A;  3FI6 A;  4TOF A;  3PVR B;  3RGD A;  4RC6 B;  2GYQ A;  3Q4Q A;  4M32 A;  4AM4 A;  4M34 A;  4P18 A;  4ERU A;  5HQO A;  2ITB A;  3WVW A;  2FFX J;  3F33 A;  4YXM A;  4ZLW A;  3WVU A;  2WTL A;  1FHA A;  4CYA A;  2Y44 A;  1OTK A;  3NP0 X;  4PGK A;  5D8Q A;  3UFB A;  3RBC A;  5FFD A;  2AR0 A;  2F7N A;  5AXS A;  3SHX A;  3T9J A;  3R2L A;  3BKN A;  5JKM A;  1H96 A;  5FFA A;  5J93 A;  1LKP A;  4LYU A;  1S2Z A;  4ZL5 A;  2HR5 A;  2Y3Q A;  1RCI A;  3F35 A;  1RCC A;  4XGS A;  4XKT A;  2V2L A;  2CLU A;  4X0J A;  3VVA A;  4ML5 A;  3F37 A;  3PWQ C;  3KDQ A;  3F36 A;  4ZJK A;  4MKU A;  1O9I A;  2CHI A;  3JZA B;  2FG4 A;  2JD8 0;  2ZA7 A;  1IER A;  3KA8 A;  3FSE A;  3UOF A;  3F39 A;  4WJG 4;  4TO9 A;  3PVY A;  2FKZ A;  5JKL G;  5HJF A;  3Q4O A;  3IS7 A;  2V2P A;  3AF7 X;  2BKC A;  4M35 A;  5I4J A;  3E2C A;  3BVK A;  2CWL A;  2D5K A;  3GE4 A;  1NNQ A;  4PG1 A;  2VXI A;  2C6R A;  3F34 A;  3PVT A;  3U90 A;  5E2D A;  4LQN A;  2OKC A;  4W4K B;  3KA9 A;  2Z5Q A;  5LG8 A;  4DZ0 A;  5JDO A;  4DYU A;  5GU1 X;  3L0M A;  4RC8 A;  4TOB A;  5ERK A;  4RC5 B;  4IWJ A;  3VV9 A;  4M33 A;  3E1P A;  1VEL A;  2BK6 A;  1JGC A;  2C41 A;  3BVE A;  3C1Y A;  3O7R A;  1J30 A;  1Z4A A;  3QD8 A;  2JD7 0;  1JIG A;  3E6R A;  2G38 B;  1L8H A;  4ZKW A;  3AJQ A;  4XKS A;  2V2S A;  4E40 A;  1DPS A;  1YUX A;  3OJ5 A;  2CHP A;  3PW8 C;  2FZF A;  2V2M A;  3IS8 A;  3R2M A;  1JI4 A;  2CN6 A;  3EZU A;  3A9Q A;  1BCF A;  1F33 A;  2CF7 A;  4LYX A;  4TW3 A;  4DI0 A;  4DE6 A;  4XKU A;  2QQY A;  1RYT A;  2W0O A;  1SOF A;  3D19 A;  4MXP A;  3KA6 A;  2ZG9 X;  3R2R A;  3RAV A;  4DYX A;  4Z3B A;  3QVD A;  4U3G A;  5FFE A;  3R2O A;  1LB3 A;  1LKM A;  4PGI A;  1L8I A;  2ZG7 X;  2ZUR X;  4IWK A;  4EVC A;  1F30 A;  2XKQ A;  2V2R A;  4DAS A;  2V8T A;  3H7G A;  4EVE A;  5JAC A;  3MPS A;  3FRS A;  3WVV A;  5JKL A;  1N1Q A;  5D8R A;  3ISF A;  1MFR A;  4EVB A;  1JTS A;  1VJX A;  3BVL A;  3BT5 A;  3IQ1 A;  1GWG A;  3E6S A;  1Z6O A;  1NF6 A;  1O9R A;  2ZA6 A;  3PW8 A;  5FEJ A;  5D8Y A;  2HTN A;  4ISP A;  4RC7 A;  1BG7 A;  2FJC A;  3C23 A;  5CMQ A;  2XJN A;  3HIU A;  4REU A;  1JKV A;  2IU2 A;  2C2U A;  1TJO A;  1AEW A;  5GU3 X;  1ZUJ A;  1JRE A;  4CMY A;  5GN8 B;  3ERZ A;  4AM5 A;  4LPN A;  3QB9 A;  3PVY B;  2V2I A;  2N02 A;  5J8S A;  2YJK A;  2JD6 0;  1BFR A;  2GYD A;  3AK9 A;  1RCG A;  3ISE A;  4CVT A;  4A25 A;  1HRS A;  2FHA A;  1RCE A;  2XJO A;  5GOU A;  3AJO A;  2RBD A;  4LQJ A;  2V2O A;  3PVT B;  3R2S A;  3F38 A;  3E1M A;  2PYB A;  4ETR A;  3PW1 B;  2X17 0;  3PWQ A;  5C6F A;  4TOD A;  5D8P A;  4II4 A;  5LS9 A;  1YV1 A;  3ES3 A;  4TOA A;  5JDO B;  5K53 A;  4ZL6 A;  1Z6O M;  2GS4 A;  2XJM A;  3O7S A;  4ISM A;  4MY7 A;  4Y08 A;  4KXR B;  3VNX A;  4MUD A;  2WWX B;  5K52 A;  2VXX A;  4CVS A;  3KX9 A;  2YJJ A;  5IX6 A;  1DAT A;  5CZU A;  2OH3 A;  2QF9 A;  4CMY V;  1UVH A;  3HL1 A;  4ITW A;  4QUW A;  5D8S A;  4LQV A;  2V2J A;  3KWO A;  1NFV A;  3PVR A;  2C2F A;  4RC6 A;  1QGH A;  1YUZ A;  3GVY A;  2WLU A;  1R03 A;  4LQH A;  3M6J A;  1VEQ A;  2CLB A;  2CIH A;  2Z5P A;  3KXU A;  3GHQ A;  3V3K B;  1TKP A;  5J8W A;  2BW1 A;  2Z6M A;  4R42 A;  1SQ3 A;  2C2J A;  3KA3 A;  4ZMC A;  4ITT A;  3TA8 A;  4KVQ A;  3PWF A;  2OC5 A;  4LPJ A;  1XZ3 A;  2IB0 A;  5J9V A;  3SID A;  5E1U A;  1S30 A;  5D8O A;  4DYZ A;  1JYB A;  1VLG A;  4ZKX A;  5FFB A;  3BVI A;  3KA4 A;  4CVP A;  3R2K A;  4TOG A;  3E1J A;  4DYY A;  2CN7 A;  4YKH A;  5GU0 X;  3NOZ X;  2BJY A;  2IY4 A;  5ERJ A;  5GU2 X;  3LKD A;  2MGY A;  3C1Z A;  1TKO A;  3A68 A;  1TK6 A;  1JKU A;  3FRR A;  1B71 A;  5HU6 D;  3E1L A;  3SE1 A;  3QHC A;  5LBH A;  2ZG8 X;  2XGW A;  3UNO A;  4CY9 A;  3SH6 A;  4ZKH A;  2YW7 A;  3OGH A;  5JKM G;  5GN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...