3PWFA

High resolution structure of the fully reduced form of rubrerythrin from p. furiosus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
total genus 63
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pwfA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pwfA02
3A9QA 1OTKA 1JGCA 5AI2A 3F39A 3E2CA 5ERKA 4CYBA 3ISEA 5J8SA 1TKOA 3AJQA 3AF7X 1RDGA 1BQ8A 4LYXA 4Z5SA 3H7GA 2FZFA 3KYUA 2V2LA 2IB0A 2GMGA 4DZ0A 5D8RA 4RC5B 3KXUA 4DI0A 2YW7A 3QB9A 4LYUA 1Z4AA 4ETRA 3E1MA 4YWLA 1QCVA 2V2PA 3AF9X 2CIHA 2ZURX 4Z3BA 4ZL5A 3PVRA 5FFBA 1RCCA 3E1PA 2BJYA 1JREA 3Q4OA 5HQOA 4TOEA 4CMYV 1SQ3A 2VXIA 4P18A 3NOZX 5J8WA 2XJOA 1YK5A 3KA9A 3F37A 5CZUA 2PVXA 1VEIA 4M35A 3PWQA 5HJFA 4PGKA 1BE7A 3A44A 1HRSA 2Z6MA 5GU1X 2CEIA 1UVHA 3KA4A 1UMNA 2BW1A 4DYYA 1CAAA 2V2JA 4XGSA 3ISFA 3AK8A 3HL1A 1RCGA 3PVRB 3F32A 3QHCA 4EVBA 4LPJA 4CVPA 3SHXA 3SE1A 4U3GA 2Z90A 4AR4A 3FVBA 5ERJA 4CVSA 5JKLG 3BKNA 4LQVA 2HTNA 4OYNA 3IQ1A 3VNXA 3KYXA 4TOCA 4ME3A 4CYAA 3T9JA 1H7VA 1FHAA 5GU2X 1DATA 5GOUA 4TOHA 2VZBA 1LKOA 4MJYA 1BFYA 2FG8A 3U90A 4IXKA 2YW6A 3R2LA 2PYBA 3PWFA 3OJ5A 3WVWA 4RC6A 3PW8C 2LCQA 5E1UA 1RCDA 2CLUA 1R03A 2YJJA 3OGHA 3R2SA 3AJOA 3PVYB 4XKSA 5IY0A 1O9RA 4TOGA 4RC5A 4AM5A 5JKMA 5FFCA 4CMYA 5RXNA 5D8SA 4AR6A 5JKLA 4TOBA 2PYAA 2XJMA 5JACA 1T9QA 1RCIA 2GS4A 4TOFA 5FFAA 3E1OA 4MN9A 3WVUA 1Z6OA 4II4A 3BVFA 3F38A 4RC6B 4EVCA 3PVTA 1QYBA 4TW3A 1L8HA 2V2SA 4KVQA 3F36A 4DASA 4K9FA 3UNOA 3Q4QA 5I4JA 2ZA8A 2C2JA 1YUZA 3BT5A 3BVKA 4Y08A 1BQ9A 7RXNA 2MS3A 2OH3A 5FFDA 1CADA 1N1QA 1TJOA 2V2IA 1VELA 3WNWA 1NF6A 3R2KA 1E8JA 3NP2X 1RCEA 4LQNA 2CN7A 2CN6A 3KX9A 3RZ6A 4TO9A 4II4B 4RC7A 2FL0A 5LG8A 4CVTA 4TOAA 3PVTB 1JYBA 3PWQC 4ZKXA 4ITWA 3QVDA 4LQJA 1KRQA 4ML5A 2IU2A 2C2FA 5E2DA 3Q4RA 2BKCA 3KYYA 3KYWA 1F30A 4POFA 1R0FA 1L8IA 1S3QA 2CHIA 1SOFA 1DPSA 2BK6A 3R2HA 3EZ0A 4ZKWA 1ZS3A 4RC7B 4EVEA 4XKTA 1DX8A 1IU5A 3PVYA 4MUDA 1FHHA 3MPSA 2D5KA 4PGIA 5JKMG 4LQHA 3AJPA 4YKHA 3PZAA 3PW1A 2JD80 2X170 2JD70 1VLGA 2F7NA 1LTLA 2ZG9X 4AR3A 2ZA7A 2CF7A 2V2MA 5D8OA 4ZTTA 1BG7A 4RC8A 1ZUJA 1IRNA 4ZL6A 2PVEA 1O9IA 1NNQA 2FJCA 2V2OA 3EZUA 1S24A 3AF8X 2XJNA 2V15A 3KA3A 3RBCA 3GE4A 3ES3A 4ZJKA 4TODA 4QUWA 5AI3A 4POGA 1JKUA 5FFEA 3F35A 2M4YA 2C41A 3RGDA 2W0OA 3IS7A 5LBHA 2ZG8X 4IWKA 3R2MA 3PW1B 2Z5RA 4KVSA 4PG1A 4LPMA 5CMRA 2V3BB 3UOFA 1B2OA 2FG4A 1TKPA 1RB9A 3O7SA 1YK4A 4A25A 2DSXA 4AR5A 2C2UA 4E6KA 3E6RA 4AM4A 1GWGA 2IY4A 4M33A 1SMMA 3NP0X 5GU3X 3O7RA 3EGMA 4R42A 3RAVA 1XZ1A 1VCXA 3QHBA 4DE6A 1FHMA 1R0HA 1JIGA 4DYUA 1R0IA 1B13A 4EVDA 1MOJA 3A68A 3Q4NA 4IWJA 3RYGA 1B71A 1EUMA 6RXNA 4ITTA 3RD0A 4RXNA 2GYQA 2XGWA 3AK9A 5D8QA 4XKUA 3WVVA 3F34A 1BRFA 5LS9A 2Z5QA 3QD8A 1JTSA 1YV1A 5LG2A 3IS8A 2HR5A 4KVRA 4ISMA 2KN9A 1DVBA 1LB3A 2XKQA 5GU0X 1BFRA 5AXSA 2KKDA 3E1LA 3HIUA 1YUXA 5GN8A 2C6RA 1VEQA 3KYVA 2G4HA 1AEWA 2CHPA 3RZTA 1TK6A 1R0JA 1B2JA 4MKUA 3BVLA 3E1NA 1BCFA 4ERUA 2FHAA 4ZLWA 2FKZA 4REUA 2RBDA 1IROA 3SS2A 3F33A 4DYXA 1F33A 5HJHA 4TPUA 5D8YA 2WLAA 1C09A 3GVYA 4LPNA 3R2RA 2V2NA 1LKMA 1S30A 1IU6A 4MY7A 4YWMA 8RXNA 1JKVA 5D8XA 5GN8B 1Z6OM 3E1JA 3R2OA 1MFRA 1JI5A 2WTLA 5FEJA 4DYZA 4M34A 2GYDA 5CMQA 2ITBA 1RWDA 5IX6A 3KWOA 2ZG7X 5J93A 5C6FA 1QGHA 2K2DA 4CVRA 1SMWA 4ZMCA 5D8PA 3BVIA 1IERA 1LKPA 2CLBA 2VL6A 3E6SA 3UOIA 2FFXJ 3RE7A 5K53A 2QQYA 3BVEA 1NFVA 1XZ3A 2QF9A 2YJKA 3SIDA 3TA8A 4AM2A 2JD60 1H96A 2VXXA 2OC5A 3FSEA 2Y3QA 4CY9A 1NF4A 2UX1A 1RYTA 1SMUA 3PW8A 1T9PA 1J30A 1JI4A 3KA6A 3SH6A 1VJXA 4PG0A 1ZRPA 2QL0A 2RDVA 5J9VA 3E1QA 3QZ3A 1RDVA 5K52A 1S2ZA 1IESA 4ISPA 4ZKHA 3ERZA 2V2RA 2WLUA 3FI6A 1T9OA 1R0GA 4M32A 2ZA6A 3KA8A 3GHQA 2Z5PA
chains in the Genus database with same CATH superfamily
1RYQA 3A9QA 1Y1VL 1OTKA 1JGCA 2M4VA 5AI2A 5MLC3 3F39A 3E2CA 5ERKA 2A68D 4CYBA 3ISEA 5J8SA 1TKOA 3AJQA 3AF7X 1RDGA 2WAQP 4X6AL 1BQ8A 2A69D 4LYXA 5HU6D 4Z5SA 3H7GA 2FZFA 3KYUA 2V2LA 2IB0A 3H99A 2GMGA 3H97A 1I3QL 4DZ0A 5D8RA 4RC5B 3VV9A 3KXUA 4DI0A 2YW7A 3QB9A 4LYUA 4XXBB 1Z4AA 4ETRA 3HOVL 3E1MA 4YWLA 1QCVA 2V2PA 3AF9X 3S15L 2CIHA 2ZURX 4Z3BA 4ZL5A 3PVRA 4G6BA 5FFBA 1RCCA 1TWFL 2NVYL 3E1PA 2BJYA 1JREA 3W54A 2JA6L 1WJVA 3Q4OA 5HQOA 4TOEA 4CMYV 2Z3RB 1SQ3A 2VXIA 4P18A 4BBSL 2B63L 3NOZX 5MF6A 5J8WA 2XJOA 4AI1A 1YK5A 2XJUA 5EINC 3KA9A 3F37A 5CZUA 2PVXA 5M5WL 1VEIA 4M35A 3PWQA 5HJFA 4PGKA 1BE7A 2EY4E 3I4ML 3A44A 1HRSA 2Z6MA 5GU1X 2CEIA 1UVHA 4C2M1 3KA4A 1UMNA 2BW1A 1TWAL 2Y44A 4WFN1 4DYYA 1CAAA 3LWVB 2V2JA 4XGSA 3H9BA 3ISFA 3WWLA 3AK8A 3HL1A 1RCGA 2JA5L 3PVRB 2M6PA 3GGYA 4KXRB 5K2ME 1PZXA 3F32A 3QHCA 3H0GL 3LWPB 4LHLA 4GS7D 4EVBA 3GTOL 4LPJA 4Y7NL 2J9UB 4CVPA 3JZAB 3SHXA 3SE1A 4U3GA 2NYDA 1I6HL 2Z90A 4AR4A 3FVBA 5ERJA 4CVSA 5JKLG 3BKNA 4LQVA 2HTNA 4OYNA 3IQ1A 5MFPA 3K35A 2CWLA 3VNXA 3KYXA 4TOCA 4YXJA 4ME3A 4CYAA 3I4NL 3DBYA 2JI3A 3T9JA 1PFWA 1H7VA 1FHAA 4A3ML 1PFYA 3J7Y1 3PL5A 5GU2X 1DATA 5GOUA 1P7PA 5DM61 4TOHA 2VZBA 3LPEB 2WWXB 1LKOA 4MJYA 1BFYA 2FG8A 3U90A 2V8TA 4IXKA 2YW6A 3R2LA 5M3ML 2PYBA 3PWFA 3OJ5A 3WVWA 2R7ZL 4RC6A 3PW8C 2LCQA 5E1UA 1RCDA 3HOWL 2CLUA 1R03A 2YJJA 3OGHA 3R2SA 3H3VM 3AJOA 3PVYB 3GTGL 4XKSA 5IY0A 3JZ9A 1O9RA 4TOGA 3LWOB 4RC5A 4WJG4 4AM5A 5JKMA 5FFCA 4CMYA 5RXNA 5D8SA 4AR6A 5JKLA 2MGYA 2BE5D 2XJVA 4TOBA 2V0EA 1SFOL 2PYAA 3GTML 2XJMA 3S1ML 5JACA 1T9QA 2VUML 1NXEA 1RCIA 5C44L 2GS4A 3PIO1 4TOFA 5FFAA 3E1OA 4MN9A 5IYDL 3WVUA 3V3KB 1Z6OA 4II4A 3BVFA 3F38A 4RC6B 4EVCA 3PVTA 1QYBA 3S1RL 4TW3A 2ERJA 1L8HA 2V2SA 1I50L 4KVQA 3F36A 4DASA 4K9FA 3UNOA 3PIP1 4AYBP 3Q4QA 5I4JA 2ZA8A 2C2JA 1YUZA 3BT5A 3BVKA 3FRRA 2E2IL 4Y08A 1BQ9A 7RXNA 2MS3A 3GTJL 2OH3A 5FFDA 1CADA 1N1QA 1TJOA 2V2IA 1VELA 2XJRA 4X0JA 2JI2A 3WNWA 3S2HL 1NF6A 1VZHA 3R2KA 1E8JA 3NP2X 2A6ED 1RCEA 2OKCA 4LQNA 2CN7A 2CN6A 2XJQA 1QQTA 3KX9A 3RZ6A 4TO9A 3PKIA 4II4B 2ERSA 3C23A 4RC7A 2NVTL 3HKZP 2FL0A 5LG8A 4CVTA 4TOAA 4C3IL 3C21A 2PSMC 4A3JL 3PVTB 3N6OA 1JYBA 3PWQC 4UY81 4ZKXA 4ITWA 2AUSB 1WCML 3QVDA 2H12A 4LQJA 3NFPI 2R93L 3FDJA 1KRQA 4ML5A 5IP9L 3HAXC 2IU2A 2C2FA 3B08B 2NVXL 5E2DA 3HOYL 3HOXL 5JVH1 2CR8A 3Q4RA 4YVZA 2E2HL 2BKCA 4ZN1B 3KYYA 5M3FL 3KYWA 2O5JD 4QIWP 1F30A 3JR7A 4POFA 1R0FA 1L8IA 1S3QA 2PPTA 2CHIA 1SOFA 1DPSA 2BK6A 3R2HA 3EZ0A 4ZKWA 1ZS3A 4RC7B 4EVEA 4XKTA 1DX8A 1IU5A 3PVYA 4MUDA 3M3YL 1FHHA 3MPSA 2D5KA 4PGIA 5JKMG 3KDQA 4AHWA 4LQHA 3AJPA 1PFVA 4YKHA 3PZAA 3PW1A 2WB1P 2JD80 3FRSA 2X170 2JD70 1VLGA 3C1YA 1VZGA 2F7NA 1LTLA 1OWBA 2ZG9X 3S14L 4AR3A 2ZA7A 2E2JL 2CF7A 2V2MA 5D8OA 4ZTTA 1BG7A 2V0FA 4Y52L 4RC8A 1ZUJA 1IRNA 3PKJA 4ZL6A 2PVEA 1O9IA 3C1ZA 1NNQA 1Z92B 4AHXA 2FJCA 3P2AA 4YXMA 2V2OA 3HJYB 3EZUA 1S24A 3KHKA 3FKIL 3AF8X 1R9TL 2XJNA 2V15A 3KA3A 3RBCA 3GE4A 1IW7D 3ES3A 4ZJKA 1K83L 4TODA 4QUWA 5AI3A 4POGA 1JKUA 2JA7L 5GAGc 5FFEA 3F35A 2M4YA 2XJTA 2C41A 3D19A 3RGDA 2W0OA 3IS7A 5LBHA 2ZG8X 4IWKA 3R2MA 4JAEA 3PW1B 2Z5RA 4KVSA 4LPMA 4PG1A 5CMRA 2V3BB 5EIOC 3UOFA 4AI2A 3GGZA 1B2OA 2FG4A 3HJWB 1TKPA 1RB9A 4JADA 4BBRL 3O7SA 1YK4A 2CKCA 4A25A 4MXPA 2DSXA 4AR5A 2C2UA 4E6KA 2V8UA 3PO2L 3E6RA 2C6BA 3IU3I 4AM4A 1GWGA 2IY4A 4M33A 3S17L 4AI0A 3LWQB 1SMMA 3NP0X 5GU3X 3O7RA 3EGMA 2AYJA 3M4OL 4R42A 3RAVA 1XZ1A 1VCXA 3QHBA 3L0MA 4TVMA 3H9CA 2YU9L 4DE6A 5DM71 1FHMA 1R0HA 1JIGA 2CKAA 3HOZL 4DYUA 1R0IA 4A3EL 2N02A 1B13A 1TWGL 4EVDA 5GAEc 1MOJA 4A3KL 3A68A 2JI1A 3VVAA 3P8BA 3Q4NA 4IWJA 3RYGA 3GTQL 1B71A 1EUMA 5C4JL 6RXNA 4C3HL 4BY1L 4ITTA 4A3IL 3RD0A 2A6HD 3CQZL 4RXNA 4C3JL 2GYQA 2XGWA 3AK9A 4E40A 5D8QA 4XKUA 3WVVA 3F34A 1BRFA 5LS9A 2Z5QA 5JVG1 3QD8A 2XJPA 2ZIXA 1JTSA 1Y1WL 1YV1A 5LG2A 3K7AL 5JDOB 3IS8A 2HR5A 4KVRA 4ISMA 2KN9A 2XKQA 1DVBA 1LB3A 4A3BL 3S1QL 5GU0X 1BFRA 5AXSA 2KKDA 3RZOL 4U671 3E1LA 3RZDL 3MSUA 3HIUA 1YUXA 4A3CL 5GN8A 5FLML 1ODHA 2C6RA 2XJSA 3S1NL 1VEQA 3KYVA 2G4HA 1AEWA 2RFKB 1TWCL 2CHPA 3RZTA 1TK6A 1R0JA 1PFUA 1B2JA 4MKUA 4AI3A 4JAGA 3BVLA 3E1NA 5FJ8L 3S2DL 4E6YA 1BCFA 5MGNA 4ERUA 2NVQL 2FHAA 4ZLWA 2FKZA 3LKDA 4REUA 1F4LA 2RBDA 3UFBA 1IROA 3F33A 3SS2A 4LHNA 4DYXA 1F33A 5HJHA 4TPUA 5D8YA 2WLAA 3J7Z1 1C09A 2B5ID 3GTLL 3GVYA 4LPNA 3R2RA 2AR0A 2V2NA 2L0ZA 1LKMA 4W4KB 1S30A 5IYCL 2C6AA 1IU6A 4MY7A 4YWMA 8RXNA 1JKVA 5D8XA 5GN8B 5IP7L 1Z6OM 3E1JA 3R2OA 2APOB 1VZIA 2M6OA 2HVYC 5GADc 1MFRA 4W4LB 4JAFA 1JI5A 3B0AB 2WTLA 5FEJA 4DYZA 3ZG6A 4M34A 2GYDA 4BY7L 3GTKL 5CMQA 2ITBA 2Y0SP 1RWDA 2R92L 5IX6A 3KWOA 5GAHc 2ZG7X 5J93A 5C6FA 1QGHA 2K2DA 4CVRA 1SMWA 4ZMCA 1NXGA 5D8PA 3BVIA 1IERA 1LKPA 2CLBA 2VL6A 3E6SA 3UOIA 1OWCA 2AQCA 2FFXJ 3PO3L 3RE7A 5K53A 2QQYA 4A3LL 3BVEA 2JA8L 1NFVA 1XZ3A 5IYBL 2QF9A 2YJKA 3SIDA 2PMZP 5AN9H 3TA8A 3HOUL 4AM2A 4AHZA 2JD60 4B8CD 4A3FL 1H96A 2VXXA 2OC5A 3MQKB 3LWRB 3FSEA 2Y3QA 3LNLA 4CY9A 5C3EL 1NF4A 5H1Sc 3WWNB 2UX1A 3GTPL 4ZN3B 1RYTA 1SMUA 4A3DL 3PW8A 1T9PA 4V196 1J30A 1JI4A 3KA6A 3SH6A 1VJXA 4PG0A 4XGHA 1ZRPA 5C4XL 2QL0A 2RDVA 5M5XL 5JDOA 2Z3QB 5J9VA 1TWHL 3E1QA 3QZ3A 3VPBE 1RDVA 5K52A 1S2ZA 3M6JA 5M5YL 1IESA 4ISPA 4ZKHA 4AHYA 3QQCE 3ERZA 4BXXL 5MFZA 2V2RA 3S16L 4A3GL 2WLUA 4A93L 3FI6A 1T9OA 1R0GA 4M32A 2G38B 2ZA6A 3KA8A 3GHQA 2Z5PA
chains in the Genus database with same CATH topology
1RYQA 3A9QA 1OTKA 1JGCA 2M4VA 5AI2A 5MLC3 3F39A 3E2CA 5ERKA 2A68D 4CYBA 3ISEA 5J8SA 1TKOA 3AJQA 3AF7X 1RDGA 1BQ8A 2A69D 4LYXA 5HU6D 4Z5SA 3H7GA 2FZFA 3KYUA 2V2LA 2IB0A 2GMGA 4DZ0A 5D8RA 4RC5B 3VV9A 3KXUA 4DI0A 2YW7A 3QB9A 4LYUA 4XXBB 1Z4AA 4ETRA 3E1MA 4YWLA 1QCVA 2V2PA 3AF9X 2CIHA 2ZURX 4Z3BA 4ZL5A 3PVRA 4G6BA 5FFBA 1RCCA 3E1PA 2BJYA 1JREA 3W54A 1WJVA 3Q4OA 5HQOA 4TOEA 4CMYV 2Z3RB 1SQ3A 2VXIA 4P18A 3NOZX 5MF6A 5J8WA 2XJOA 4AI1A 1YK5A 2XJUA 5EINC 3KA9A 3F37A 5CZUA 2PVXA 1VEIA 4M35A 3PWQA 5HJFA 4PGKA 1BE7A 3A44A 1HRSA 2Z6MA 5GU1X 2CEIA 1UVHA 3KA4A 1UMNA 2BW1A 2Y44A 4WFN1 4DYYA 1CAAA 2V2JA 4XGSA 3ISFA 3WWLA 3AK8A 3HL1A 1RCGA 3PVRB 2M6PA 3GGYA 4KXRB 5K2ME 3F32A 3QHCA 4LHLA 4GS7D 4EVBA 4LPJA 2J9UB 4CVPA 3JZAB 3SHXA 3SE1A 4U3GA 2NYDA 2Z90A 4AR4A 3FVBA 5ERJA 4CVSA 5JKLG 3BKNA 4LQVA 2HTNA 4OYNA 3IQ1A 5MFPA 3K35A 2CWLA 3VNXA 3KYXA 4TOCA 4YXJA 4ME3A 4CYAA 3DBYA 2JI3A 3T9JA 1H7VA 1FHAA 3J7Y1 5GU2X 1DATA 5GOUA 5DM61 4TOHA 2VZBA 3LPEB 2WWXB 1LKOA 4MJYA 1BFYA 2FG8A 3U90A 2V8TA 4IXKA 2YW6A 3R2LA 2PYBA 3PWFA 3OJ5A 3WVWA 4RC6A 3PW8C 2LCQA 5E1UA 1RCDA 2CLUA 1R03A 2YJJA 3OGHA 3R2SA 3AJOA 3PVYB 4XKSA 5IY0A 3JZ9A 1O9RA 4TOGA 4RC5A 4WJG4 4AM5A 5JKMA 5FFCA 4CMYA 5RXNA 5D8SA 4AR6A 5JKLA 2MGYA 2BE5D 2XJVA 4TOBA 2V0EA 2PYAA 2XJMA 5JACA 1T9QA 1NXEA 1RCIA 2GS4A 3PIO1 4TOFA 5FFAA 3E1OA 4MN9A 3WVUA 3V3KB 1Z6OA 4II4A 3BVFA 3F38A 4RC6B 4EVCA 3PVTA 1QYBA 4TW3A 2ERJA 1L8HA 2V2SA 4KVQA 3F36A 4DASA 4K9FA 3UNOA 3PIP1 3Q4QA 5I4JA 2ZA8A 2C2JA 1YUZA 3BT5A 3BVKA 3FRRA 4Y08A 1BQ9A 7RXNA 2MS3A 2OH3A 5FFDA 1CADA 1N1QA 1TJOA 2V2IA 1VELA 2XJRA 4X0JA 2JI2A 3WNWA 1NF6A 1VZHA 3R2KA 1E8JA 3NP2X 2A6ED 1RCEA 2OKCA 4LQNA 2CN7A 2CN6A 2XJQA 3KX9A 3RZ6A 4TO9A 3PKIA 4II4B 2ERSA 3C23A 4RC7A 2FL0A 5LG8A 4CVTA 4TOAA 3C21A 2PSMC 3PVTB 3N6OA 1JYBA 3PWQC 4UY81 4ZKXA 4ITWA 3QVDA 2H12A 4LQJA 3NFPI 1KRQA 4ML5A 2IU2A 2C2FA 3B08B 5E2DA 5JVH1 2CR8A 3Q4RA 4YVZA 2BKCA 4ZN1B 3KYYA 3KYWA 2O5JD 1F30A 4POFA 1R0FA 1L8IA 1S3QA 2PPTA 2CHIA 1SOFA 1DPSA 2BK6A 3R2HA 3EZ0A 4ZKWA 1ZS3A 4RC7B 4EVEA 4XKTA 1DX8A 1IU5A 3PVYA 4MUDA 1FHHA 3MPSA 2D5KA 4PGIA 5JKMG 3KDQA 4AHWA 4LQHA 3AJPA 4YKHA 3PZAA 3PW1A 2JD80 3FRSA 2X170 2JD70 1VLGA 3C1YA 1VZGA 2F7NA 1LTLA 1OWBA 2ZG9X 4AR3A 2ZA7A 2CF7A 2V2MA 5D8OA 4ZTTA 1BG7A 2V0FA 4RC8A 1ZUJA 1IRNA 3PKJA 4ZL6A 2PVEA 1O9IA 3C1ZA 1NNQA 1Z92B 4AHXA 2FJCA 3P2AA 4YXMA 2V2OA 3EZUA 1S24A 3KHKA 3AF8X 2XJNA 2V15A 3KA3A 3RBCA 3GE4A 1IW7D 3ES3A 4ZJKA 4TODA 4QUWA 5AI3A 4POGA 1JKUA 5GAGc 5FFEA 3F35A 2M4YA 2XJTA 2C41A 3D19A 3RGDA 2W0OA 3IS7A 5LBHA 2ZG8X 4IWKA 3R2MA 4JAEA 3PW1B 2Z5RA 4KVSA 4LPMA 4PG1A 5CMRA 2V3BB 5EIOC 3UOFA 4AI2A 3GGZA 1B2OA 2FG4A 1TKPA 1RB9A 4JADA 3O7SA 1YK4A 2CKCA 4A25A 4MXPA 2DSXA 4AR5A 2C2UA 4E6KA 2V8UA 3E6RA 2C6BA 3IU3I 4AM4A 1GWGA 2IY4A 4M33A 4AI0A 1SMMA 3NP0X 5GU3X 3O7RA 3EGMA 2AYJA 4R42A 3RAVA 1XZ1A 1VCXA 3QHBA 3L0MA 4TVMA 4DE6A 5DM71 1FHMA 1R0HA 1JIGA 2CKAA 4DYUA 1R0IA 2N02A 1B13A 4EVDA 5GAEc 1MOJA 3A68A 2JI1A 3VVAA 3P8BA 3Q4NA 4IWJA 3RYGA 1B71A 1EUMA 6RXNA 4ITTA 3RD0A 2A6HD 4RXNA 2GYQA 2XGWA 3AK9A 4E40A 5D8QA 4XKUA 3WVVA 3F34A 1BRFA 5LS9A 2Z5QA 5JVG1 3QD8A 2XJPA 2ZIXA 1JTSA 1YV1A 5LG2A 5JDOB 3IS8A 2HR5A 4KVRA 4ISMA 2KN9A 2XKQA 1DVBA 1LB3A 5GU0X 1BFRA 5AXSA 2KKDA 4U671 3E1LA 3MSUA 3HIUA 1YUXA 5GN8A 1ODHA 2C6RA 2XJSA 1VEQA 3KYVA 2G4HA 1AEWA 2CHPA 3RZTA 1TK6A 1R0JA 1B2JA 4MKUA 4AI3A 4JAGA 3BVLA 3E1NA 4E6YA 1BCFA 5MGNA 4ERUA 2FHAA 4ZLWA 2FKZA 3LKDA 4REUA 2RBDA 3UFBA 1IROA 3F33A 3SS2A 4LHNA 4DYXA 1F33A 5HJHA 4TPUA 5D8YA 2WLAA 3J7Z1 1C09A 2B5ID 3GVYA 4LPNA 3R2RA 2AR0A 2V2NA 2L0ZA 1LKMA 4W4KB 1S30A 2C6AA 1IU6A 4MY7A 4YWMA 8RXNA 1JKVA 5D8XA 5GN8B 1Z6OM 3E1JA 3R2OA 1VZIA 2M6OA 5GADc 1MFRA 4W4LB 4JAFA 1JI5A 3B0AB 2WTLA 5FEJA 4DYZA 3ZG6A 4M34A 2GYDA 5CMQA 2ITBA 1RWDA 5IX6A 3KWOA 5GAHc 2ZG7X 5J93A 5C6FA 1QGHA 2K2DA 4CVRA 1SMWA 4ZMCA 1NXGA 5D8PA 3BVIA 1IERA 1LKPA 2CLBA 2VL6A 3E6SA 3UOIA 1OWCA 2FFXJ 3RE7A 5K53A 2QQYA 3BVEA 1NFVA 1XZ3A 2QF9A 2YJKA 3SIDA 5AN9H 3TA8A 4AM2A 4AHZA 2JD60 4B8CD 1H96A 2VXXA 2OC5A 3FSEA 2Y3QA 3LNLA 4CY9A 1NF4A 5H1Sc 3WWNB 2UX1A 4ZN3B 1RYTA 1SMUA 3PW8A 1T9PA 4V196 1J30A 1JI4A 3KA6A 3SH6A 1VJXA 4PG0A 4XGHA 1ZRPA 2QL0A 2RDVA 5JDOA 2Z3QB 5J9VA 3E1QA 3QZ3A 3VPBE 1RDVA 5K52A 1S2ZA 3M6JA 1IESA 4ISPA 4ZKHA 4AHYA 3QQCE 3ERZA 5MFZA 2V2RA 2WLUA 3FI6A 1T9OA 1R0GA 4M32A 2G38B 2ZA6A 3KA8A 3GHQA 2Z5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A9Q A;  1OTK A;  1JGC A;  5AI2 A;  3F39 A;  3E2C A;  5ERK A;  4CYB A;  3ISE A;  5J8S A;  1TKO A;  3AJQ A;  3AF7 X;  1RDG A;  1BQ8 A;  4LYX A;  4Z5S A;  3H7G A;  2FZF A;  3KYU A;  2V2L A;  2IB0 A;  2GMG A;  4DZ0 A;  5D8R A;  4RC5 B;  3KXU A;  4DI0 A;  2YW7 A;  3QB9 A;  4LYU A;  1Z4A A;  4ETR A;  3E1M A;  4YWL A;  1QCV A;  2V2P A;  3AF9 X;  2CIH A;  2ZUR X;  4Z3B A;  4ZL5 A;  3PVR A;  5FFB A;  1RCC A;  3E1P A;  2BJY A;  1JRE A;  3Q4O A;  5HQO A;  4TOE A;  4CMY V;  1SQ3 A;  2VXI A;  4P18 A;  3NOZ X;  5J8W A;  2XJO A;  1YK5 A;  3KA9 A;  3F37 A;  5CZU A;  2PVX A;  1VEI A;  4M35 A;  3PWQ A;  5HJF A;  4PGK A;  1BE7 A;  3A44 A;  1HRS A;  2Z6M A;  5GU1 X;  2CEI A;  1UVH A;  3KA4 A;  1UMN A;  2BW1 A;  4DYY A;  1CAA A;  2V2J A;  4XGS A;  3ISF A;  3AK8 A;  3HL1 A;  1RCG A;  3PVR B;  3F32 A;  3QHC A;  4EVB A;  4LPJ A;  4CVP A;  3SHX A;  3SE1 A;  4U3G A;  2Z90 A;  4AR4 A;  3FVB A;  5ERJ A;  4CVS A;  5JKL G;  3BKN A;  4LQV A;  2HTN A;  4OYN A;  3IQ1 A;  3VNX A;  3KYX A;  4TOC A;  4ME3 A;  4CYA A;  3T9J A;  1H7V A;  1FHA A;  5GU2 X;  1DAT A;  5GOU A;  4TOH A;  2VZB A;  1LKO A;  4MJY A;  1BFY A;  2FG8 A;  3U90 A;  4IXK A;  2YW6 A;  3R2L A;  2PYB A;  3PWF A;  3OJ5 A;  3WVW A;  4RC6 A;  3PW8 C;  2LCQ A;  5E1U A;  1RCD A;  2CLU A;  1R03 A;  2YJJ A;  3OGH A;  3R2S A;  3AJO A;  3PVY B;  4XKS A;  5IY0 A;  1O9R A;  4TOG A;  4RC5 A;  4AM5 A;  5JKM A;  5FFC A;  4CMY A;  5RXN A;  5D8S A;  4AR6 A;  5JKL A;  4TOB A;  2PYA A;  2XJM A;  5JAC A;  1T9Q A;  1RCI A;  2GS4 A;  4TOF A;  5FFA A;  3E1O A;  4MN9 A;  3WVU A;  1Z6O A;  4II4 A;  3BVF A;  3F38 A;  4RC6 B;  4EVC A;  3PVT A;  1QYB A;  4TW3 A;  1L8H A;  2V2S A;  4KVQ A;  3F36 A;  4DAS A;  4K9F A;  3UNO A;  3Q4Q A;  5I4J A;  2ZA8 A;  2C2J A;  1YUZ A;  3BT5 A;  3BVK A;  4Y08 A;  1BQ9 A;  7RXN A;  2MS3 A;  2OH3 A;  5FFD A;  1CAD A;  1N1Q A;  1TJO A;  2V2I A;  1VEL A;  3WNW A;  1NF6 A;  3R2K A;  1E8J A;  3NP2 X;  1RCE A;  4LQN A;  2CN7 A;  2CN6 A;  3KX9 A;  3RZ6 A;  4TO9 A;  4II4 B;  4RC7 A;  2FL0 A;  5LG8 A;  4CVT A;  4TOA A;  3PVT B;  1JYB A;  3PWQ C;  4ZKX A;  4ITW A;  3QVD A;  4LQJ A;  1KRQ A;  4ML5 A;  2IU2 A;  2C2F A;  5E2D A;  3Q4R A;  2BKC A;  3KYY A;  3KYW A;  1F30 A;  4POF A;  1R0F A;  1L8I A;  1S3Q A;  2CHI A;  1SOF A;  1DPS A;  2BK6 A;  3R2H A;  3EZ0 A;  4ZKW A;  1ZS3 A;  4RC7 B;  4EVE A;  4XKT A;  1DX8 A;  1IU5 A;  3PVY A;  4MUD A;  1FHH A;  3MPS A;  2D5K A;  4PGI A;  5JKM G;  4LQH A;  3AJP A;  4YKH A;  3PZA A;  3PW1 A;  2JD8 0;  2X17 0;  2JD7 0;  1VLG A;  2F7N A;  1LTL A;  2ZG9 X;  4AR3 A;  2ZA7 A;  2CF7 A;  2V2M A;  5D8O A;  4ZTT A;  1BG7 A;  4RC8 A;  1ZUJ A;  1IRN A;  4ZL6 A;  2PVE A;  1O9I A;  1NNQ A;  2FJC A;  2V2O A;  3EZU A;  1S24 A;  3AF8 X;  2XJN A;  2V15 A;  3KA3 A;  3RBC A;  3GE4 A;  3ES3 A;  4ZJK A;  4TOD A;  4QUW A;  5AI3 A;  4POG A;  1JKU A;  5FFE A;  3F35 A;  2M4Y A;  2C41 A;  3RGD A;  2W0O A;  3IS7 A;  5LBH A;  2ZG8 X;  4IWK A;  3R2M A;  3PW1 B;  2Z5R A;  4KVS A;  4PG1 A;  4LPM A;  5CMR A;  2V3B B;  3UOF A;  1B2O A;  2FG4 A;  1TKP A;  1RB9 A;  3O7S A;  1YK4 A;  4A25 A;  2DSX A;  4AR5 A;  2C2U A;  4E6K A;  3E6R A;  4AM4 A;  1GWG A;  2IY4 A;  4M33 A;  1SMM A;  3NP0 X;  5GU3 X;  3O7R A;  3EGM A;  4R42 A;  3RAV A;  1XZ1 A;  1VCX A;  3QHB A;  4DE6 A;  1FHM A;  1R0H A;  1JIG A;  4DYU A;  1R0I A;  1B13 A;  4EVD A;  1MOJ A;  3A68 A;  3Q4N A;  4IWJ A;  3RYG A;  1B71 A;  1EUM A;  6RXN A;  4ITT A;  3RD0 A;  4RXN A;  2GYQ A;  2XGW A;  3AK9 A;  5D8Q A;  4XKU A;  3WVV A;  3F34 A;  1BRF A;  5LS9 A;  2Z5Q A;  3QD8 A;  1JTS A;  1YV1 A;  5LG2 A;  3IS8 A;  2HR5 A;  4KVR A;  4ISM A;  2KN9 A;  1DVB A;  1LB3 A;  2XKQ A;  5GU0 X;  1BFR A;  5AXS A;  2KKD A;  3E1L A;  3HIU A;  1YUX A;  5GN8 A;  2C6R A;  1VEQ A;  3KYV A;  2G4H A;  1AEW A;  2CHP A;  3RZT A;  1TK6 A;  1R0J A;  1B2J A;  4MKU A;  3BVL A;  3E1N A;  1BCF A;  4ERU A;  2FHA A;  4ZLW A;  2FKZ A;  4REU A;  2RBD A;  1IRO A;  3SS2 A;  3F33 A;  4DYX A;  1F33 A;  5HJH A;  4TPU A;  5D8Y A;  2WLA A;  1C09 A;  3GVY A;  4LPN A;  3R2R A;  2V2N A;  1LKM A;  1S30 A;  1IU6 A;  4MY7 A;  4YWM A;  8RXN A;  1JKV A;  5D8X A;  5GN8 B;  1Z6O M;  3E1J A;  3R2O A;  1MFR A;  1JI5 A;  2WTL A;  5FEJ A;  4DYZ A;  4M34 A;  2GYD A;  5CMQ A;  2ITB A;  1RWD A;  5IX6 A;  3KWO A;  2ZG7 X;  5J93 A;  5C6F A;  1QGH A;  2K2D A;  4CVR A;  1SMW A;  4ZMC A;  5D8P A;  3BVI A;  1IER A;  1LKP A;  2CLB A;  2VL6 A;  3E6S A;  3UOI A;  2FFX J;  3RE7 A;  5K53 A;  2QQY A;  3BVE A;  1NFV A;  1XZ3 A;  2QF9 A;  2YJK A;  3SID A;  3TA8 A;  4AM2 A;  2JD6 0;  1H96 A;  2VXX A;  2OC5 A;  3FSE A;  2Y3Q A;  4CY9 A;  1NF4 A;  2UX1 A;  1RYT A;  1SMU A;  3PW8 A;  1T9P A;  1J30 A;  1JI4 A;  3KA6 A;  3SH6 A;  1VJX A;  4PG0 A;  1ZRP A;  2QL0 A;  2RDV A;  5J9V A;  3E1Q A;  3QZ3 A;  1RDV A;  5K52 A;  1S2Z A;  1IES A;  4ISP A;  4ZKH A;  3ERZ A;  2V2R A;  2WLU A;  3FI6 A;  1T9O A;  1R0G A;  4M32 A;  2ZA6 A;  3KA8 A;  3GHQ A;  2Z5P A; 
#chains in the Genus database with same CATH topology
 1RYQ A;  3A9Q A;  1Y1V L;  1OTK A;  1JGC A;  2M4V A;  5AI2 A;  5MLC 3;  3F39 A;  3E2C A;  5ERK A;  2A68 D;  4CYB A;  3ISE A;  5J8S A;  1TKO A;  3AJQ A;  3AF7 X;  1RDG A;  2WAQ P;  4X6A L;  1BQ8 A;  2A69 D;  4LYX A;  5HU6 D;  4Z5S A;  3H7G A;  2FZF A;  3KYU A;  2V2L A;  2IB0 A;  3H99 A;  2GMG A;  3H97 A;  1I3Q L;  4DZ0 A;  5D8R A;  4RC5 B;  3VV9 A;  3KXU A;  4DI0 A;  2YW7 A;  3QB9 A;  4LYU A;  4XXB B;  1Z4A A;  4ETR A;  3HOV L;  3E1M A;  4YWL A;  1QCV A;  2V2P A;  3AF9 X;  3S15 L;  2CIH A;  2ZUR X;  4Z3B A;  4ZL5 A;  3PVR A;  4G6B A;  5FFB A;  1RCC A;  1TWF L;  2NVY L;  3E1P A;  2BJY A;  1JRE A;  3W54 A;  2JA6 L;  1WJV A;  3Q4O A;  5HQO A;  4TOE A;  4CMY V;  2Z3R B;  1SQ3 A;  2VXI A;  4P18 A;  4BBS L;  2B63 L;  3NOZ X;  5MF6 A;  5J8W A;  2XJO A;  4AI1 A;  1YK5 A;  2XJU A;  5EIN C;  3KA9 A;  3F37 A;  5CZU A;  2PVX A;  5M5W L;  1VEI A;  4M35 A;  3PWQ A;  5HJF A;  4PGK A;  1BE7 A;  2EY4 E;  3I4M L;  3A44 A;  1HRS A;  2Z6M A;  5GU1 X;  2CEI A;  1UVH A;  4C2M 1;  3KA4 A;  1UMN A;  2BW1 A;  1TWA L;  2Y44 A;  4WFN 1;  4DYY A;  1CAA A;  3LWV B;  2V2J A;  4XGS A;  3H9B A;  3ISF A;  3WWL A;  3AK8 A;  3HL1 A;  1RCG A;  2JA5 L;  3PVR B;  2M6P A;  3GGY A;  4KXR B;  5K2M E;  1PZX A;  3F32 A;  3QHC A;  3H0G L;  3LWP B;  4LHL A;  4GS7 D;  4EVB A;  3GTO L;  4LPJ A;  4Y7N L;  2J9U B;  4CVP A;  3JZA B;  3SHX A;  3SE1 A;  4U3G A;  2NYD A;  1I6H L;  2Z90 A;  4AR4 A;  3FVB A;  5ERJ A;  4CVS A;  5JKL G;  3BKN A;  4LQV A;  2HTN A;  4OYN A;  3IQ1 A;  5MFP A;  3K35 A;  2CWL A;  3VNX A;  3KYX A;  4TOC A;  4YXJ A;  4ME3 A;  4CYA A;  3I4N L;  3DBY A;  2JI3 A;  3T9J A;  1PFW A;  1H7V A;  1FHA A;  4A3M L;  1PFY A;  3J7Y 1;  3PL5 A;  5GU2 X;  1DAT A;  5GOU A;  1P7P A;  5DM6 1;  4TOH A;  2VZB A;  3LPE B;  2WWX B;  1LKO A;  4MJY A;  1BFY A;  2FG8 A;  3U90 A;  2V8T A;  4IXK A;  2YW6 A;  3R2L A;  5M3M L;  2PYB A;  3PWF A;  3OJ5 A;  3WVW A;  2R7Z L;  4RC6 A;  3PW8 C;  2LCQ A;  5E1U A;  1RCD A;  3HOW L;  2CLU A;  1R03 A;  2YJJ A;  3OGH A;  3R2S A;  3H3V M;  3AJO A;  3PVY B;  3GTG L;  4XKS A;  5IY0 A;  3JZ9 A;  1O9R A;  4TOG A;  3LWO B;  4RC5 A;  4WJG 4;  4AM5 A;  5JKM A;  5FFC A;  4CMY A;  5RXN A;  5D8S A;  4AR6 A;  5JKL A;  2MGY A;  2BE5 D;  2XJV A;  4TOB A;  2V0E A;  1SFO L;  2PYA A;  3GTM L;  2XJM A;  3S1M L;  5JAC A;  1T9Q A;  2VUM L;  1NXE A;  1RCI A;  5C44 L;  2GS4 A;  3PIO 1;  4TOF A;  5FFA A;  3E1O A;  4MN9 A;  5IYD L;  3WVU A;  3V3K B;  1Z6O A;  4II4 A;  3BVF A;  3F38 A;  4RC6 B;  4EVC A;  3PVT A;  1QYB A;  3S1R L;  4TW3 A;  2ERJ A;  1L8H A;  2V2S A;  1I50 L;  4KVQ A;  3F36 A;  4DAS A;  4K9F A;  3UNO A;  3PIP 1;  4AYB P;  3Q4Q A;  5I4J A;  2ZA8 A;  2C2J A;  1YUZ A;  3BT5 A;  3BVK A;  3FRR A;  2E2I L;  4Y08 A;  1BQ9 A;  7RXN A;  2MS3 A;  3GTJ L;  2OH3 A;  5FFD A;  1CAD A;  1N1Q A;  1TJO A;  2V2I A;  1VEL A;  2XJR A;  4X0J A;  2JI2 A;  3WNW A;  3S2H L;  1NF6 A;  1VZH A;  3R2K A;  1E8J A;  3NP2 X;  2A6E D;  1RCE A;  2OKC A;  4LQN A;  2CN7 A;  2CN6 A;  2XJQ A;  1QQT A;  3KX9 A;  3RZ6 A;  4TO9 A;  3PKI A;  4II4 B;  2ERS A;  3C23 A;  4RC7 A;  2NVT L;  3HKZ P;  2FL0 A;  5LG8 A;  4CVT A;  4TOA A;  4C3I L;  3C21 A;  2PSM C;  4A3J L;  3PVT B;  3N6O A;  1JYB A;  3PWQ C;  4UY8 1;  4ZKX A;  4ITW A;  2AUS B;  1WCM L;  3QVD A;  2H12 A;  4LQJ A;  3NFP I;  2R93 L;  3FDJ A;  1KRQ A;  4ML5 A;  5IP9 L;  3HAX C;  2IU2 A;  2C2F A;  3B08 B;  2NVX L;  5E2D A;  3HOY L;  3HOX L;  5JVH 1;  2CR8 A;  3Q4R A;  4YVZ A;  2E2H L;  2BKC A;  4ZN1 B;  3KYY A;  5M3F L;  3KYW A;  2O5J D;  4QIW P;  1F30 A;  3JR7 A;  4POF A;  1R0F A;  1L8I A;  1S3Q A;  2PPT A;  2CHI A;  1SOF A;  1DPS A;  2BK6 A;  3R2H A;  3EZ0 A;  4ZKW A;  1ZS3 A;  4RC7 B;  4EVE A;  4XKT A;  1DX8 A;  1IU5 A;  3PVY A;  4MUD A;  3M3Y L;  1FHH A;  3MPS A;  2D5K A;  4PGI A;  5JKM G;  3KDQ A;  4AHW A;  4LQH A;  3AJP A;  1PFV A;  4YKH A;  3PZA A;  3PW1 A;  2WB1 P;  2JD8 0;  3FRS A;  2X17 0;  2JD7 0;  1VLG A;  3C1Y A;  1VZG A;  2F7N A;  1LTL A;  1OWB A;  2ZG9 X;  3S14 L;  4AR3 A;  2ZA7 A;  2E2J L;  2CF7 A;  2V2M A;  5D8O A;  4ZTT A;  1BG7 A;  2V0F A;  4Y52 L;  4RC8 A;  1ZUJ A;  1IRN A;  3PKJ A;  4ZL6 A;  2PVE A;  1O9I A;  3C1Z A;  1NNQ A;  1Z92 B;  4AHX A;  2FJC A;  3P2A A;  4YXM A;  2V2O A;  3HJY B;  3EZU A;  1S24 A;  3KHK A;  3FKI L;  3AF8 X;  1R9T L;  2XJN A;  2V15 A;  3KA3 A;  3RBC A;  3GE4 A;  1IW7 D;  3ES3 A;  4ZJK A;  1K83 L;  4TOD A;  4QUW A;  5AI3 A;  4POG A;  1JKU A;  2JA7 L;  5GAG c;  5FFE A;  3F35 A;  2M4Y A;  2XJT A;  2C41 A;  3D19 A;  3RGD A;  2W0O A;  3IS7 A;  5LBH A;  2ZG8 X;  4IWK A;  3R2M A;  4JAE A;  3PW1 B;  2Z5R A;  4KVS A;  4LPM A;  4PG1 A;  5CMR A;  2V3B B;  5EIO C;  3UOF A;  4AI2 A;  3GGZ A;  1B2O A;  2FG4 A;  3HJW B;  1TKP A;  1RB9 A;  4JAD A;  4BBR L;  3O7S A;  1YK4 A;  2CKC A;  4A25 A;  4MXP A;  2DSX A;  4AR5 A;  2C2U A;  4E6K A;  2V8U A;  3PO2 L;  3E6R A;  2C6B A;  3IU3 I;  4AM4 A;  1GWG A;  2IY4 A;  4M33 A;  3S17 L;  4AI0 A;  3LWQ B;  1SMM A;  3NP0 X;  5GU3 X;  3O7R A;  3EGM A;  2AYJ A;  3M4O L;  4R42 A;  3RAV A;  1XZ1 A;  1VCX A;  3QHB A;  3L0M A;  4TVM A;  3H9C A;  2YU9 L;  4DE6 A;  5DM7 1;  1FHM A;  1R0H A;  1JIG A;  2CKA A;  3HOZ L;  4DYU A;  1R0I A;  4A3E L;  2N02 A;  1B13 A;  1TWG L;  4EVD A;  5GAE c;  1MOJ A;  4A3K L;  3A68 A;  2JI1 A;  3VVA A;  3P8B A;  3Q4N A;  4IWJ A;  3RYG A;  3GTQ L;  1B71 A;  1EUM A;  5C4J L;  6RXN A;  4C3H L;  4BY1 L;  4ITT A;  4A3I L;  3RD0 A;  2A6H D;  3CQZ L;  4RXN A;  4C3J L;  2GYQ A;  2XGW A;  3AK9 A;  4E40 A;  5D8Q A;  4XKU A;  3WVV A;  3F34 A;  1BRF A;  5LS9 A;  2Z5Q A;  5JVG 1;  3QD8 A;  2XJP A;  2ZIX A;  1JTS A;  1Y1W L;  1YV1 A;  5LG2 A;  3K7A L;  5JDO B;  3IS8 A;  2HR5 A;  4KVR A;  4ISM A;  2KN9 A;  2XKQ A;  1DVB A;  1LB3 A;  4A3B L;  3S1Q L;  5GU0 X;  1BFR A;  5AXS A;  2KKD A;  3RZO L;  4U67 1;  3E1L A;  3RZD L;  3MSU A;  3HIU A;  1YUX A;  4A3C L;  5GN8 A;  5FLM L;  1ODH A;  2C6R A;  2XJS A;  3S1N L;  1VEQ A;  3KYV A;  2G4H A;  1AEW A;  2RFK B;  1TWC L;  2CHP A;  3RZT A;  1TK6 A;  1R0J A;  1PFU A;  1B2J A;  4MKU A;  4AI3 A;  4JAG A;  3BVL A;  3E1N A;  5FJ8 L;  3S2D L;  4E6Y A;  1BCF A;  5MGN A;  4ERU A;  2NVQ L;  2FHA A;  4ZLW A;  2FKZ A;  3LKD A;  4REU A;  1F4L A;  2RBD A;  3UFB A;  1IRO A;  3F33 A;  3SS2 A;  4LHN A;  4DYX A;  1F33 A;  5HJH A;  4TPU A;  5D8Y A;  2WLA A;  3J7Z 1;  1C09 A;  2B5I D;  3GTL L;  3GVY A;  4LPN A;  3R2R A;  2AR0 A;  2V2N A;  2L0Z A;  1LKM A;  4W4K B;  1S30 A;  5IYC L;  2C6A A;  1IU6 A;  4MY7 A;  4YWM A;  8RXN A;  1JKV A;  5D8X A;  5GN8 B;  5IP7 L;  1Z6O M;  3E1J A;  3R2O A;  2APO B;  1VZI A;  2M6O A;  2HVY C;  5GAD c;  1MFR A;  4W4L B;  4JAF A;  1JI5 A;  3B0A B;  2WTL A;  5FEJ A;  4DYZ A;  3ZG6 A;  4M34 A;  2GYD A;  4BY7 L;  3GTK L;  5CMQ A;  2ITB A;  2Y0S P;  1RWD A;  2R92 L;  5IX6 A;  3KWO A;  5GAH c;  2ZG7 X;  5J93 A;  5C6F A;  1QGH A;  2K2D A;  4CVR A;  1SMW A;  4ZMC A;  1NXG A;  5D8P A;  3BVI A;  1IER A;  1LKP A;  2CLB A;  2VL6 A;  3E6S A;  3UOI A;  1OWC A;  2AQC A;  2FFX J;  3PO3 L;  3RE7 A;  5K53 A;  2QQY A;  4A3L L;  3BVE A;  2JA8 L;  1NFV A;  1XZ3 A;  5IYB L;  2QF9 A;  2YJK A;  3SID A;  2PMZ P;  5AN9 H;  3TA8 A;  3HOU L;  4AM2 A;  4AHZ A;  2JD6 0;  4B8C D;  4A3F L;  1H96 A;  2VXX A;  2OC5 A;  3MQK B;  3LWR B;  3FSE A;  2Y3Q A;  3LNL A;  4CY9 A;  5C3E L;  1NF4 A;  5H1S c;  3WWN B;  2UX1 A;  3GTP L;  4ZN3 B;  1RYT A;  1SMU A;  4A3D L;  3PW8 A;  1T9P A;  4V19 6;  1J30 A;  1JI4 A;  3KA6 A;  3SH6 A;  1VJX A;  4PG0 A;  4XGH A;  1ZRP A;  5C4X L;  2QL0 A;  2RDV A;  5M5X L;  5JDO A;  2Z3Q B;  5J9V A;  1TWH L;  3E1Q A;  3QZ3 A;  3VPB E;  1RDV A;  5K52 A;  1S2Z A;  3M6J A;  5M5Y L;  1IES A;  4ISP A;  4ZKH A;  4AHY A;  3QQC E;  3ERZ A;  4BXX L;  5MFZ A;  2V2R A;  3S16 L;  4A3G L;  2WLU A;  4A93 L;  3FI6 A;  1T9O A;  1R0G A;  4M32 A;  2G38 B;  2ZA6 A;  3KA8 A;  3GHQ A;  2Z5P A; 
#chains in the Genus database with same CATH homology
 1RYQ A;  3A9Q A;  1OTK A;  1JGC A;  2M4V A;  5AI2 A;  5MLC 3;  3F39 A;  3E2C A;  5ERK A;  2A68 D;  4CYB A;  3ISE A;  5J8S A;  1TKO A;  3AJQ A;  3AF7 X;  1RDG A;  1BQ8 A;  2A69 D;  4LYX A;  5HU6 D;  4Z5S A;  3H7G A;  2FZF A;  3KYU A;  2V2L A;  2IB0 A;  2GMG A;  4DZ0 A;  5D8R A;  4RC5 B;  3VV9 A;  3KXU A;  4DI0 A;  2YW7 A;  3QB9 A;  4LYU A;  4XXB B;  1Z4A A;  4ETR A;  3E1M A;  4YWL A;  1QCV A;  2V2P A;  3AF9 X;  2CIH A;  2ZUR X;  4Z3B A;  4ZL5 A;  3PVR A;  4G6B A;  5FFB A;  1RCC A;  3E1P A;  2BJY A;  1JRE A;  3W54 A;  1WJV A;  3Q4O A;  5HQO A;  4TOE A;  4CMY V;  2Z3R B;  1SQ3 A;  2VXI A;  4P18 A;  3NOZ X;  5MF6 A;  5J8W A;  2XJO A;  4AI1 A;  1YK5 A;  2XJU A;  5EIN C;  3KA9 A;  3F37 A;  5CZU A;  2PVX A;  1VEI A;  4M35 A;  3PWQ A;  5HJF A;  4PGK A;  1BE7 A;  3A44 A;  1HRS A;  2Z6M A;  5GU1 X;  2CEI A;  1UVH A;  3KA4 A;  1UMN A;  2BW1 A;  2Y44 A;  4WFN 1;  4DYY A;  1CAA A;  2V2J A;  4XGS A;  3ISF A;  3WWL A;  3AK8 A;  3HL1 A;  1RCG A;  3PVR B;  2M6P A;  3GGY A;  4KXR B;  5K2M E;  3F32 A;  3QHC A;  4LHL A;  4GS7 D;  4EVB A;  4LPJ A;  2J9U B;  4CVP A;  3JZA B;  3SHX A;  3SE1 A;  4U3G A;  2NYD A;  2Z90 A;  4AR4 A;  3FVB A;  5ERJ A;  4CVS A;  5JKL G;  3BKN A;  4LQV A;  2HTN A;  4OYN A;  3IQ1 A;  5MFP A;  3K35 A;  2CWL A;  3VNX A;  3KYX A;  4TOC A;  4YXJ A;  4ME3 A;  4CYA A;  3DBY A;  2JI3 A;  3T9J A;  1H7V A;  1FHA A;  3J7Y 1;  5GU2 X;  1DAT A;  5GOU A;  5DM6 1;  4TOH A;  2VZB A;  3LPE B;  2WWX B;  1LKO A;  4MJY A;  1BFY A;  2FG8 A;  3U90 A;  2V8T A;  4IXK A;  2YW6 A;  3R2L A;  2PYB A;  3PWF A;  3OJ5 A;  3WVW A;  4RC6 A;  3PW8 C;  2LCQ A;  5E1U A;  1RCD A;  2CLU A;  1R03 A;  2YJJ A;  3OGH A;  3R2S A;  3AJO A;  3PVY B;  4XKS A;  5IY0 A;  3JZ9 A;  1O9R A;  4TOG A;  4RC5 A;  4WJG 4;  4AM5 A;  5JKM A;  5FFC A;  4CMY A;  5RXN A;  5D8S A;  4AR6 A;  5JKL A;  2MGY A;  2BE5 D;  2XJV A;  4TOB A;  2V0E A;  2PYA A;  2XJM A;  5JAC A;  1T9Q A;  1NXE A;  1RCI A;  2GS4 A;  3PIO 1;  4TOF A;  5FFA A;  3E1O A;  4MN9 A;  3WVU A;  3V3K B;  1Z6O A;  4II4 A;  3BVF A;  3F38 A;  4RC6 B;  4EVC A;  3PVT A;  1QYB A;  4TW3 A;  2ERJ A;  1L8H A;  2V2S A;  4KVQ A;  3F36 A;  4DAS A;  4K9F A;  3UNO A;  3PIP 1;  3Q4Q A;  5I4J A;  2ZA8 A;  2C2J A;  1YUZ A;  3BT5 A;  3BVK A;  3FRR A;  4Y08 A;  1BQ9 A;  7RXN A;  2MS3 A;  2OH3 A;  5FFD A;  1CAD A;  1N1Q A;  1TJO A;  2V2I A;  1VEL A;  2XJR A;  4X0J A;  2JI2 A;  3WNW A;  1NF6 A;  1VZH A;  3R2K A;  1E8J A;  3NP2 X;  2A6E D;  1RCE A;  2OKC A;  4LQN A;  2CN7 A;  2CN6 A;  2XJQ A;  3KX9 A;  3RZ6 A;  4TO9 A;  3PKI A;  4II4 B;  2ERS A;  3C23 A;  4RC7 A;  2FL0 A;  5LG8 A;  4CVT A;  4TOA A;  3C21 A;  2PSM C;  3PVT B;  3N6O A;  1JYB A;  3PWQ C;  4UY8 1;  4ZKX A;  4ITW A;  3QVD A;  2H12 A;  4LQJ A;  3NFP I;  1KRQ A;  4ML5 A;  2IU2 A;  2C2F A;  3B08 B;  5E2D A;  5JVH 1;  2CR8 A;  3Q4R A;  4YVZ A;  2BKC A;  4ZN1 B;  3KYY A;  3KYW A;  2O5J D;  1F30 A;  4POF A;  1R0F A;  1L8I A;  1S3Q A;  2PPT A;  2CHI A;  1SOF A;  1DPS A;  2BK6 A;  3R2H A;  3EZ0 A;  4ZKW A;  1ZS3 A;  4RC7 B;  4EVE A;  4XKT A;  1DX8 A;  1IU5 A;  3PVY A;  4MUD A;  1FHH A;  3MPS A;  2D5K A;  4PGI A;  5JKM G;  3KDQ A;  4AHW A;  4LQH A;  3AJP A;  4YKH A;  3PZA A;  3PW1 A;  2JD8 0;  3FRS A;  2X17 0;  2JD7 0;  1VLG A;  3C1Y A;  1VZG A;  2F7N A;  1LTL A;  1OWB A;  2ZG9 X;  4AR3 A;  2ZA7 A;  2CF7 A;  2V2M A;  5D8O A;  4ZTT A;  1BG7 A;  2V0F A;  4RC8 A;  1ZUJ A;  1IRN A;  3PKJ A;  4ZL6 A;  2PVE A;  1O9I A;  3C1Z A;  1NNQ A;  1Z92 B;  4AHX A;  2FJC A;  3P2A A;  4YXM A;  2V2O A;  3EZU A;  1S24 A;  3KHK A;  3AF8 X;  2XJN A;  2V15 A;  3KA3 A;  3RBC A;  3GE4 A;  1IW7 D;  3ES3 A;  4ZJK A;  4TOD A;  4QUW A;  5AI3 A;  4POG A;  1JKU A;  5GAG c;  5FFE A;  3F35 A;  2M4Y A;  2XJT A;  2C41 A;  3D19 A;  3RGD A;  2W0O A;  3IS7 A;  5LBH A;  2ZG8 X;  4IWK A;  3R2M A;  4JAE A;  3PW1 B;  2Z5R A;  4KVS A;  4LPM A;  4PG1 A;  5CMR A;  2V3B B;  5EIO C;  3UOF A;  4AI2 A;  3GGZ A;  1B2O A;  2FG4 A;  1TKP A;  1RB9 A;  4JAD A;  3O7S A;  1YK4 A;  2CKC A;  4A25 A;  4MXP A;  2DSX A;  4AR5 A;  2C2U A;  4E6K A;  2V8U A;  3E6R A;  2C6B A;  3IU3 I;  4AM4 A;  1GWG A;  2IY4 A;  4M33 A;  4AI0 A;  1SMM A;  3NP0 X;  5GU3 X;  3O7R A;  3EGM A;  2AYJ A;  4R42 A;  3RAV A;  1XZ1 A;  1VCX A;  3QHB A;  3L0M A;  4TVM A;  4DE6 A;  5DM7 1;  1FHM A;  1R0H A;  1JIG A;  2CKA A;  4DYU A;  1R0I A;  2N02 A;  1B13 A;  4EVD A;  5GAE c;  1MOJ A;  3A68 A;  2JI1 A;  3VVA A;  3P8B A;  3Q4N A;  4IWJ A;  3RYG A;  1B71 A;  1EUM A;  6RXN A;  4ITT A;  3RD0 A;  2A6H D;  4RXN A;  2GYQ A;  2XGW A;  3AK9 A;  4E40 A;  5D8Q A;  4XKU A;  3WVV A;  3F34 A;  1BRF A;  5LS9 A;  2Z5Q A;  5JVG 1;  3QD8 A;  2XJP A;  2ZIX A;  1JTS A;  1YV1 A;  5LG2 A;  5JDO B;  3IS8 A;  2HR5 A;  4KVR A;  4ISM A;  2KN9 A;  2XKQ A;  1DVB A;  1LB3 A;  5GU0 X;  1BFR A;  5AXS A;  2KKD A;  4U67 1;  3E1L A;  3MSU A;  3HIU A;  1YUX A;  5GN8 A;  1ODH A;  2C6R A;  2XJS A;  1VEQ A;  3KYV A;  2G4H A;  1AEW A;  2CHP A;  3RZT A;  1TK6 A;  1R0J A;  1B2J A;  4MKU A;  4AI3 A;  4JAG A;  3BVL A;  3E1N A;  4E6Y A;  1BCF A;  5MGN A;  4ERU A;  2FHA A;  4ZLW A;  2FKZ A;  3LKD A;  4REU A;  2RBD A;  3UFB A;  1IRO A;  3F33 A;  3SS2 A;  4LHN A;  4DYX A;  1F33 A;  5HJH A;  4TPU A;  5D8Y A;  2WLA A;  3J7Z 1;  1C09 A;  2B5I D;  3GVY A;  4LPN A;  3R2R A;  2AR0 A;  2V2N A;  2L0Z A;  1LKM A;  4W4K B;  1S30 A;  2C6A A;  1IU6 A;  4MY7 A;  4YWM A;  8RXN A;  1JKV A;  5D8X A;  5GN8 B;  1Z6O M;  3E1J A;  3R2O A;  1VZI A;  2M6O A;  5GAD c;  1MFR A;  4W4L B;  4JAF A;  1JI5 A;  3B0A B;  2WTL A;  5FEJ A;  4DYZ A;  3ZG6 A;  4M34 A;  2GYD A;  5CMQ A;  2ITB A;  1RWD A;  5IX6 A;  3KWO A;  5GAH c;  2ZG7 X;  5J93 A;  5C6F A;  1QGH A;  2K2D A;  4CVR A;  1SMW A;  4ZMC A;  1NXG A;  5D8P A;  3BVI A;  1IER A;  1LKP A;  2CLB A;  2VL6 A;  3E6S A;  3UOI A;  1OWC A;  2FFX J;  3RE7 A;  5K53 A;  2QQY A;  3BVE A;  1NFV A;  1XZ3 A;  2QF9 A;  2YJK A;  3SID A;  5AN9 H;  3TA8 A;  4AM2 A;  4AHZ A;  2JD6 0;  4B8C D;  1H96 A;  2VXX A;  2OC5 A;  3FSE A;  2Y3Q A;  3LNL A;  4CY9 A;  1NF4 A;  5H1S c;  3WWN B;  2UX1 A;  4ZN3 B;  1RYT A;  1SMU A;  3PW8 A;  1T9P A;  4V19 6;  1J30 A;  1JI4 A;  3KA6 A;  3SH6 A;  1VJX A;  4PG0 A;  4XGH A;  1ZRP A;  2QL0 A;  2RDV A;  5JDO A;  2Z3Q B;  5J9V A;  3E1Q A;  3QZ3 A;  3VPB E;  1RDV A;  5K52 A;  1S2Z A;  3M6J A;  1IES A;  4ISP A;  4ZKH A;  4AHY A;  3QQC E;  3ERZ A;  5MFZ A;  2V2R A;  2WLU A;  3FI6 A;  1T9O A;  1R0G A;  4M32 A;  2G38 B;  2ZA6 A;  3KA8 A;  3GHQ A;  2Z5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...