3PWFA

High resolution structure of the fully reduced form of rubrerythrin from p. furiosus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pwfA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pwfA02
1JKUA 2CN7A 2HR5A 2BK6A 4TOBA 5AI3A 5GN8A 1Z6OA 4RXNA 2UX1A 3FI6A 8RXNA 1YUXA 2YW6A 3WVVA 4AR4A 1RDGA 2GYQA 4EVCA 2Z6MA 1JKVA 2Z5RA 4M34A 3ISEA 1VLGA 3F34A 2FKZA 1ZS3A 4CYAA 2DSXA 1E8JA 5JKLG 5C6FA 1NF6A 5D8QA 2JD80 2VZBA 2BKCA 3F38A 1RCGA 1F33A 3KWOA 1TK6A 5HJFA 4PGIA 4U3GA 3BVIA 1IRNA 4AR3A 2GS4A 4AM2A 1BFRA 1B2JA 3KA4A 2HTNA 4ZJKA 2V3BB 2PVEA 4YKHA 5I4JA 4RC8A 1SOFA 4YWMA 1IROA 2VXXA 3F32A 2D5KA 2ZG8X 2ZG7X 1T9QA 4A25A 2IY4A 4ZMCA 1OTKA 5J93A 3E1MA 4CVSA 3AK8A 1RYTA 3PWQA 5CMRA 4ISPA 3Q4NA 3RGDA 1IU6A 3PVTA 4ME3A 5LG2A 3E1PA 3NOZX 3Q4OA 5IY0A 4LQJA 1JIGA 3GHQA 2LCQA 1S3QA 1LKMA 2JD60 3SS2A 5IX6A 2V2JA 2K2DA 5JACA 3KYWA 3R2OA 4ITWA 1EUMA 2WLAA 1J30A 3MPSA 3SHXA 1QGHA 4ZL5A 2WLUA 1DPSA 3F39A 1TJOA 1C09A 3QB9A 3RYGA 2CEIA 1BQ8A 2XJNA 1N1QA 1YV1A 3T9JA 3KA8A 3BVLA 4LPJA 4AM5A 3KYYA 3OGHA 2FJCA 3KX9A 4RC6A 3PWFA 2C2UA 1T9OA 1JI5A 4TOHA 1SMUA 3KA9A 3AJPA 3EGMA 2V2SA 2CN6A 1CAAA 3E1QA 1DX8A 2V2RA 4IXKA 1DVBA 1LB3A 2CF7A 3RBCA 5GOUA 2C2FA 5D8XA 2FHAA 2CIHA 4DYYA 4ZKWA 2Z90A 1SMMA 2QL0A 4DASA 4Y08A 3HIUA 2ZA6A 1FHMA 4LYUA 1BQ9A 3PZAA 5FFEA 3OJ5A 4AR5A 2V2LA 3R2RA 1Z6OM 4M32A 2V2NA 4Z5SA 4MKUA 2JD70 1RDVA 1O9RA 4POGA 4R42A 1RCCA 1MFRA 3O7SA 4M33A 4KVSA 3QHBA 4ERUA 4RC5A 4RC6B 4MUDA 1VELA 1YK5A 5D8OA 1DATA 4II4A 2XJOA 3SE1A 3AF9X 4RC7A 1AEWA 3AF8X 4TOFA 5K52A 1BFYA 5GN8B 3ISFA 4LQVA 3PVYA 2QF9A 2KKDA 3BT5A 4PGKA 5CMQA 2PVXA 1NFVA 3AF7X 3F37A 2F7NA 2V2PA 3UOFA 2MS3A 5JKMA 3NP0X 5D8RA 1B71A 2V2IA 3BVEA 4REUA 5D8SA 2FFXJ 3KA6A 1H7VA 3O7RA 1HRSA 4DZ0A 4DYZA 5AXSA 2YJJA 4RC5B 3E1OA 4XKUA 4TW3A 3R2SA 1RWDA 3KYXA 5E1UA 4DYXA 3R2HA 4KVRA 2V2MA 1LTLA 4POFA 3WVWA 2CHIA 4IWKA 1NF4A 4RC7B 1SQ3A 5LG8A 3BVKA 4TODA 5FFDA 2BJYA 2OH3A 1T9PA 3ES3A 3PVYB 3F33A 3EZUA 1R0GA 4TOGA 5GU0X 1S30A 2FG4A 7RXNA 4LPMA 4CMYV 3NP2X 3QZ3A 1IERA 1JTSA 3UOIA 3E1LA 2PYAA 1QCVA 1R0JA 2ITBA 2C41A 4Z3BA 3Q4RA 4ZL6A 3RZ6A 4CY9A 1TKOA 1R03A 2YJKA 2CHPA 2Z5QA 3RZTA 2CLBA 3PVTB 4YWLA 4IWJA 3E2CA 5K53A 4ITTA 3UNOA 1B13A 2PYBA 3BVFA 4CVPA 3PVRA 5GU3X 3RE7A 5LBHA 2C2JA 2RBDA 5RXNA 4PG1A 5J8WA 1IU5A 3F36A 3IS7A 5JKMG 2XGWA 3IS8A 4EVEA 4TOEA 4ML5A 3HL1A 5HJHA 2FZFA 3KYVA 5ERKA 2GYDA 3BKNA 3Q4QA 3R2LA 1KRQA 3EZ0A 3TA8A 4CMYA 1Z4AA 1UVHA 2BW1A 3RD0A 4LPNA 3PW8C 4LQHA 1R0FA 1L8HA 2V2OA 5D8YA 2M4YA 3E6SA 3KXUA 4ISMA 3GE4A 1VJXA 1JI4A 4TO9A 5GU1X 2KN9A 2G4HA 5E2DA 3KYUA 3PW1A 1S24A 2X170 4ZKXA 3SIDA 3PVRB 4P18A 1JGCA 4M35A 3IQ1A 4AR6A 5AI2A 1VEIA 4QUWA 3R2KA 4MN9A 4K9FA 4EVBA 5GU2X 4DE6A 1FHAA 1BE7A 3VNXA 4TOCA 2Y3QA 4E6KA 5FFCA 1CADA 3QD8A 1YK4A 2WTLA 1H96A 4MY7A 3E6RA 4ZKHA 2ZA8A 1FHHA 3QVDA 4TOAA 1RCDA 1VEQA 3U90A 5ERJA 2ZG9X 1RCIA 2FG8A 4XKTA 1NNQA 1LKOA 3ERZA 1S2ZA 3SH6A 1BG7A 3WVUA 4DYUA 1RCEA 1ZRPA 4ZLWA 2GMGA 1QYBA 3WNWA 3E1JA 3PW1B 3RAVA 4LYXA 2XJMA 2RDVA 5J9VA 1LKPA 4II4B 1TKPA 2V15A 4AM4A 1R0HA 4CYBA 1YUZA 5LS9A 4CVRA 2VXIA 1JYBA 3FVBA 3QHCA 2FL0A 3R2MA 1ZUJA 1BCFA 1VCXA 4MJYA 3PWQC 1R0IA 4EVDA 1SMWA 3KA3A 1RB9A 4ETRA 5JKLA 1JREA 3AJQA 5FFBA 3FSEA 2VL6A 3F35A 4PG0A 2IU2A 2ZURX 3A44A 4XGSA 3GVYA 4OYNA 2C6RA 1BRFA 5J8SA 4TPUA 2XKQA 1MOJA 3A68A 3H7GA 4CVTA 2W0OA 1UMNA 2CLUA 5FEJA 5CZUA 2YW7A 3AJOA 2OC5A 4ZTTA 4DI0A 6RXNA 5HQOA 2Z5PA 1XZ3A 1F30A 4LQNA 5D8PA 3E1NA 1IESA 2ZA7A 3AK9A 4XKSA 1O9IA 2QQYA 3PW8A 5FFAA 1GWGA 1XZ1A 3A9QA 1L8IA 4KVQA 2IB0A 1B2OA
chains in the Genus database with same CATH superfamily
1JKUA 2CN7A 2XJTA 4LHNA 3RZOL 2C6AA 2HR5A 2BK6A 2WB1P 4TOBA 5AI3A 2C6BA 1PFVA 5M3ML 5GN8A 2BE5D 1Z6OA 4RXNA 3NFPI 5GADc 2L0ZA 3PKIA 4AI3A 2UX1A 3FI6A 2AQCA 5JDOA 8RXNA 2R7ZL 1YUXA 2YW6A 3WVVA 5EIOC 4AR4A 2JA8L 1RDGA 2GYQA 4EVCA 3M6JA 2Z6MA 2Y0SP 4ZN3B 1JKVA 2Z5RA 4M34A 3ISEA 1VLGA 5DM71 3F34A 2FKZA 1ZS3A 4CYAA 3HOVL 2DSXA 1E8JA 5JKLG 2NVYL 5C6FA 3LWVB 1NF6A 3GGZA 5D8QA 3H3VM 4KXRB 3CQZL 2JD80 2VZBA 2XJUA 1VZHA 2BKCA 3IU3I 3F38A 3HKZP 4LHLA 1RCGA 1F33A 4BY7L 3KWOA 1TK6A 5HJFA 4PGIA 3JR7A 1PFUA 4U3GA 3BVIA 1IRNA 3FKIL 4AR3A 2GS4A 4AM2A 4A93L 1BFRA 1B2JA 3KA4A 2HTNA 4ZJKA 3H9CA 3J7Y1 2V3BB 2PVEA 4YKHA 5I4JA 4RC8A 1SOFA 4YWMA 2V8TA 1IROA 4BBRL 2VXXA 3F32A 2D5KA 2ZG8X 5JDOB 2R93L 2ZG7X 1T9QA 4AI1A 1OWBA 4A25A 2IY4A 4ZMCA 1OTKA 3H0GL 2VUML 2M4VA 5J93A 1Z92B 3S1NL 3E1MA 4CVSA 3AK8A 4C3HL 1RYTA 2CKCA 5K2ME 3PWQA 5CMRA 4ISPA 2Y44A 3Q4NA 3RGDA 1IU6A 3PVTA 4ME3A 5LG2A 3K35A 3E1PA 3NOZX 3Q4OA 5H1Sc 5IY0A 4LQJA 2V0FA 1JIGA 3GHQA 1Y1WL 2LCQA 1S3QA 1LKMA 4JAFA 2JD60 3WWNB 2M6PA 3SS2A 5IX6A 2V2JA 2K2DA 3N6OA 5JACA 3LKDA 3KYWA 3K7AL 3R2OA 2V0EA 4A3EL 4ITWA 3GTQL 3PL5A 1EUMA 2WLAA 1J30A 3MPSA 3SHXA 1QGHA 4ZL5A 5MFZA 4BBSL 1I3QL 2WLUA 1DPSA 3F39A 1TJOA 1C09A 4U671 5JVH1 5MGNA 3QB9A 3RYGA 4BY1L 2CEIA 1BQ8A 2XJNA 1N1QA 3H99A 1YV1A 3T9JA 4A3IL 5GAGc 3KA8A 3BVLA 3QQCE 3GGYA 4LPJA 4AM5A 3KYYA 1I6HL 3HJYB 3OGHA 2FJCA 3KX9A 5IYCL 4RC6A 3PWFA 2C2UA 2JA7L 2O5JD 4C2M1 2MGYA 1JI5A 1T9OA 3PO2L 4Y7NL 4TOHA 1SMUA 3GTLL 3KA9A 3AJPA 3EGMA 1IW7D 3PIP1 2V2SA 2CN6A 1CAAA 4A3DL 2JA6L 5GAEc 3E1QA 5FJ8L 2V2RA 1DX8A 4IXKA 1DVBA 1LB3A 2CF7A 3RBCA 5GOUA 2C2FA 5D8XA 1K83L 2JA5L 2FHAA 2CIHA 3FRSA 4DYYA 2Z90A 4ZKWA 1SMMA 4DASA 2J9UB 2QL0A 4Y08A 4A3KL 3S17L 3HIUA 2ZA6A 3GTJL 1FHMA 3S1ML 4LYUA 1BQ9A 3C21A 3PZAA 4B8CD 5FFEA 1WJVA 3OJ5A 2AR0A 2V2LA 4AR5A 3LWOB 2AUSB 3R2RA 1Z6OM 4M32A 2V2NA 4Z5SA 1Y1VL 4MKUA 2JD70 1RDVA 1O9RA 3V3KB 4POGA 4R42A 1RCCA 1PFYA 1MFRA 4A3CL 2B5ID 2WWXB 2XJPA 3O7SA 4M33A 2G38B 4YVZA 3HOXL 4KVSA 3QHBA 4ERUA 1NXGA 4RC5A 4RC6B 3S2HL 4MUDA 5C44L 3P2AA 1VELA 1YK5A 5D8OA 4AI2A 4YXMA 3LWRB 1DATA 4II4A 4WFN1 2XJOA 5HU6D 3SE1A 3AF9X 3HJWB 2E2HL 4RC7A 1AEWA 2E2JL 3AF8X 1PFWA 4TOFA 5K52A 1I50L 1BFYA 5GN8B 3ISFA 4LQVA 3PVYA 1TWAL 2A6HD 2QF9A 5MF6A 2KKDA 3BT5A 4PGKA 2NVTL 5CMQA 2H12A 3M4OL 3MQKB 2PVXA 1NFVA 2XJVA 3AF7X 3F37A 2F7NA 2V2PA 3UOFA 2MS3A 5AN9H 5JKMA 3PIO1 3VV9A 3NP0X 3FRRA 5D8RA 1TWGL 5C4JL 1B71A 2V2IA 3MSUA 3BVEA 3KDQA 4REUA 1NXEA 5D8SA 2FFXJ 4GS7D 3KA6A 3C23A 2XJSA 5M5YL 1H7VA 3O7RA 5M3FL 1WCML 2Z3QB 3GTKL 1HRSA 1F4LA 2N02A 5M5XL 4DZ0A 2PSMC 4DYZA 5AXSA 4AI0A 4W4LB 4A3GL 3J7Z1 2YJJA 4RC5B 3E1OA 1VZGA 4XKUA 4TW3A 3R2SA 1RWDA 3KYXA 5E1UA 1P7PA 4DYXA 3R2HA 4KVRA 2V2MA 1LTLA 4POFA 3WVWA 2CHIA 4IWKA 5FLML 1NF4A 4RC7B 1SQ3A 5LG8A 3BVKA 4TODA 5FFDA 4AHZA 2ZIXA 2BJYA 2OH3A 2ERSA 1T9PA 3ES3A 3PVYB 3F33A 3EZUA 1R0GA 4TOGA 5GU0X 1S30A 2FG4A 7RXNA 4LPMA 3UFBA 4CMYV 4JAGA 4C3IL 1QQTA 3NP2X 2M6OA 3QZ3A 1IERA 4YXJA 3M3YL 1JTSA 5EINC 3UOIA 1ODHA 3E1LA 5C3EL 2PYAA 1PZXA 1QCVA 1R0JA 2ITBA 3HOZL 2RFKB 2A69D 2CKAA 4A3LL 2C41A 4QIWP 4Z3BA 3Q4RA 4ZL6A 3RZ6A 3S1QL 4JADA 4CY9A 1TKOA 1R03A 2YJKA 2CHPA 5MFPA 2Z5QA 3RZTA 2CLBA 3PVTB 4YWLA 4IWJA 3E2CA 3HAXC 5K53A 4C3JL 4ITTA 3UNOA 1B13A 4AHXA 2PYBA 3BVFA 2R92L 4CVPA 3PVRA 5GU3X 3RE7A 5LBHA 2C2JA 2RBDA 4MXPA 5IP9L 5RXNA 2OKCA 4PG1A 3GTOL 4V196 5J8WA 2JI1A 1IU5A 3F36A 3IS7A 3WWLA 2B63L 3B0AB 5JKMG 2XGWA 3IS8A 2ERJA 3ZG6A 2NVQL 4EVEA 3LWPB 3HOUL 4XXBB 4TOEA 3VPBE 4ML5A 3HL1A 2EY4E 5HJHA 2FZFA 3KYVA 5ERKA 2GYDA 3BKNA 3Q4QA 3R2LA 1KRQA 4ZN1B 3EZ0A 3TA8A 4CMYA 2A6ED 1Z4AA 5IYBL 5MLC3 1UVHA 2BW1A 3RD0A 4LPNA 3PW8C 4LQHA 1R0FA 4A3BL 1L8HA 2V2OA 4XGHA 5D8YA 2M4YA 2PMZP 5JVG1 3E6SA 2A68D 1R9TL 4UY81 2CR8A 3KXUA 4ISMA 3HOWL 3C1YA 3GE4A 3PO3L 1VJXA 1JI4A 4TO9A 5GU1X 2PPTA 2KN9A 2G4HA 5E2DA 3KYUA 4A3JL 3PW1A 1S24A 2NVXL 2X170 4ZKXA 3SIDA 1TWFL 3PVRB 4P18A 1JGCA 4M35A 2HVYC 2APOB 3IQ1A 4AR6A 3DBYA 3GTPL 5AI2A 1VEIA 4QUWA 3R2KA 4MN9A 4K9FA 4EVBA 5GU2X 4DE6A 1FHAA 1BE7A 3LNLA 3L0MA 3VNXA 3S14L 4TOCA 2Y3QA 3P8BA 4E6KA 5FFCA 1CADA 3QD8A 1YK4A 3I4ML 2WTLA 1H96A 4MY7A 3E6RA 4ZKHA 3JZ9A 2ZA8A 1FHHA 3QVDA 4TOAA 1RCDA 1VEQA 3U90A 5ERJA 2E2IL 2ZG9X 1RCIA 3LWQB 3H97A 2FG8A 4XKTA 1NNQA 5DM61 1LKOA 3ERZA 1S2ZA 2AYJA 3GTGL 3SH6A 1BG7A 4E40A 3WVUA 4DYUA 1RCEA 3C1ZA 1ZRPA 4ZLWA 2GMGA 4AHWA 1OWCA 1QYBA 3WNWA 3E1JA 4Y52L 3PW1B 3RAVA 4E6YA 3RZDL 4LYXA 2XJMA 2RDVA 3GTML 5J9VA 1SFOL 1LKPA 4II4B 1TKPA 2V15A 4AM4A 1R0HA 4CYBA 1YUZA 5LS9A 4CVRA 2VXIA 1JYBA 3FVBA 3QHCA 2NYDA 2FL0A 2XJRA 3R2MA 1ZUJA 3HOYL 1BCFA 4G6BA 5IP7L 3JZAB 2JI3A 1VCXA 4MJYA 3PWQC 4AHYA 1R0IA 4EVDA 3B08B 1SMWA 4BXXL 3KA3A 1RB9A 4ETRA 5JKLA 1JREA 3AJQA 3S16L 5FFBA 3FSEA 3KHKA 4A3FL 2VL6A 2CWLA 3H9BA 4A3ML 3F35A 4PG0A 2IU2A 2JI2A 2ZURX 3A44A 4XGSA 1TWHL 3GVYA 4X0JA 5M5WL 4OYNA 2C6RA 1BRFA 5J8SA 5IYDL 4X6AL 4TPUA 2XKQA 1MOJA 3A68A 3H7GA 3FDJA 4CVTA 3S1RL 2W0OA 4JAEA 3I4NL 3VVAA 1TWCL 1UMNA 3W54A 2CLUA 5FEJA 5CZUA 3S15L 1RYQA 2Z3RB 2YW7A 3AJOA 2OC5A 2WAQP 4ZTTA 4DI0A 4TVMA 2V8UA 5HQOA 6RXNA 3D19A 3LPEB 2Z5PA 4W4KB 1XZ3A 3PKJA 1F30A 1VZIA 5GAHc 4LQNA 5D8PA 3E1NA 1IESA 2XJQA 2ZA7A 3AK9A 4XKSA 1O9IA 4AYBP 2QQYA 2YU9L 3PW8A 5FFAA 1GWGA 1XZ1A 3A9QA 1L8IA 4KVQA 2IB0A 4WJG4 3S2DL 5C4XL 1B2OA
chains in the Genus database with same CATH topology
1JKUA 2CN7A 2XJTA 4LHNA 2C6AA 2HR5A 2BK6A 4TOBA 5AI3A 2C6BA 5GN8A 2BE5D 1Z6OA 4RXNA 3NFPI 5GADc 2L0ZA 3PKIA 4AI3A 2UX1A 3FI6A 5JDOA 8RXNA 1YUXA 2YW6A 3WVVA 5EIOC 4AR4A 1RDGA 2GYQA 4EVCA 3M6JA 2Z6MA 4ZN3B 1JKVA 2Z5RA 4M34A 3ISEA 1VLGA 5DM71 3F34A 2FKZA 1ZS3A 4CYAA 2DSXA 1E8JA 5JKLG 5C6FA 1NF6A 3GGZA 5D8QA 4KXRB 2JD80 2VZBA 2XJUA 1VZHA 2BKCA 3IU3I 3F38A 4LHLA 1RCGA 1F33A 3KWOA 1TK6A 5HJFA 4PGIA 4U3GA 3BVIA 1IRNA 4AR3A 2GS4A 4AM2A 1BFRA 1B2JA 3KA4A 2HTNA 4ZJKA 3J7Y1 2V3BB 2PVEA 4YKHA 5I4JA 4RC8A 1SOFA 4YWMA 2V8TA 1IROA 2VXXA 3F32A 2D5KA 2ZG8X 5JDOB 2ZG7X 1T9QA 4AI1A 1OWBA 4A25A 2IY4A 4ZMCA 1OTKA 2M4VA 5J93A 1Z92B 3E1MA 4CVSA 3AK8A 1RYTA 2CKCA 5K2ME 3PWQA 5CMRA 4ISPA 2Y44A 3Q4NA 3RGDA 1IU6A 3PVTA 4ME3A 5LG2A 3K35A 3E1PA 3NOZX 3Q4OA 5H1Sc 5IY0A 4LQJA 2V0FA 1JIGA 3GHQA 2LCQA 1S3QA 1LKMA 4JAFA 2JD60 3WWNB 2M6PA 3SS2A 5IX6A 2V2JA 2K2DA 3N6OA 5JACA 3LKDA 3KYWA 3R2OA 2V0EA 4ITWA 1EUMA 2WLAA 1J30A 3MPSA 3SHXA 1QGHA 4ZL5A 5MFZA 2WLUA 1DPSA 3F39A 1TJOA 1C09A 4U671 5JVH1 5MGNA 3QB9A 3RYGA 2CEIA 1BQ8A 2XJNA 1N1QA 1YV1A 3T9JA 5GAGc 3KA8A 3BVLA 3QQCE 3GGYA 4LPJA 4AM5A 3KYYA 3OGHA 2FJCA 3KX9A 4RC6A 3PWFA 2C2UA 2O5JD 2MGYA 1JI5A 1T9OA 4TOHA 1SMUA 3KA9A 3AJPA 3EGMA 1IW7D 3PIP1 2V2SA 2CN6A 1CAAA 5GAEc 3E1QA 1DX8A 2V2RA 4IXKA 1DVBA 1LB3A 2CF7A 3RBCA 5GOUA 2C2FA 5D8XA 2FHAA 2CIHA 3FRSA 4DYYA 2Z90A 4ZKWA 1SMMA 4DASA 2J9UB 2QL0A 4Y08A 3HIUA 2ZA6A 1FHMA 4LYUA 1BQ9A 3C21A 3PZAA 4B8CD 5FFEA 1WJVA 3OJ5A 2AR0A 2V2LA 4AR5A 3R2RA 1Z6OM 4M32A 2V2NA 4Z5SA 4MKUA 2JD70 1RDVA 1O9RA 3V3KB 4POGA 4R42A 1RCCA 1MFRA 2B5ID 2WWXB 2XJPA 3O7SA 4M33A 2G38B 4YVZA 4KVSA 3QHBA 4ERUA 1NXGA 4RC5A 4RC6B 4MUDA 3P2AA 1VELA 1YK5A 5D8OA 4AI2A 4YXMA 1DATA 4II4A 4WFN1 2XJOA 5HU6D 3SE1A 3AF9X 4RC7A 1AEWA 3AF8X 4TOFA 5K52A 1BFYA 5GN8B 3ISFA 4LQVA 3PVYA 2A6HD 2QF9A 5MF6A 2KKDA 3BT5A 4PGKA 5CMQA 2H12A 2PVXA 1NFVA 2XJVA 3AF7X 3F37A 2F7NA 2V2PA 3UOFA 2MS3A 5AN9H 5JKMA 3PIO1 3VV9A 3NP0X 3FRRA 5D8RA 1B71A 2V2IA 3MSUA 3BVEA 3KDQA 4REUA 1NXEA 5D8SA 2FFXJ 4GS7D 3KA6A 3C23A 2XJSA 1H7VA 3O7RA 2Z3QB 1HRSA 2N02A 4DZ0A 2PSMC 4DYZA 5AXSA 4AI0A 4W4LB 3J7Z1 2YJJA 4RC5B 3E1OA 1VZGA 4XKUA 4TW3A 3R2SA 1RWDA 3KYXA 5E1UA 4DYXA 3R2HA 4KVRA 2V2MA 1LTLA 4POFA 3WVWA 2CHIA 4IWKA 1NF4A 4RC7B 1SQ3A 5LG8A 3BVKA 4TODA 5FFDA 4AHZA 2ZIXA 2BJYA 2OH3A 2ERSA 1T9PA 3ES3A 3PVYB 3F33A 3EZUA 1R0GA 4TOGA 5GU0X 1S30A 2FG4A 7RXNA 4LPMA 3UFBA 4CMYV 4JAGA 3NP2X 2M6OA 3QZ3A 1IERA 4YXJA 1JTSA 5EINC 3UOIA 1ODHA 3E1LA 2PYAA 1QCVA 1R0JA 2ITBA 2A69D 2CKAA 2C41A 4Z3BA 3Q4RA 4ZL6A 3RZ6A 4JADA 4CY9A 1TKOA 1R03A 2YJKA 2CHPA 5MFPA 2Z5QA 3RZTA 2CLBA 3PVTB 4YWLA 4IWJA 3E2CA 5K53A 4ITTA 3UNOA 1B13A 4AHXA 2PYBA 3BVFA 4CVPA 3PVRA 5GU3X 3RE7A 5LBHA 2C2JA 2RBDA 4MXPA 5RXNA 2OKCA 4PG1A 4V196 5J8WA 2JI1A 1IU5A 3F36A 3IS7A 3WWLA 3B0AB 5JKMG 2XGWA 3IS8A 2ERJA 3ZG6A 4EVEA 4XXBB 4TOEA 3VPBE 4ML5A 3HL1A 5HJHA 2FZFA 3KYVA 5ERKA 2GYDA 3BKNA 3Q4QA 3R2LA 1KRQA 4ZN1B 3EZ0A 3TA8A 4CMYA 2A6ED 1Z4AA 5MLC3 1UVHA 2BW1A 3RD0A 4LPNA 3PW8C 4LQHA 1R0FA 1L8HA 2V2OA 4XGHA 5D8YA 2M4YA 5JVG1 3E6SA 2A68D 4UY81 2CR8A 3KXUA 4ISMA 3C1YA 3GE4A 1VJXA 1JI4A 4TO9A 5GU1X 2PPTA 2KN9A 2G4HA 5E2DA 3KYUA 3PW1A 1S24A 2X170 4ZKXA 3SIDA 3PVRB 4P18A 1JGCA 4M35A 3IQ1A 4AR6A 3DBYA 5AI2A 1VEIA 4QUWA 3R2KA 4MN9A 4K9FA 4EVBA 5GU2X 4DE6A 1FHAA 1BE7A 3LNLA 3L0MA 3VNXA 4TOCA 2Y3QA 3P8BA 4E6KA 5FFCA 1CADA 3QD8A 1YK4A 2WTLA 1H96A 4MY7A 3E6RA 4ZKHA 3JZ9A 2ZA8A 1FHHA 3QVDA 4TOAA 1RCDA 1VEQA 3U90A 5ERJA 2ZG9X 1RCIA 2FG8A 4XKTA 1NNQA 5DM61 1LKOA 3ERZA 1S2ZA 2AYJA 3SH6A 1BG7A 4E40A 3WVUA 4DYUA 1RCEA 3C1ZA 1ZRPA 4ZLWA 2GMGA 4AHWA 1OWCA 1QYBA 3WNWA 3E1JA 3PW1B 3RAVA 4E6YA 4LYXA 2XJMA 2RDVA 5J9VA 1LKPA 4II4B 1TKPA 2V15A 4AM4A 1R0HA 4CYBA 1YUZA 5LS9A 4CVRA 2VXIA 1JYBA 3FVBA 3QHCA 2NYDA 2FL0A 2XJRA 3R2MA 1ZUJA 1BCFA 4G6BA 3JZAB 2JI3A 1VCXA 4MJYA 3PWQC 4AHYA 1R0IA 4EVDA 3B08B 1SMWA 3KA3A 1RB9A 4ETRA 5JKLA 1JREA 3AJQA 5FFBA 3FSEA 3KHKA 2VL6A 2CWLA 3F35A 4PG0A 2IU2A 2JI2A 2ZURX 3A44A 4XGSA 3GVYA 4X0JA 4OYNA 2C6RA 1BRFA 5J8SA 4TPUA 2XKQA 1MOJA 3A68A 3H7GA 4CVTA 2W0OA 4JAEA 3VVAA 1UMNA 3W54A 2CLUA 5FEJA 5CZUA 1RYQA 2Z3RB 2YW7A 3AJOA 2OC5A 4ZTTA 4DI0A 4TVMA 2V8UA 5HQOA 6RXNA 3D19A 3LPEB 2Z5PA 4W4KB 1XZ3A 3PKJA 1F30A 1VZIA 5GAHc 4LQNA 5D8PA 3E1NA 1IESA 2XJQA 2ZA7A 3AK9A 4XKSA 1O9IA 2QQYA 3PW8A 5FFAA 1GWGA 1XZ1A 3A9QA 1L8IA 4KVQA 2IB0A 4WJG4 1B2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKU A;  2CN7 A;  2HR5 A;  2BK6 A;  4TOB A;  5AI3 A;  5GN8 A;  1Z6O A;  4RXN A;  2UX1 A;  3FI6 A;  8RXN A;  1YUX A;  2YW6 A;  3WVV A;  4AR4 A;  1RDG A;  2GYQ A;  4EVC A;  2Z6M A;  1JKV A;  2Z5R A;  4M34 A;  3ISE A;  1VLG A;  3F34 A;  2FKZ A;  1ZS3 A;  4CYA A;  2DSX A;  1E8J A;  5JKL G;  5C6F A;  1NF6 A;  5D8Q A;  2JD8 0;  2VZB A;  2BKC A;  3F38 A;  1RCG A;  1F33 A;  3KWO A;  1TK6 A;  5HJF A;  4PGI A;  4U3G A;  3BVI A;  1IRN A;  4AR3 A;  2GS4 A;  4AM2 A;  1BFR A;  1B2J A;  3KA4 A;  2HTN A;  4ZJK A;  2V3B B;  2PVE A;  4YKH A;  5I4J A;  4RC8 A;  1SOF A;  4YWM A;  1IRO A;  2VXX A;  3F32 A;  2D5K A;  2ZG8 X;  2ZG7 X;  1T9Q A;  4A25 A;  2IY4 A;  4ZMC A;  1OTK A;  5J93 A;  3E1M A;  4CVS A;  3AK8 A;  1RYT A;  3PWQ A;  5CMR A;  4ISP A;  3Q4N A;  3RGD A;  1IU6 A;  3PVT A;  4ME3 A;  5LG2 A;  3E1P A;  3NOZ X;  3Q4O A;  5IY0 A;  4LQJ A;  1JIG A;  3GHQ A;  2LCQ A;  1S3Q A;  1LKM A;  2JD6 0;  3SS2 A;  5IX6 A;  2V2J A;  2K2D A;  5JAC A;  3KYW A;  3R2O A;  4ITW A;  1EUM A;  2WLA A;  1J30 A;  3MPS A;  3SHX A;  1QGH A;  4ZL5 A;  2WLU A;  1DPS A;  3F39 A;  1TJO A;  1C09 A;  3QB9 A;  3RYG A;  2CEI A;  1BQ8 A;  2XJN A;  1N1Q A;  1YV1 A;  3T9J A;  3KA8 A;  3BVL A;  4LPJ A;  4AM5 A;  3KYY A;  3OGH A;  2FJC A;  3KX9 A;  4RC6 A;  3PWF A;  2C2U A;  1T9O A;  1JI5 A;  4TOH A;  1SMU A;  3KA9 A;  3AJP A;  3EGM A;  2V2S A;  2CN6 A;  1CAA A;  3E1Q A;  1DX8 A;  2V2R A;  4IXK A;  1DVB A;  1LB3 A;  2CF7 A;  3RBC A;  5GOU A;  2C2F A;  5D8X A;  2FHA A;  2CIH A;  4DYY A;  4ZKW A;  2Z90 A;  1SMM A;  2QL0 A;  4DAS A;  4Y08 A;  3HIU A;  2ZA6 A;  1FHM A;  4LYU A;  1BQ9 A;  3PZA A;  5FFE A;  3OJ5 A;  4AR5 A;  2V2L A;  3R2R A;  1Z6O M;  4M32 A;  2V2N A;  4Z5S A;  4MKU A;  2JD7 0;  1RDV A;  1O9R A;  4POG A;  4R42 A;  1RCC A;  1MFR A;  3O7S A;  4M33 A;  4KVS A;  3QHB A;  4ERU A;  4RC5 A;  4RC6 B;  4MUD A;  1VEL A;  1YK5 A;  5D8O A;  1DAT A;  4II4 A;  2XJO A;  3SE1 A;  3AF9 X;  4RC7 A;  1AEW A;  3AF8 X;  4TOF A;  5K52 A;  1BFY A;  5GN8 B;  3ISF A;  4LQV A;  3PVY A;  2QF9 A;  2KKD A;  3BT5 A;  4PGK A;  5CMQ A;  2PVX A;  1NFV A;  3AF7 X;  3F37 A;  2F7N A;  2V2P A;  3UOF A;  2MS3 A;  5JKM A;  3NP0 X;  5D8R A;  1B71 A;  2V2I A;  3BVE A;  4REU A;  5D8S A;  2FFX J;  3KA6 A;  1H7V A;  3O7R A;  1HRS A;  4DZ0 A;  4DYZ A;  5AXS A;  2YJJ A;  4RC5 B;  3E1O A;  4XKU A;  4TW3 A;  3R2S A;  1RWD A;  3KYX A;  5E1U A;  4DYX A;  3R2H A;  4KVR A;  2V2M A;  1LTL A;  4POF A;  3WVW A;  2CHI A;  4IWK A;  1NF4 A;  4RC7 B;  1SQ3 A;  5LG8 A;  3BVK A;  4TOD A;  5FFD A;  2BJY A;  2OH3 A;  1T9P A;  3ES3 A;  3PVY B;  3F33 A;  3EZU A;  1R0G A;  4TOG A;  5GU0 X;  1S30 A;  2FG4 A;  7RXN A;  4LPM A;  4CMY V;  3NP2 X;  3QZ3 A;  1IER A;  1JTS A;  3UOI A;  3E1L A;  2PYA A;  1QCV A;  1R0J A;  2ITB A;  2C41 A;  4Z3B A;  3Q4R A;  4ZL6 A;  3RZ6 A;  4CY9 A;  1TKO A;  1R03 A;  2YJK A;  2CHP A;  2Z5Q A;  3RZT A;  2CLB A;  3PVT B;  4YWL A;  4IWJ A;  3E2C A;  5K53 A;  4ITT A;  3UNO A;  1B13 A;  2PYB A;  3BVF A;  4CVP A;  3PVR A;  5GU3 X;  3RE7 A;  5LBH A;  2C2J A;  2RBD A;  5RXN A;  4PG1 A;  5J8W A;  1IU5 A;  3F36 A;  3IS7 A;  5JKM G;  2XGW A;  3IS8 A;  4EVE A;  4TOE A;  4ML5 A;  3HL1 A;  5HJH A;  2FZF A;  3KYV A;  5ERK A;  2GYD A;  3BKN A;  3Q4Q A;  3R2L A;  1KRQ A;  3EZ0 A;  3TA8 A;  4CMY A;  1Z4A A;  1UVH A;  2BW1 A;  3RD0 A;  4LPN A;  3PW8 C;  4LQH A;  1R0F A;  1L8H A;  2V2O A;  5D8Y A;  2M4Y A;  3E6S A;  3KXU A;  4ISM A;  3GE4 A;  1VJX A;  1JI4 A;  4TO9 A;  5GU1 X;  2KN9 A;  2G4H A;  5E2D A;  3KYU A;  3PW1 A;  1S24 A;  2X17 0;  4ZKX A;  3SID A;  3PVR B;  4P18 A;  1JGC A;  4M35 A;  3IQ1 A;  4AR6 A;  5AI2 A;  1VEI A;  4QUW A;  3R2K A;  4MN9 A;  4K9F A;  4EVB A;  5GU2 X;  4DE6 A;  1FHA A;  1BE7 A;  3VNX A;  4TOC A;  2Y3Q A;  4E6K A;  5FFC A;  1CAD A;  3QD8 A;  1YK4 A;  2WTL A;  1H96 A;  4MY7 A;  3E6R A;  4ZKH A;  2ZA8 A;  1FHH A;  3QVD A;  4TOA A;  1RCD A;  1VEQ A;  3U90 A;  5ERJ A;  2ZG9 X;  1RCI A;  2FG8 A;  4XKT A;  1NNQ A;  1LKO A;  3ERZ A;  1S2Z A;  3SH6 A;  1BG7 A;  3WVU A;  4DYU A;  1RCE A;  1ZRP A;  4ZLW A;  2GMG A;  1QYB A;  3WNW A;  3E1J A;  3PW1 B;  3RAV A;  4LYX A;  2XJM A;  2RDV A;  5J9V A;  1LKP A;  4II4 B;  1TKP A;  2V15 A;  4AM4 A;  1R0H A;  4CYB A;  1YUZ A;  5LS9 A;  4CVR A;  2VXI A;  1JYB A;  3FVB A;  3QHC A;  2FL0 A;  3R2M A;  1ZUJ A;  1BCF A;  1VCX A;  4MJY A;  3PWQ C;  1R0I A;  4EVD A;  1SMW A;  3KA3 A;  1RB9 A;  4ETR A;  5JKL A;  1JRE A;  3AJQ A;  5FFB A;  3FSE A;  2VL6 A;  3F35 A;  4PG0 A;  2IU2 A;  2ZUR X;  3A44 A;  4XGS A;  3GVY A;  4OYN A;  2C6R A;  1BRF A;  5J8S A;  4TPU A;  2XKQ A;  1MOJ A;  3A68 A;  3H7G A;  4CVT A;  2W0O A;  1UMN A;  2CLU A;  5FEJ A;  5CZU A;  2YW7 A;  3AJO A;  2OC5 A;  4ZTT A;  4DI0 A;  6RXN A;  5HQO A;  2Z5P A;  1XZ3 A;  1F30 A;  4LQN A;  5D8P A;  3E1N A;  1IES A;  2ZA7 A;  3AK9 A;  4XKS A;  1O9I A;  2QQY A;  3PW8 A;  5FFA A;  1GWG A;  1XZ1 A;  3A9Q A;  1L8I A;  4KVQ A;  2IB0 A;  1B2O A; 
#chains in the Genus database with same CATH topology
 1JKU A;  2CN7 A;  2XJT A;  4LHN A;  3RZO L;  2C6A A;  2HR5 A;  2BK6 A;  2WB1 P;  4TOB A;  5AI3 A;  2C6B A;  1PFV A;  5M3M L;  5GN8 A;  2BE5 D;  1Z6O A;  4RXN A;  3NFP I;  5GAD c;  2L0Z A;  3PKI A;  4AI3 A;  2UX1 A;  3FI6 A;  2AQC A;  5JDO A;  8RXN A;  2R7Z L;  1YUX A;  2YW6 A;  3WVV A;  5EIO C;  4AR4 A;  2JA8 L;  1RDG A;  2GYQ A;  4EVC A;  3M6J A;  2Z6M A;  2Y0S P;  4ZN3 B;  1JKV A;  2Z5R A;  4M34 A;  3ISE A;  1VLG A;  5DM7 1;  3F34 A;  2FKZ A;  1ZS3 A;  4CYA A;  3HOV L;  2DSX A;  1E8J A;  5JKL G;  2NVY L;  5C6F A;  3LWV B;  1NF6 A;  3GGZ A;  5D8Q A;  3H3V M;  4KXR B;  3CQZ L;  2JD8 0;  2VZB A;  2XJU A;  1VZH A;  2BKC A;  3IU3 I;  3F38 A;  3HKZ P;  4LHL A;  1RCG A;  1F33 A;  4BY7 L;  3KWO A;  1TK6 A;  5HJF A;  4PGI A;  3JR7 A;  1PFU A;  4U3G A;  3BVI A;  1IRN A;  3FKI L;  4AR3 A;  2GS4 A;  4AM2 A;  4A93 L;  1BFR A;  1B2J A;  3KA4 A;  2HTN A;  4ZJK A;  3H9C A;  3J7Y 1;  2V3B B;  2PVE A;  4YKH A;  5I4J A;  4RC8 A;  1SOF A;  4YWM A;  2V8T A;  1IRO A;  4BBR L;  2VXX A;  3F32 A;  2D5K A;  2ZG8 X;  5JDO B;  2R93 L;  2ZG7 X;  1T9Q A;  4AI1 A;  1OWB A;  4A25 A;  2IY4 A;  4ZMC A;  1OTK A;  3H0G L;  2VUM L;  2M4V A;  5J93 A;  1Z92 B;  3S1N L;  3E1M A;  4CVS A;  3AK8 A;  4C3H L;  1RYT A;  2CKC A;  5K2M E;  3PWQ A;  5CMR A;  4ISP A;  2Y44 A;  3Q4N A;  3RGD A;  1IU6 A;  3PVT A;  4ME3 A;  5LG2 A;  3K35 A;  3E1P A;  3NOZ X;  3Q4O A;  5H1S c;  5IY0 A;  4LQJ A;  2V0F A;  1JIG A;  3GHQ A;  1Y1W L;  2LCQ A;  1S3Q A;  1LKM A;  4JAF A;  2JD6 0;  3WWN B;  2M6P A;  3SS2 A;  5IX6 A;  2V2J A;  2K2D A;  3N6O A;  5JAC A;  3LKD A;  3KYW A;  3K7A L;  3R2O A;  2V0E A;  4A3E L;  4ITW A;  3GTQ L;  3PL5 A;  1EUM A;  2WLA A;  1J30 A;  3MPS A;  3SHX A;  1QGH A;  4ZL5 A;  5MFZ A;  4BBS L;  1I3Q L;  2WLU A;  1DPS A;  3F39 A;  1TJO A;  1C09 A;  4U67 1;  5JVH 1;  5MGN A;  3QB9 A;  3RYG A;  4BY1 L;  2CEI A;  1BQ8 A;  2XJN A;  1N1Q A;  3H99 A;  1YV1 A;  3T9J A;  4A3I L;  5GAG c;  3KA8 A;  3BVL A;  3QQC E;  3GGY A;  4LPJ A;  4AM5 A;  3KYY A;  1I6H L;  3HJY B;  3OGH A;  2FJC A;  3KX9 A;  5IYC L;  4RC6 A;  3PWF A;  2C2U A;  2JA7 L;  2O5J D;  4C2M 1;  2MGY A;  1JI5 A;  1T9O A;  3PO2 L;  4Y7N L;  4TOH A;  1SMU A;  3GTL L;  3KA9 A;  3AJP A;  3EGM A;  1IW7 D;  3PIP 1;  2V2S A;  2CN6 A;  1CAA A;  4A3D L;  2JA6 L;  5GAE c;  3E1Q A;  5FJ8 L;  2V2R A;  1DX8 A;  4IXK A;  1DVB A;  1LB3 A;  2CF7 A;  3RBC A;  5GOU A;  2C2F A;  5D8X A;  1K83 L;  2JA5 L;  2FHA A;  2CIH A;  3FRS A;  4DYY A;  2Z90 A;  4ZKW A;  1SMM A;  4DAS A;  2J9U B;  2QL0 A;  4Y08 A;  4A3K L;  3S17 L;  3HIU A;  2ZA6 A;  3GTJ L;  1FHM A;  3S1M L;  4LYU A;  1BQ9 A;  3C21 A;  3PZA A;  4B8C D;  5FFE A;  1WJV A;  3OJ5 A;  2AR0 A;  2V2L A;  4AR5 A;  3LWO B;  2AUS B;  3R2R A;  1Z6O M;  4M32 A;  2V2N A;  4Z5S A;  1Y1V L;  4MKU A;  2JD7 0;  1RDV A;  1O9R A;  3V3K B;  4POG A;  4R42 A;  1RCC A;  1PFY A;  1MFR A;  4A3C L;  2B5I D;  2WWX B;  2XJP A;  3O7S A;  4M33 A;  2G38 B;  4YVZ A;  3HOX L;  4KVS A;  3QHB A;  4ERU A;  1NXG A;  4RC5 A;  4RC6 B;  3S2H L;  4MUD A;  5C44 L;  3P2A A;  1VEL A;  1YK5 A;  5D8O A;  4AI2 A;  4YXM A;  3LWR B;  1DAT A;  4II4 A;  4WFN 1;  2XJO A;  5HU6 D;  3SE1 A;  3AF9 X;  3HJW B;  2E2H L;  4RC7 A;  1AEW A;  2E2J L;  3AF8 X;  1PFW A;  4TOF A;  5K52 A;  1I50 L;  1BFY A;  5GN8 B;  3ISF A;  4LQV A;  3PVY A;  1TWA L;  2A6H D;  2QF9 A;  5MF6 A;  2KKD A;  3BT5 A;  4PGK A;  2NVT L;  5CMQ A;  2H12 A;  3M4O L;  3MQK B;  2PVX A;  1NFV A;  2XJV A;  3AF7 X;  3F37 A;  2F7N A;  2V2P A;  3UOF A;  2MS3 A;  5AN9 H;  5JKM A;  3PIO 1;  3VV9 A;  3NP0 X;  3FRR A;  5D8R A;  1TWG L;  5C4J L;  1B71 A;  2V2I A;  3MSU A;  3BVE A;  3KDQ A;  4REU A;  1NXE A;  5D8S A;  2FFX J;  4GS7 D;  3KA6 A;  3C23 A;  2XJS A;  5M5Y L;  1H7V A;  3O7R A;  5M3F L;  1WCM L;  2Z3Q B;  3GTK L;  1HRS A;  1F4L A;  2N02 A;  5M5X L;  4DZ0 A;  2PSM C;  4DYZ A;  5AXS A;  4AI0 A;  4W4L B;  4A3G L;  3J7Z 1;  2YJJ A;  4RC5 B;  3E1O A;  1VZG A;  4XKU A;  4TW3 A;  3R2S A;  1RWD A;  3KYX A;  5E1U A;  1P7P A;  4DYX A;  3R2H A;  4KVR A;  2V2M A;  1LTL A;  4POF A;  3WVW A;  2CHI A;  4IWK A;  5FLM L;  1NF4 A;  4RC7 B;  1SQ3 A;  5LG8 A;  3BVK A;  4TOD A;  5FFD A;  4AHZ A;  2ZIX A;  2BJY A;  2OH3 A;  2ERS A;  1T9P A;  3ES3 A;  3PVY B;  3F33 A;  3EZU A;  1R0G A;  4TOG A;  5GU0 X;  1S30 A;  2FG4 A;  7RXN A;  4LPM A;  3UFB A;  4CMY V;  4JAG A;  4C3I L;  1QQT A;  3NP2 X;  2M6O A;  3QZ3 A;  1IER A;  4YXJ A;  3M3Y L;  1JTS A;  5EIN C;  3UOI A;  1ODH A;  3E1L A;  5C3E L;  2PYA A;  1PZX A;  1QCV A;  1R0J A;  2ITB A;  3HOZ L;  2RFK B;  2A69 D;  2CKA A;  4A3L L;  2C41 A;  4QIW P;  4Z3B A;  3Q4R A;  4ZL6 A;  3RZ6 A;  3S1Q L;  4JAD A;  4CY9 A;  1TKO A;  1R03 A;  2YJK A;  2CHP A;  5MFP A;  2Z5Q A;  3RZT A;  2CLB A;  3PVT B;  4YWL A;  4IWJ A;  3E2C A;  3HAX C;  5K53 A;  4C3J L;  4ITT A;  3UNO A;  1B13 A;  4AHX A;  2PYB A;  3BVF A;  2R92 L;  4CVP A;  3PVR A;  5GU3 X;  3RE7 A;  5LBH A;  2C2J A;  2RBD A;  4MXP A;  5IP9 L;  5RXN A;  2OKC A;  4PG1 A;  3GTO L;  4V19 6;  5J8W A;  2JI1 A;  1IU5 A;  3F36 A;  3IS7 A;  3WWL A;  2B63 L;  3B0A B;  5JKM G;  2XGW A;  3IS8 A;  2ERJ A;  3ZG6 A;  2NVQ L;  4EVE A;  3LWP B;  3HOU L;  4XXB B;  4TOE A;  3VPB E;  4ML5 A;  3HL1 A;  2EY4 E;  5HJH A;  2FZF A;  3KYV A;  5ERK A;  2GYD A;  3BKN A;  3Q4Q A;  3R2L A;  1KRQ A;  4ZN1 B;  3EZ0 A;  3TA8 A;  4CMY A;  2A6E D;  1Z4A A;  5IYB L;  5MLC 3;  1UVH A;  2BW1 A;  3RD0 A;  4LPN A;  3PW8 C;  4LQH A;  1R0F A;  4A3B L;  1L8H A;  2V2O A;  4XGH A;  5D8Y A;  2M4Y A;  2PMZ P;  5JVG 1;  3E6S A;  2A68 D;  1R9T L;  4UY8 1;  2CR8 A;  3KXU A;  4ISM A;  3HOW L;  3C1Y A;  3GE4 A;  3PO3 L;  1VJX A;  1JI4 A;  4TO9 A;  5GU1 X;  2PPT A;  2KN9 A;  2G4H A;  5E2D A;  3KYU A;  4A3J L;  3PW1 A;  1S24 A;  2NVX L;  2X17 0;  4ZKX A;  3SID A;  1TWF L;  3PVR B;  4P18 A;  1JGC A;  4M35 A;  2HVY C;  2APO B;  3IQ1 A;  4AR6 A;  3DBY A;  3GTP L;  5AI2 A;  1VEI A;  4QUW A;  3R2K A;  4MN9 A;  4K9F A;  4EVB A;  5GU2 X;  4DE6 A;  1FHA A;  1BE7 A;  3LNL A;  3L0M A;  3VNX A;  3S14 L;  4TOC A;  2Y3Q A;  3P8B A;  4E6K A;  5FFC A;  1CAD A;  3QD8 A;  1YK4 A;  3I4M L;  2WTL A;  1H96 A;  4MY7 A;  3E6R A;  4ZKH A;  3JZ9 A;  2ZA8 A;  1FHH A;  3QVD A;  4TOA A;  1RCD A;  1VEQ A;  3U90 A;  5ERJ A;  2E2I L;  2ZG9 X;  1RCI A;  3LWQ B;  3H97 A;  2FG8 A;  4XKT A;  1NNQ A;  5DM6 1;  1LKO A;  3ERZ A;  1S2Z A;  2AYJ A;  3GTG L;  3SH6 A;  1BG7 A;  4E40 A;  3WVU A;  4DYU A;  1RCE A;  3C1Z A;  1ZRP A;  4ZLW A;  2GMG A;  4AHW A;  1OWC A;  1QYB A;  3WNW A;  3E1J A;  4Y52 L;  3PW1 B;  3RAV A;  4E6Y A;  3RZD L;  4LYX A;  2XJM A;  2RDV A;  3GTM L;  5J9V A;  1SFO L;  1LKP A;  4II4 B;  1TKP A;  2V15 A;  4AM4 A;  1R0H A;  4CYB A;  1YUZ A;  5LS9 A;  4CVR A;  2VXI A;  1JYB A;  3FVB A;  3QHC A;  2NYD A;  2FL0 A;  2XJR A;  3R2M A;  1ZUJ A;  3HOY L;  1BCF A;  4G6B A;  5IP7 L;  3JZA B;  2JI3 A;  1VCX A;  4MJY A;  3PWQ C;  4AHY A;  1R0I A;  4EVD A;  3B08 B;  1SMW A;  4BXX L;  3KA3 A;  1RB9 A;  4ETR A;  5JKL A;  1JRE A;  3AJQ A;  3S16 L;  5FFB A;  3FSE A;  3KHK A;  4A3F L;  2VL6 A;  2CWL A;  3H9B A;  4A3M L;  3F35 A;  4PG0 A;  2IU2 A;  2JI2 A;  2ZUR X;  3A44 A;  4XGS A;  1TWH L;  3GVY A;  4X0J A;  5M5W L;  4OYN A;  2C6R A;  1BRF A;  5J8S A;  5IYD L;  4X6A L;  4TPU A;  2XKQ A;  1MOJ A;  3A68 A;  3H7G A;  3FDJ A;  4CVT A;  3S1R L;  2W0O A;  4JAE A;  3I4N L;  3VVA A;  1TWC L;  1UMN A;  3W54 A;  2CLU A;  5FEJ A;  5CZU A;  3S15 L;  1RYQ A;  2Z3R B;  2YW7 A;  3AJO A;  2OC5 A;  2WAQ P;  4ZTT A;  4DI0 A;  4TVM A;  2V8U A;  5HQO A;  6RXN A;  3D19 A;  3LPE B;  2Z5P A;  4W4K B;  1XZ3 A;  3PKJ A;  1F30 A;  1VZI A;  5GAH c;  4LQN A;  5D8P A;  3E1N A;  1IES A;  2XJQ A;  2ZA7 A;  3AK9 A;  4XKS A;  1O9I A;  4AYB P;  2QQY A;  2YU9 L;  3PW8 A;  5FFA A;  1GWG A;  1XZ1 A;  3A9Q A;  1L8I A;  4KVQ A;  2IB0 A;  4WJG 4;  3S2D L;  5C4X L;  1B2O A; 
#chains in the Genus database with same CATH homology
 1JKU A;  2CN7 A;  2XJT A;  4LHN A;  2C6A A;  2HR5 A;  2BK6 A;  4TOB A;  5AI3 A;  2C6B A;  5GN8 A;  2BE5 D;  1Z6O A;  4RXN A;  3NFP I;  5GAD c;  2L0Z A;  3PKI A;  4AI3 A;  2UX1 A;  3FI6 A;  5JDO A;  8RXN A;  1YUX A;  2YW6 A;  3WVV A;  5EIO C;  4AR4 A;  1RDG A;  2GYQ A;  4EVC A;  3M6J A;  2Z6M A;  4ZN3 B;  1JKV A;  2Z5R A;  4M34 A;  3ISE A;  1VLG A;  5DM7 1;  3F34 A;  2FKZ A;  1ZS3 A;  4CYA A;  2DSX A;  1E8J A;  5JKL G;  5C6F A;  1NF6 A;  3GGZ A;  5D8Q A;  4KXR B;  2JD8 0;  2VZB A;  2XJU A;  1VZH A;  2BKC A;  3IU3 I;  3F38 A;  4LHL A;  1RCG A;  1F33 A;  3KWO A;  1TK6 A;  5HJF A;  4PGI A;  4U3G A;  3BVI A;  1IRN A;  4AR3 A;  2GS4 A;  4AM2 A;  1BFR A;  1B2J A;  3KA4 A;  2HTN A;  4ZJK A;  3J7Y 1;  2V3B B;  2PVE A;  4YKH A;  5I4J A;  4RC8 A;  1SOF A;  4YWM A;  2V8T A;  1IRO A;  2VXX A;  3F32 A;  2D5K A;  2ZG8 X;  5JDO B;  2ZG7 X;  1T9Q A;  4AI1 A;  1OWB A;  4A25 A;  2IY4 A;  4ZMC A;  1OTK A;  2M4V A;  5J93 A;  1Z92 B;  3E1M A;  4CVS A;  3AK8 A;  1RYT A;  2CKC A;  5K2M E;  3PWQ A;  5CMR A;  4ISP A;  2Y44 A;  3Q4N A;  3RGD A;  1IU6 A;  3PVT A;  4ME3 A;  5LG2 A;  3K35 A;  3E1P A;  3NOZ X;  3Q4O A;  5H1S c;  5IY0 A;  4LQJ A;  2V0F A;  1JIG A;  3GHQ A;  2LCQ A;  1S3Q A;  1LKM A;  4JAF A;  2JD6 0;  3WWN B;  2M6P A;  3SS2 A;  5IX6 A;  2V2J A;  2K2D A;  3N6O A;  5JAC A;  3LKD A;  3KYW A;  3R2O A;  2V0E A;  4ITW A;  1EUM A;  2WLA A;  1J30 A;  3MPS A;  3SHX A;  1QGH A;  4ZL5 A;  5MFZ A;  2WLU A;  1DPS A;  3F39 A;  1TJO A;  1C09 A;  4U67 1;  5JVH 1;  5MGN A;  3QB9 A;  3RYG A;  2CEI A;  1BQ8 A;  2XJN A;  1N1Q A;  1YV1 A;  3T9J A;  5GAG c;  3KA8 A;  3BVL A;  3QQC E;  3GGY A;  4LPJ A;  4AM5 A;  3KYY A;  3OGH A;  2FJC A;  3KX9 A;  4RC6 A;  3PWF A;  2C2U A;  2O5J D;  2MGY A;  1JI5 A;  1T9O A;  4TOH A;  1SMU A;  3KA9 A;  3AJP A;  3EGM A;  1IW7 D;  3PIP 1;  2V2S A;  2CN6 A;  1CAA A;  5GAE c;  3E1Q A;  1DX8 A;  2V2R A;  4IXK A;  1DVB A;  1LB3 A;  2CF7 A;  3RBC A;  5GOU A;  2C2F A;  5D8X A;  2FHA A;  2CIH A;  3FRS A;  4DYY A;  2Z90 A;  4ZKW A;  1SMM A;  4DAS A;  2J9U B;  2QL0 A;  4Y08 A;  3HIU A;  2ZA6 A;  1FHM A;  4LYU A;  1BQ9 A;  3C21 A;  3PZA A;  4B8C D;  5FFE A;  1WJV A;  3OJ5 A;  2AR0 A;  2V2L A;  4AR5 A;  3R2R A;  1Z6O M;  4M32 A;  2V2N A;  4Z5S A;  4MKU A;  2JD7 0;  1RDV A;  1O9R A;  3V3K B;  4POG A;  4R42 A;  1RCC A;  1MFR A;  2B5I D;  2WWX B;  2XJP A;  3O7S A;  4M33 A;  2G38 B;  4YVZ A;  4KVS A;  3QHB A;  4ERU A;  1NXG A;  4RC5 A;  4RC6 B;  4MUD A;  3P2A A;  1VEL A;  1YK5 A;  5D8O A;  4AI2 A;  4YXM A;  1DAT A;  4II4 A;  4WFN 1;  2XJO A;  5HU6 D;  3SE1 A;  3AF9 X;  4RC7 A;  1AEW A;  3AF8 X;  4TOF A;  5K52 A;  1BFY A;  5GN8 B;  3ISF A;  4LQV A;  3PVY A;  2A6H D;  2QF9 A;  5MF6 A;  2KKD A;  3BT5 A;  4PGK A;  5CMQ A;  2H12 A;  2PVX A;  1NFV A;  2XJV A;  3AF7 X;  3F37 A;  2F7N A;  2V2P A;  3UOF A;  2MS3 A;  5AN9 H;  5JKM A;  3PIO 1;  3VV9 A;  3NP0 X;  3FRR A;  5D8R A;  1B71 A;  2V2I A;  3MSU A;  3BVE A;  3KDQ A;  4REU A;  1NXE A;  5D8S A;  2FFX J;  4GS7 D;  3KA6 A;  3C23 A;  2XJS A;  1H7V A;  3O7R A;  2Z3Q B;  1HRS A;  2N02 A;  4DZ0 A;  2PSM C;  4DYZ A;  5AXS A;  4AI0 A;  4W4L B;  3J7Z 1;  2YJJ A;  4RC5 B;  3E1O A;  1VZG A;  4XKU A;  4TW3 A;  3R2S A;  1RWD A;  3KYX A;  5E1U A;  4DYX A;  3R2H A;  4KVR A;  2V2M A;  1LTL A;  4POF A;  3WVW A;  2CHI A;  4IWK A;  1NF4 A;  4RC7 B;  1SQ3 A;  5LG8 A;  3BVK A;  4TOD A;  5FFD A;  4AHZ A;  2ZIX A;  2BJY A;  2OH3 A;  2ERS A;  1T9P A;  3ES3 A;  3PVY B;  3F33 A;  3EZU A;  1R0G A;  4TOG A;  5GU0 X;  1S30 A;  2FG4 A;  7RXN A;  4LPM A;  3UFB A;  4CMY V;  4JAG A;  3NP2 X;  2M6O A;  3QZ3 A;  1IER A;  4YXJ A;  1JTS A;  5EIN C;  3UOI A;  1ODH A;  3E1L A;  2PYA A;  1QCV A;  1R0J A;  2ITB A;  2A69 D;  2CKA A;  2C41 A;  4Z3B A;  3Q4R A;  4ZL6 A;  3RZ6 A;  4JAD A;  4CY9 A;  1TKO A;  1R03 A;  2YJK A;  2CHP A;  5MFP A;  2Z5Q A;  3RZT A;  2CLB A;  3PVT B;  4YWL A;  4IWJ A;  3E2C A;  5K53 A;  4ITT A;  3UNO A;  1B13 A;  4AHX A;  2PYB A;  3BVF A;  4CVP A;  3PVR A;  5GU3 X;  3RE7 A;  5LBH A;  2C2J A;  2RBD A;  4MXP A;  5RXN A;  2OKC A;  4PG1 A;  4V19 6;  5J8W A;  2JI1 A;  1IU5 A;  3F36 A;  3IS7 A;  3WWL A;  3B0A B;  5JKM G;  2XGW A;  3IS8 A;  2ERJ A;  3ZG6 A;  4EVE A;  4XXB B;  4TOE A;  3VPB E;  4ML5 A;  3HL1 A;  5HJH A;  2FZF A;  3KYV A;  5ERK A;  2GYD A;  3BKN A;  3Q4Q A;  3R2L A;  1KRQ A;  4ZN1 B;  3EZ0 A;  3TA8 A;  4CMY A;  2A6E D;  1Z4A A;  5MLC 3;  1UVH A;  2BW1 A;  3RD0 A;  4LPN A;  3PW8 C;  4LQH A;  1R0F A;  1L8H A;  2V2O A;  4XGH A;  5D8Y A;  2M4Y A;  5JVG 1;  3E6S A;  2A68 D;  4UY8 1;  2CR8 A;  3KXU A;  4ISM A;  3C1Y A;  3GE4 A;  1VJX A;  1JI4 A;  4TO9 A;  5GU1 X;  2PPT A;  2KN9 A;  2G4H A;  5E2D A;  3KYU A;  3PW1 A;  1S24 A;  2X17 0;  4ZKX A;  3SID A;  3PVR B;  4P18 A;  1JGC A;  4M35 A;  3IQ1 A;  4AR6 A;  3DBY A;  5AI2 A;  1VEI A;  4QUW A;  3R2K A;  4MN9 A;  4K9F A;  4EVB A;  5GU2 X;  4DE6 A;  1FHA A;  1BE7 A;  3LNL A;  3L0M A;  3VNX A;  4TOC A;  2Y3Q A;  3P8B A;  4E6K A;  5FFC A;  1CAD A;  3QD8 A;  1YK4 A;  2WTL A;  1H96 A;  4MY7 A;  3E6R A;  4ZKH A;  3JZ9 A;  2ZA8 A;  1FHH A;  3QVD A;  4TOA A;  1RCD A;  1VEQ A;  3U90 A;  5ERJ A;  2ZG9 X;  1RCI A;  2FG8 A;  4XKT A;  1NNQ A;  5DM6 1;  1LKO A;  3ERZ A;  1S2Z A;  2AYJ A;  3SH6 A;  1BG7 A;  4E40 A;  3WVU A;  4DYU A;  1RCE A;  3C1Z A;  1ZRP A;  4ZLW A;  2GMG A;  4AHW A;  1OWC A;  1QYB A;  3WNW A;  3E1J A;  3PW1 B;  3RAV A;  4E6Y A;  4LYX A;  2XJM A;  2RDV A;  5J9V A;  1LKP A;  4II4 B;  1TKP A;  2V15 A;  4AM4 A;  1R0H A;  4CYB A;  1YUZ A;  5LS9 A;  4CVR A;  2VXI A;  1JYB A;  3FVB A;  3QHC A;  2NYD A;  2FL0 A;  2XJR A;  3R2M A;  1ZUJ A;  1BCF A;  4G6B A;  3JZA B;  2JI3 A;  1VCX A;  4MJY A;  3PWQ C;  4AHY A;  1R0I A;  4EVD A;  3B08 B;  1SMW A;  3KA3 A;  1RB9 A;  4ETR A;  5JKL A;  1JRE A;  3AJQ A;  5FFB A;  3FSE A;  3KHK A;  2VL6 A;  2CWL A;  3F35 A;  4PG0 A;  2IU2 A;  2JI2 A;  2ZUR X;  3A44 A;  4XGS A;  3GVY A;  4X0J A;  4OYN A;  2C6R A;  1BRF A;  5J8S A;  4TPU A;  2XKQ A;  1MOJ A;  3A68 A;  3H7G A;  4CVT A;  2W0O A;  4JAE A;  3VVA A;  1UMN A;  3W54 A;  2CLU A;  5FEJ A;  5CZU A;  1RYQ A;  2Z3R B;  2YW7 A;  3AJO A;  2OC5 A;  4ZTT A;  4DI0 A;  4TVM A;  2V8U A;  5HQO A;  6RXN A;  3D19 A;  3LPE B;  2Z5P A;  4W4K B;  1XZ3 A;  3PKJ A;  1F30 A;  1VZI A;  5GAH c;  4LQN A;  5D8P A;  3E1N A;  1IES A;  2XJQ A;  2ZA7 A;  3AK9 A;  4XKS A;  1O9I A;  2QQY A;  3PW8 A;  5FFA A;  1GWG A;  1XZ1 A;  3A9Q A;  1L8I A;  4KVQ A;  2IB0 A;  4WJG 4;  1B2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...