3PWFA

High resolution structure of the fully reduced form of rubrerythrin from p. furiosus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 63
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3pwfA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3pwfA02
4AR4A 4LPNA 2ZG9X 5GOUA 4DYZA 3F36A 4DYYA 1YK4A 1RB9A 3QVDA 5J93A 4MN9A 2QL0A 3RE7A 3QHCA 3PVTA 3F34A 4M32A 2PYAA 3NP2X 3E1QA 3RZ6A 2IB0A 2YJKA 1H7VA 4ZJKA 3PWQC 1JTSA 4EVDA 3E6RA 5FFAA 4Z5SA 3AF7X 1BQ8A 5JKLA 2Z5RA 2CLBA 3ISEA 1T9QA 2WLUA 5AI2A 5K53A 5FFCA 2ZG7X 1JREA 5D8YA 1SMUA 3O7SA 2WLAA 4P18A 2V2NA 3IS8A 1RYTA 2RDVA 5RXNA 1L8HA 4ITWA 3PWFA 2XKQA 5D8XA 3AK9A 4RC6A 5CZUA 3ERZA 3Q4QA 4AR3A 2FZFA 3BVEA 5JKLG 1LKOA 4IWJA 3SH6A 1T9OA 4TOCA 4ME3A 3TA8A 4CVRA 1VEIA 5E1UA 3E2CA 3RZTA 2GYDA 1NNQA 2VL6A 3BVLA 4ZL6A 2JD80 2C2FA 2ZA7A 4CVSA 2ZG8X 3IS7A 3AF8X 2GMGA 2FKZA 5J8SA 2M4YA 3FI6A 5GN8B 4MY7A 4TOHA 4ISMA 2Z6MA 1BFRA 1Z4AA 1L8IA 2C6RA 2WTLA 5LS9A 2BJYA 3F35A 2CN6A 4ERUA 1IROA 1LTLA 3KWOA 5GU3X 6RXNA 1LKPA 1R03A 1BG7A 2V3BB 1RCGA 2ZURX 4CMYA 5CMRA 4ZKWA 3UOFA 1O9RA 2QQYA 2FFXJ 2C41A 5FFDA 3EZUA 4E6KA 3PWQA 2HTNA 1MOJA 4M33A 2GS4A 3QD8A 4KVQA 3NOZX 5GU0X 3OJ5A 4CY9A 2V2MA 1RWDA 2OH3A 4Z3BA 1SMMA 3KYVA 3QB9A 4CVTA 2K2DA 1FHMA 5AXSA 4AM5A 2D5KA 3KA3A 2FG4A 3PW8A 4OYNA 3F32A 1C09A 2G4HA 5JACA 4LQJA 1ZUJA 1S3QA 5D8PA 1SQ3A 3KYWA 2PVXA 2KKDA 3KX9A 4TO9A 1JKVA 5HJFA 1DX8A 5IY0A 2YW6A 1O9IA 1QGHA 4U3GA 1FHHA 1BFYA 4YWMA 5LG2A 4LYUA 3KA6A 2HR5A 1OTKA 3OGHA 5I4JA 5IX6A 1NF4A 1DATA 2FG8A 4IWKA 4RC7B 3SS2A 4AM4A 1B2OA 3A68A 3Q4RA 3FVBA 4YKHA 1R0GA 5GN8A 4LQNA 4TOFA 1BCFA 5K52A 4IXKA 4XGSA 3E1MA 1FHAA 3BT5A 5ERKA 4Y08A 2V15A 5FFBA 5J9VA 2Y3QA 1VLGA 3H7GA 1CAAA 5D8OA 5E2DA 3RYGA 3PW8C 3U90A 1DVBA 1JGCA 3BVIA 3F38A 2W0OA 3WVWA 1H96A 3GHQA 3WNWA 1HRSA 1F30A 3EZ0A 1RCIA 1YV1A 2JD70 2CHIA 4K9FA 4XKSA 1DPSA 4CMYV 3BVKA 4II4B 7RXNA 3KYUA 4PG1A 5JKMA 3KYXA 3AJPA 1JI5A 4RXNA 3PVYB 3EGMA 2XJOA 1XZ1A 3AJOA 1IU6A 1N1QA 5GU2X 1XZ3A 3E1NA 2V2JA 3R2MA 2ITBA 4LYXA 2ZA6A 4RC8A 3E1PA 3SIDA 1VJXA 2YJJA 2BK6A 5JKMG 3RAVA 1BE7A 4EVBA 2V2SA 5J8WA 1JI4A 5D8RA 3BVFA 3O7RA 1JYBA 4RC7A 3T9JA 2JD60 3E1LA 3AJQA 1TKPA 2V2RA 4KVRA 2V2PA 3F33A 1S2ZA 1Z6OM 4REUA 5LBHA 4XKUA 3GVYA 4POFA 3R2SA 2DSXA 1QYBA 2V2IA 2CHPA 4LPMA 5ERJA 4POGA 4TOBA 1KRQA 4RC5B 3E6SA 3R2KA 4KVSA 3E1JA 2Z5PA 4DE6A 2CIHA 4LQHA 3UOIA 4DI0A 1UMNA 1TJOA 3A9QA 3ES3A 4LQVA 2V2LA 4TW3A 4A25A 2FJCA 5D8QA 1IERA 5HJHA 4ISPA 1RCCA 2C2UA 3R2HA 4DYUA 4TOEA 2FL0A 4II4A 3WVUA 4ZL5A 4M35A 1BQ9A 2V2OA 3QHBA 4XKTA 3VNXA 3PVYA 2CN7A 5C6FA 1ZS3A 1IU5A 2X170 4MJYA 3PW1B 4ZLWA 1VELA 2Z5QA 3F39A 5AI3A 2CEIA 4ZMCA 1AEWA 1LB3A 1VCXA 4MUDA 4ZKHA 1LKMA 4TODA 4AR6A 1NF6A 2FHAA 3F37A 5LG8A 3R2RA 3KYYA 4DASA 1B71A 4YWLA 1B13A 4TOGA 4PGIA 3MPSA 3PVRB 1CADA 3A44A 3KA4A 2CLUA 3R2OA 5GU1X 3SE1A 1RDGA 4MKUA 4EVCA 2RBDA 4CYAA 1MFRA 3UNOA 4PGKA 4CYBA 1F33A 3RGDA 1RCDA 3GE4A 8RXNA 1JIGA 3NP0X 3AF9X 3RBCA 2XGWA 3BKNA 1TKOA 2Z90A 1NFVA 1R0IA 4RC5A 5FFEA 1S30A 2VXXA 3KA9A 2CF7A 2ZA8A 1R0JA 3E1OA 4ITTA 1BRFA 1YUXA 4ETRA 1UVHA 2BW1A 3KXUA 1ZRPA 3IQ1A 3RD0A 3PVTB 4PG0A 1YUZA 2BKCA 4ML5A 2XJNA 2VXIA 4R42A 2LCQA 1RDVA 3HL1A 1E8JA 3QZ3A 1GWGA 2QF9A 2IU2A 1B2JA 3PW1A 4AR5A 2F7NA 3FSEA 1TK6A 1YK5A 4ZTTA 4TPUA 4RC6B 4CVPA 2KN9A 4DZ0A 3SHXA 5HQOA 4AM2A 1QCVA 4LPJA 3Q4OA 1RCEA 3AK8A 2YW7A 3KA8A 1S24A 3R2LA 1VEQA 2VZBA 3PZAA 2OC5A 3HIUA 3PVRA 2PVEA 1R0HA 2IY4A 1Z6OA 2MS3A 5CMQA 4DYXA 1SOFA 3Q4NA 2UX1A 1IRNA 1J30A 1R0FA 1T9PA 4M34A 2XJMA 1SMWA 3WVVA 1EUMA 2PYBA 4EVEA 2C2JA 1JKUA 4QUWA 1IESA 3ISFA 2GYQA 4TOAA 5FEJA 4ZKXA 5D8SA
chains in the Genus database with same CATH superfamily
4AR4A 4LPNA 2ZG9X 5GOUA 4DYZA 5JVH1 3F36A 4DYYA 1YK4A 1RB9A 3QVDA 4JADA 5GAEc 5J93A 4MN9A 2QL0A 2XJRA 3RE7A 4YXJA 3QHCA 3PVTA 3F34A 4M32A 2PYAA 3NP2X 2XJUA 3E1QA 3RZ6A 2IB0A 2YJKA 2CKCA 3GTGL 3S15L 4Y7NL 2Y0SP 1H7VA 4ZJKA 3PWQC 1JTSA 4EVDA 3HOYL 1F4LA 3E6RA 5FFAA 4Z5SA 3AF7X 3C1ZA 1BQ8A 3J7Y1 4LHNA 3RZOL 5JKLA 2Z5RA 2CLBA 1PFYA 3ISEA 4C3IL 1T9QA 2WLUA 5AI2A 5K53A 5FFCA 2NVTL 2ZG7X 1JREA 5D8YA 1SMUA 2JA5L 3O7SA 2WLAA 4P18A 2V2NA 4AHWA 3IS8A 1RYTA 4YXMA 1PFUA 5HU6D 2RDVA 5RXNA 1L8HA 3HOXL 2B63L 4ITWA 5M5WL 4U671 2V0FA 3PWFA 2XKQA 5D8XA 3AK9A 4RC6A 2C6BA 5CZUA 5C3EL 3ERZA 3S1ML 4V196 5EINC 3Q4QA 4A3IL 4JAGA 4AR3A 2FZFA 3BVEA 5JKLG 2Z3RB 3HOUL 1LKOA 4IWJA 3SH6A 1T9OA 4TOCA 1RYQA 4ME3A 4BXXL 5M5YL 3TA8A 4CVRA 1VEIA 5E1UA 3PL5A 3E2CA 3RZTA 2GYDA 1NNQA 2VL6A 3BVLA 4AI1A 3M6JA 3LWRB 4ZL6A 3LWOB 1NXGA 3WWNB 2JD80 2C2FA 2ZA7A 4CVSA 2ZG8X 3IS7A 3AF8X 2GMGA 3V3KB 2FKZA 5J8SA 4XGHA 2M6PA 2AQCA 2M4YA 3FI6A 1I50L 3S16L 5GN8B 4MY7A 4TOHA 4ISMA 2Z6MA 2JI2A 1BFRA 1Z4AA 1L8IA 2C6RA 2WTLA 3B0AB 5LS9A 2BJYA 3F35A 3H3VM 2CN6A 4ERUA 1IROA 1K83L 1LTLA 1R9TL 3KWOA 5GU3X 2JI3A 4GS7D 1LKPA 6RXNA 1R03A 3KDQA 5GAGc 3GTOL 1BG7A 2V3BB 1RCGA 3I4NL 2ZURX 4CMYA 3B08B 5CMRA 4X6AL 4ZKWA 4W4KB 3UOFA 2EY4E 1I6HL 1TWAL 5DM61 1O9RA 3VVAA 2QQYA 1PFWA 5MF6A 2FFXJ 2NVXL 1PFVA 4AHYA 4W4LB 2C41A 5FFDA 1VZHA 3EZUA 4E6KA 3S1QL 3PWQA 2HTNA 1MOJA 2OKCA 4M33A 2GS4A 4A3BL 3QD8A 5IP7L 4KVQA 3LPEB 3NOZX 5GU0X 1TWFL 4A3LL 3OJ5A 4CY9A 2V2MA 1RWDA 2OH3A 4Z3BA 1SMMA 3KYVA 2ZIXA 2G38B 3QB9A 4CVTA 2K2DA 4A3GL 1FHMA 5AXSA 4AM5A 3IU3I 2D5KA 5FLML 3PO2L 3KA3A 2FG4A 3PW8A 4OYNA 3F32A 1C09A 2R7ZL 2G4HA 2ERJA 5JACA 4LQJA 3MSUA 1ZUJA 3HAXC 4A3KL 3RZDL 1S3QA 4MXPA 4AI0A 5D8PA 1SQ3A 3K7AL 3KYWA 5JVG1 2PVXA 3H0GL 2KKDA 3KX9A 4TO9A 4BY7L 1JKVA 5HJFA 2CWLA 1DX8A 5IY0A 2JA6L 2PMZP 2NYDA 2YW6A 1O9IA 5M5XL 3L0MA 3PIO1 1QGHA 4U3GA 5H1Sc 1FHHA 1BFYA 4YWMA 5LG2A 4LYUA 3KA6A 2HR5A 4AHXA 2A69D 5DM71 1OTKA 5MFZA 3OGHA 3QQCE 5I4JA 5IX6A 1NF4A 1DATA 2FG8A 4IWKA 4RC7B 3SS2A 3M3YL 2V8TA 4AM4A 1B2OA 3A68A 3Q4RA 3FVBA 4YKHA 1R0GA 5GN8A 2XJSA 4LQNA 2XJPA 4TOFA 2RFKB 1BCFA 5K52A 4IXKA 4XGSA 3E1MA 3GTPL 1FHAA 3BT5A 2J9UB 5ERKA 1I3QL 3C1YA 4Y08A 2V15A 5FFBA 3PKJA 5J9VA 4E6YA 2Y3QA 3WWLA 4A3JL 1VLGA 3H7GA 1CAAA 5D8OA 2R93L 5E2DA 2V8UA 3RYGA 3PW8C 3U90A 1DVBA 1JGCA 4A3EL 5AN9H 3BVIA 3F38A 2W0OA 3WVWA 1H96A 4QIWP 3GHQA 4AYBP 5EIOC 1WJVA 3WNWA 2PPTA 1HRSA 1F30A 3EZ0A 1RCIA 1YV1A 2JD70 3S14L 2CHIA 3KHKA 4K9FA 1IW7D 4XKSA 1DPSA 4CMYV 3VPBE 3BVKA 4II4B 4XXBB 3KYUA 4PG1A 7RXNA 5JKMA 3M4OL 3KYXA 2B5ID 3AJPA 1JI5A 4RXNA 3PVYB 4WFN1 3EGMA 2XJOA 5MLC3 4WJG4 3S17L 2BE5D 4AI2A 1XZ1A 3AJOA 1IU6A 1N1QA 5GU2X 4JAFA 2WWXB 4TVMA 1NXEA 1XZ3A 4A3DL 3E1NA 2V2JA 3R2MA 3JZAB 2ITBA 3PO3L 5GADc 4LYXA 2ZA6A 4RC8A 3E1PA 3SIDA 1VJXA 2WB1P 2YJJA 3S2HL 3GTQL 2AYJA 2BK6A 4C3JL 5JKMG 2XJQA 3RAVA 1BE7A 4AHZA 4EVBA 3HJYB 2V2SA 5J8WA 1JI4A 3MQKB 2H12A 5D8RA 3GTML 3BVFA 3O7RA 1JYBA 3S1NL 2APOB 4RC7A 3T9JA 3NFPI 2JD60 3E1LA 3AJQA 1TKPA 2V2RA 2V2PA 3F33A 4KVRA 2YU9L 1S2ZA 1Z6OM 4G6BA 4REUA 3GTKL 5LBHA 5IYBL 4Y52L 4XKUA 3GVYA 4POFA 5IYCL 3R2SA 2DSXA 1QYBA 2JA7L 5GAHc 5MGNA 1VZGA 2V2IA 2CHPA 4LPMA 5ERJA 3HOZL 4POGA 4TOBA 1KRQA 4RC5B 3E6SA 3R2KA 4KVSA 2WAQP 3E1JA 3GGZA 3H99A 4C3HL 2Z5PA 4UY81 1PZXA 4DE6A 3I4ML 2CIHA 4LQHA 3UOIA 4DI0A 2L0ZA 2N02A 1UMNA 1TJOA 3A9QA 3ES3A 4LQVA 2V2LA 4A93L 3VV9A 4TW3A 4A25A 2FJCA 2O5JD 5D8QA 5IYDL 3W54A 3LWPB 1TWGL 1IERA 5HJHA 4ISPA 1RCCA 2C2UA 3R2HA 2AUSB 4DYUA 4TOEA 2FL0A 4II4A 3WVUA 4ZL5A 4M35A 3LWVB 1BQ9A 3P2AA 4E40A 2V2OA 3QHBA 4XKTA 3LWQB 3VNXA 3PVYA 2CN7A 5C6FA 1ZS3A 1IU5A 2X170 4MJYA 3PW1B 4ZLWA 2E2IL 3S1RL 3HOVL 3LKDA 1VELA 2Z5QA 3F39A 5AI3A 2CEIA 4ZMCA 1AEWA 1LB3A 3DBYA 1VCXA 3ZG6A 4MUDA 4ZKHA 2NVQL 3P8BA 1LKMA 4TODA 4AR6A 1NF6A 2FHAA 1SFOL 3F37A 4BBRL 3FRRA 3N6OA 5LG8A 3R2RA 3KYYA 3D19A 4DASA 2A6ED 1B71A 4YWLA 1B13A 4TOGA 4PGIA 1OWBA 3MPSA 3PVRB 2Y44A 4X0JA 3KA4A 1CADA 3A44A 2CLUA 3R2OA 5GU1X 3SE1A 5JDOB 1RDGA 4MKUA 2Z3QB 2HVYC 4EVCA 2M6OA 2RBDA 4CYAA 1MFRA 3UNOA 4PGKA 4CYBA 1F33A 3RGDA 4BY1L 1RCDA 1TWHL 3GE4A 3JR7A 5C4JL 8RXNA 1JIGA 5C44L 2A6HD 3NP0X 3HOWL 3AF9X 3RBCA 2XGWA 3BKNA 1TKOA 2Z90A 1NFVA 1VZIA 1R0IA 4RC5A 5FFEA 5C4XL 1S30A 4KXRB 2VXXA 3HKZP 3KA9A 2CF7A 2ZA8A 1R0JA 2AR0A 3E1OA 4ITTA 2A68D 1BRFA 3H9BA 1YUXA 3C21A 4ETRA 3FKIL 1UVHA 2BW1A 3KXUA 4B8CD 1ZRPA 3IQ1A 5IP9L 2JA8L 3RD0A 3J7Z1 3PVTB 4PG0A 1YUZA 2BKCA 4ML5A 2M4VA 2XJNA 4C2M1 5FJ8L 4YVZA 4A3CL 1ODHA 2VXIA 4R42A 2LCQA 1RDVA 3C23A 3HL1A 4LHLA 3K35A 1E8JA 3QZ3A 2E2JL 1GWGA 2QF9A 1QQTA 2IU2A 3PKIA 3LNLA 1B2JA 4JAEA 3PW1A 2MGYA 4AR5A 2F7NA 3FSEA 4ZN1B 1TK6A 2C6AA 3H9CA 1YK5A 4ZTTA 4TPUA 3S2DL 5M3FL 4RC6B 4CVPA 2KN9A 4DZ0A 3SHXA 2ERSA 5HQOA 2CR8A 4AM2A 2E2HL 1QCVA 3PIP1 2R92L 4A3FL 4LPJA 1WCML 3Q4OA 1RCEA 3AK8A 2XJVA 1Y1VL 2YW7A 3GTLL 3KA8A 3HJWB 4AI3A 1TWCL 3H97A 1S24A 3R2LA 1VEQA 2VZBA 3PZAA 2OC5A 3HIUA 3PVRA 2NVYL 2PVEA 1R0HA 2IY4A 5JDOA 4ZN3B 1Z6OA 3GTJL 2MS3A 3CQZL 5CMQA 4DYXA 1SOFA 2PSMC 3FDJA 5K2ME 4A3ML 3Q4NA 2UX1A 1IRNA 1J30A 1Z92B 5M3ML 1R0FA 1T9PA 4M34A 2XJMA 1SMWA 3WVVA 1Y1WL 5MFPA 1OWCA 1EUMA 2CKAA 2PYBA 4EVEA 2V0EA 2JI1A 2C2JA 1JKUA 2XJTA 1P7PA 4QUWA 1IESA 2VUML 3ISFA 3FRSA 2GYQA 3UFBA 4TOAA 3GGYA 3JZ9A 5FEJA 4BBSL 4ZKXA 5D8SA
chains in the Genus database with same CATH topology
4AR4A 4LPNA 2ZG9X 5GOUA 4DYZA 5JVH1 3F36A 4DYYA 1YK4A 1RB9A 3QVDA 4JADA 5GAEc 5J93A 4MN9A 2QL0A 2XJRA 3RE7A 4YXJA 3QHCA 3PVTA 3F34A 4M32A 2PYAA 3NP2X 2XJUA 3E1QA 3RZ6A 2IB0A 2YJKA 2CKCA 1H7VA 4ZJKA 3PWQC 1JTSA 4EVDA 3E6RA 5FFAA 4Z5SA 3AF7X 3C1ZA 1BQ8A 3J7Y1 4LHNA 5JKLA 2Z5RA 2CLBA 3ISEA 1T9QA 2WLUA 5AI2A 5K53A 5FFCA 2ZG7X 1JREA 5D8YA 1SMUA 3O7SA 2WLAA 4P18A 2V2NA 4AHWA 3IS8A 1RYTA 4YXMA 5HU6D 2RDVA 5RXNA 1L8HA 4ITWA 4U671 2V0FA 3PWFA 2XKQA 5D8XA 3AK9A 4RC6A 2C6BA 5CZUA 3ERZA 4V196 5EINC 3Q4QA 4JAGA 4AR3A 2FZFA 3BVEA 5JKLG 2Z3RB 1LKOA 4IWJA 3SH6A 1T9OA 4TOCA 1RYQA 4ME3A 3TA8A 4CVRA 1VEIA 5E1UA 3E2CA 3RZTA 2GYDA 1NNQA 2VL6A 3BVLA 4AI1A 3M6JA 4ZL6A 1NXGA 3WWNB 2JD80 2C2FA 2ZA7A 4CVSA 2ZG8X 3IS7A 3AF8X 2GMGA 3V3KB 2FKZA 5J8SA 4XGHA 2M6PA 2M4YA 3FI6A 5GN8B 4MY7A 4TOHA 4ISMA 2Z6MA 2JI2A 1BFRA 1Z4AA 1L8IA 2C6RA 2WTLA 3B0AB 5LS9A 2BJYA 3F35A 2CN6A 4ERUA 1IROA 1LTLA 3KWOA 5GU3X 2JI3A 4GS7D 1LKPA 6RXNA 1R03A 3KDQA 5GAGc 1BG7A 2V3BB 1RCGA 2ZURX 4CMYA 3B08B 5CMRA 4ZKWA 4W4KB 3UOFA 5DM61 1O9RA 3VVAA 2QQYA 5MF6A 2FFXJ 4AHYA 4W4LB 2C41A 5FFDA 1VZHA 3EZUA 4E6KA 3PWQA 2HTNA 1MOJA 2OKCA 4M33A 2GS4A 3QD8A 4KVQA 3LPEB 3NOZX 5GU0X 3OJ5A 4CY9A 2V2MA 1RWDA 2OH3A 4Z3BA 1SMMA 3KYVA 2ZIXA 2G38B 3QB9A 4CVTA 2K2DA 1FHMA 5AXSA 4AM5A 3IU3I 2D5KA 3KA3A 2FG4A 3PW8A 4OYNA 3F32A 1C09A 2G4HA 2ERJA 5JACA 4LQJA 3MSUA 1ZUJA 1S3QA 4MXPA 4AI0A 5D8PA 1SQ3A 3KYWA 5JVG1 2PVXA 2KKDA 3KX9A 4TO9A 1JKVA 5HJFA 2CWLA 1DX8A 5IY0A 2NYDA 2YW6A 1O9IA 3L0MA 3PIO1 1QGHA 4U3GA 5H1Sc 1FHHA 1BFYA 4YWMA 5LG2A 4LYUA 3KA6A 2HR5A 4AHXA 2A69D 5DM71 1OTKA 5MFZA 3OGHA 3QQCE 5I4JA 5IX6A 1NF4A 1DATA 2FG8A 4IWKA 4RC7B 3SS2A 2V8TA 4AM4A 1B2OA 3A68A 3Q4RA 3FVBA 4YKHA 1R0GA 5GN8A 2XJSA 4LQNA 2XJPA 4TOFA 1BCFA 5K52A 4IXKA 4XGSA 3E1MA 1FHAA 3BT5A 2J9UB 5ERKA 3C1YA 4Y08A 2V15A 5FFBA 3PKJA 5J9VA 4E6YA 2Y3QA 3WWLA 1VLGA 3H7GA 1CAAA 5D8OA 5E2DA 2V8UA 3RYGA 3PW8C 3U90A 1DVBA 1JGCA 5AN9H 3BVIA 3F38A 2W0OA 3WVWA 1H96A 3GHQA 5EIOC 1WJVA 3WNWA 2PPTA 1HRSA 1F30A 3EZ0A 1RCIA 1YV1A 2JD70 2CHIA 3KHKA 4K9FA 1IW7D 4XKSA 1DPSA 4CMYV 3VPBE 3BVKA 4II4B 4XXBB 3KYUA 4PG1A 7RXNA 5JKMA 3KYXA 2B5ID 3AJPA 1JI5A 4RXNA 3PVYB 4WFN1 3EGMA 2XJOA 5MLC3 4WJG4 2BE5D 4AI2A 1XZ1A 3AJOA 1IU6A 1N1QA 5GU2X 4JAFA 2WWXB 4TVMA 1NXEA 1XZ3A 3E1NA 2V2JA 3R2MA 3JZAB 2ITBA 5GADc 4LYXA 2ZA6A 4RC8A 3E1PA 3SIDA 1VJXA 2YJJA 2AYJA 2BK6A 5JKMG 2XJQA 3RAVA 1BE7A 4AHZA 4EVBA 2V2SA 5J8WA 1JI4A 2H12A 5D8RA 3BVFA 3O7RA 1JYBA 4RC7A 3T9JA 3NFPI 2JD60 3E1LA 3AJQA 1TKPA 2V2RA 2V2PA 3F33A 4KVRA 1S2ZA 1Z6OM 4G6BA 4REUA 5LBHA 4XKUA 3GVYA 4POFA 3R2SA 2DSXA 1QYBA 5GAHc 5MGNA 1VZGA 2V2IA 2CHPA 4LPMA 5ERJA 4POGA 4TOBA 1KRQA 4RC5B 3E6SA 3R2KA 4KVSA 3E1JA 3GGZA 4UY81 2Z5PA 4DE6A 2CIHA 4LQHA 3UOIA 4DI0A 2L0ZA 2N02A 1UMNA 1TJOA 3A9QA 3ES3A 4LQVA 2V2LA 3VV9A 4TW3A 4A25A 2FJCA 2O5JD 5D8QA 3W54A 1IERA 5HJHA 4ISPA 1RCCA 2C2UA 3R2HA 4DYUA 4TOEA 2FL0A 4II4A 3WVUA 4ZL5A 4M35A 1BQ9A 3P2AA 4E40A 2V2OA 3QHBA 4XKTA 3VNXA 3PVYA 2CN7A 5C6FA 1ZS3A 1IU5A 2X170 4MJYA 3PW1B 4ZLWA 3LKDA 1VELA 2Z5QA 3F39A 5AI3A 2CEIA 4ZMCA 1AEWA 1LB3A 3DBYA 1VCXA 3ZG6A 4MUDA 4ZKHA 3P8BA 1LKMA 4TODA 4AR6A 1NF6A 2FHAA 3F37A 3FRRA 3N6OA 5LG8A 3R2RA 3KYYA 3D19A 4DASA 2A6ED 1B71A 4YWLA 1B13A 4TOGA 4PGIA 1OWBA 3MPSA 3PVRB 2Y44A 4X0JA 3KA4A 1CADA 3A44A 2CLUA 3R2OA 5GU1X 3SE1A 5JDOB 1RDGA 4MKUA 2Z3QB 4EVCA 2M6OA 2RBDA 4CYAA 1MFRA 3UNOA 4PGKA 4CYBA 1F33A 3RGDA 1RCDA 3GE4A 8RXNA 1JIGA 2A6HD 3NP0X 3AF9X 3RBCA 2XGWA 3BKNA 1TKOA 2Z90A 1NFVA 1VZIA 1R0IA 4RC5A 5FFEA 1S30A 4KXRB 2VXXA 3KA9A 2CF7A 2ZA8A 1R0JA 2AR0A 3E1OA 4ITTA 2A68D 1BRFA 1YUXA 3C21A 4ETRA 1UVHA 2BW1A 3KXUA 4B8CD 1ZRPA 3IQ1A 3RD0A 3J7Z1 3PVTB 4PG0A 1YUZA 2BKCA 4ML5A 2M4VA 2XJNA 4YVZA 1ODHA 2VXIA 4R42A 2LCQA 1RDVA 3C23A 3HL1A 4LHLA 3K35A 1E8JA 3QZ3A 1GWGA 2QF9A 2IU2A 3PKIA 3LNLA 1B2JA 4JAEA 3PW1A 2MGYA 4AR5A 2F7NA 3FSEA 4ZN1B 1TK6A 2C6AA 1YK5A 4ZTTA 4TPUA 4RC6B 4CVPA 2KN9A 4DZ0A 3SHXA 2ERSA 5HQOA 2CR8A 4AM2A 1QCVA 3PIP1 4LPJA 3Q4OA 1RCEA 3AK8A 2XJVA 2YW7A 3KA8A 4AI3A 1S24A 3R2LA 1VEQA 2VZBA 3PZAA 2OC5A 3HIUA 3PVRA 2PVEA 1R0HA 2IY4A 5JDOA 4ZN3B 1Z6OA 2MS3A 5CMQA 4DYXA 1SOFA 2PSMC 5K2ME 3Q4NA 2UX1A 1IRNA 1J30A 1Z92B 1R0FA 1T9PA 4M34A 2XJMA 1SMWA 3WVVA 5MFPA 1OWCA 1EUMA 2CKAA 2PYBA 4EVEA 2V0EA 2JI1A 2C2JA 1JKUA 2XJTA 4QUWA 1IESA 3ISFA 3FRSA 2GYQA 3UFBA 4TOAA 3GGYA 3JZ9A 5FEJA 4ZKXA 5D8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AR4 A;  4LPN A;  2ZG9 X;  5GOU A;  4DYZ A;  3F36 A;  4DYY A;  1YK4 A;  1RB9 A;  3QVD A;  5J93 A;  4MN9 A;  2QL0 A;  3RE7 A;  3QHC A;  3PVT A;  3F34 A;  4M32 A;  2PYA A;  3NP2 X;  3E1Q A;  3RZ6 A;  2IB0 A;  2YJK A;  1H7V A;  4ZJK A;  3PWQ C;  1JTS A;  4EVD A;  3E6R A;  5FFA A;  4Z5S A;  3AF7 X;  1BQ8 A;  5JKL A;  2Z5R A;  2CLB A;  3ISE A;  1T9Q A;  2WLU A;  5AI2 A;  5K53 A;  5FFC A;  2ZG7 X;  1JRE A;  5D8Y A;  1SMU A;  3O7S A;  2WLA A;  4P18 A;  2V2N A;  3IS8 A;  1RYT A;  2RDV A;  5RXN A;  1L8H A;  4ITW A;  3PWF A;  2XKQ A;  5D8X A;  3AK9 A;  4RC6 A;  5CZU A;  3ERZ A;  3Q4Q A;  4AR3 A;  2FZF A;  3BVE A;  5JKL G;  1LKO A;  4IWJ A;  3SH6 A;  1T9O A;  4TOC A;  4ME3 A;  3TA8 A;  4CVR A;  1VEI A;  5E1U A;  3E2C A;  3RZT A;  2GYD A;  1NNQ A;  2VL6 A;  3BVL A;  4ZL6 A;  2JD8 0;  2C2F A;  2ZA7 A;  4CVS A;  2ZG8 X;  3IS7 A;  3AF8 X;  2GMG A;  2FKZ A;  5J8S A;  2M4Y A;  3FI6 A;  5GN8 B;  4MY7 A;  4TOH A;  4ISM A;  2Z6M A;  1BFR A;  1Z4A A;  1L8I A;  2C6R A;  2WTL A;  5LS9 A;  2BJY A;  3F35 A;  2CN6 A;  4ERU A;  1IRO A;  1LTL A;  3KWO A;  5GU3 X;  6RXN A;  1LKP A;  1R03 A;  1BG7 A;  2V3B B;  1RCG A;  2ZUR X;  4CMY A;  5CMR A;  4ZKW A;  3UOF A;  1O9R A;  2QQY A;  2FFX J;  2C41 A;  5FFD A;  3EZU A;  4E6K A;  3PWQ A;  2HTN A;  1MOJ A;  4M33 A;  2GS4 A;  3QD8 A;  4KVQ A;  3NOZ X;  5GU0 X;  3OJ5 A;  4CY9 A;  2V2M A;  1RWD A;  2OH3 A;  4Z3B A;  1SMM A;  3KYV A;  3QB9 A;  4CVT A;  2K2D A;  1FHM A;  5AXS A;  4AM5 A;  2D5K A;  3KA3 A;  2FG4 A;  3PW8 A;  4OYN A;  3F32 A;  1C09 A;  2G4H A;  5JAC A;  4LQJ A;  1ZUJ A;  1S3Q A;  5D8P A;  1SQ3 A;  3KYW A;  2PVX A;  2KKD A;  3KX9 A;  4TO9 A;  1JKV A;  5HJF A;  1DX8 A;  5IY0 A;  2YW6 A;  1O9I A;  1QGH A;  4U3G A;  1FHH A;  1BFY A;  4YWM A;  5LG2 A;  4LYU A;  3KA6 A;  2HR5 A;  1OTK A;  3OGH A;  5I4J A;  5IX6 A;  1NF4 A;  1DAT A;  2FG8 A;  4IWK A;  4RC7 B;  3SS2 A;  4AM4 A;  1B2O A;  3A68 A;  3Q4R A;  3FVB A;  4YKH A;  1R0G A;  5GN8 A;  4LQN A;  4TOF A;  1BCF A;  5K52 A;  4IXK A;  4XGS A;  3E1M A;  1FHA A;  3BT5 A;  5ERK A;  4Y08 A;  2V15 A;  5FFB A;  5J9V A;  2Y3Q A;  1VLG A;  3H7G A;  1CAA A;  5D8O A;  5E2D A;  3RYG A;  3PW8 C;  3U90 A;  1DVB A;  1JGC A;  3BVI A;  3F38 A;  2W0O A;  3WVW A;  1H96 A;  3GHQ A;  3WNW A;  1HRS A;  1F30 A;  3EZ0 A;  1RCI A;  1YV1 A;  2JD7 0;  2CHI A;  4K9F A;  4XKS A;  1DPS A;  4CMY V;  3BVK A;  4II4 B;  7RXN A;  3KYU A;  4PG1 A;  5JKM A;  3KYX A;  3AJP A;  1JI5 A;  4RXN A;  3PVY B;  3EGM A;  2XJO A;  1XZ1 A;  3AJO A;  1IU6 A;  1N1Q A;  5GU2 X;  1XZ3 A;  3E1N A;  2V2J A;  3R2M A;  2ITB A;  4LYX A;  2ZA6 A;  4RC8 A;  3E1P A;  3SID A;  1VJX A;  2YJJ A;  2BK6 A;  5JKM G;  3RAV A;  1BE7 A;  4EVB A;  2V2S A;  5J8W A;  1JI4 A;  5D8R A;  3BVF A;  3O7R A;  1JYB A;  4RC7 A;  3T9J A;  2JD6 0;  3E1L A;  3AJQ A;  1TKP A;  2V2R A;  4KVR A;  2V2P A;  3F33 A;  1S2Z A;  1Z6O M;  4REU A;  5LBH A;  4XKU A;  3GVY A;  4POF A;  3R2S A;  2DSX A;  1QYB A;  2V2I A;  2CHP A;  4LPM A;  5ERJ A;  4POG A;  4TOB A;  1KRQ A;  4RC5 B;  3E6S A;  3R2K A;  4KVS A;  3E1J A;  2Z5P A;  4DE6 A;  2CIH A;  4LQH A;  3UOI A;  4DI0 A;  1UMN A;  1TJO A;  3A9Q A;  3ES3 A;  4LQV A;  2V2L A;  4TW3 A;  4A25 A;  2FJC A;  5D8Q A;  1IER A;  5HJH A;  4ISP A;  1RCC A;  2C2U A;  3R2H A;  4DYU A;  4TOE A;  2FL0 A;  4II4 A;  3WVU A;  4ZL5 A;  4M35 A;  1BQ9 A;  2V2O A;  3QHB A;  4XKT A;  3VNX A;  3PVY A;  2CN7 A;  5C6F A;  1ZS3 A;  1IU5 A;  2X17 0;  4MJY A;  3PW1 B;  4ZLW A;  1VEL A;  2Z5Q A;  3F39 A;  5AI3 A;  2CEI A;  4ZMC A;  1AEW A;  1LB3 A;  1VCX A;  4MUD A;  4ZKH A;  1LKM A;  4TOD A;  4AR6 A;  1NF6 A;  2FHA A;  3F37 A;  5LG8 A;  3R2R A;  3KYY A;  4DAS A;  1B71 A;  4YWL A;  1B13 A;  4TOG A;  4PGI A;  3MPS A;  3PVR B;  1CAD A;  3A44 A;  3KA4 A;  2CLU A;  3R2O A;  5GU1 X;  3SE1 A;  1RDG A;  4MKU A;  4EVC A;  2RBD A;  4CYA A;  1MFR A;  3UNO A;  4PGK A;  4CYB A;  1F33 A;  3RGD A;  1RCD A;  3GE4 A;  8RXN A;  1JIG A;  3NP0 X;  3AF9 X;  3RBC A;  2XGW A;  3BKN A;  1TKO A;  2Z90 A;  1NFV A;  1R0I A;  4RC5 A;  5FFE A;  1S30 A;  2VXX A;  3KA9 A;  2CF7 A;  2ZA8 A;  1R0J A;  3E1O A;  4ITT A;  1BRF A;  1YUX A;  4ETR A;  1UVH A;  2BW1 A;  3KXU A;  1ZRP A;  3IQ1 A;  3RD0 A;  3PVT B;  4PG0 A;  1YUZ A;  2BKC A;  4ML5 A;  2XJN A;  2VXI A;  4R42 A;  2LCQ A;  1RDV A;  3HL1 A;  1E8J A;  3QZ3 A;  1GWG A;  2QF9 A;  2IU2 A;  1B2J A;  3PW1 A;  4AR5 A;  2F7N A;  3FSE A;  1TK6 A;  1YK5 A;  4ZTT A;  4TPU A;  4RC6 B;  4CVP A;  2KN9 A;  4DZ0 A;  3SHX A;  5HQO A;  4AM2 A;  1QCV A;  4LPJ A;  3Q4O A;  1RCE A;  3AK8 A;  2YW7 A;  3KA8 A;  1S24 A;  3R2L A;  1VEQ A;  2VZB A;  3PZA A;  2OC5 A;  3HIU A;  3PVR A;  2PVE A;  1R0H A;  2IY4 A;  1Z6O A;  2MS3 A;  5CMQ A;  4DYX A;  1SOF A;  3Q4N A;  2UX1 A;  1IRN A;  1J30 A;  1R0F A;  1T9P A;  4M34 A;  2XJM A;  1SMW A;  3WVV A;  1EUM A;  2PYB A;  4EVE A;  2C2J A;  1JKU A;  4QUW A;  1IES A;  3ISF A;  2GYQ A;  4TOA A;  5FEJ A;  4ZKX A;  5D8S A; 
#chains in the Genus database with same CATH topology
 4AR4 A;  4LPN A;  2ZG9 X;  5GOU A;  4DYZ A;  5JVH 1;  3F36 A;  4DYY A;  1YK4 A;  1RB9 A;  3QVD A;  4JAD A;  5GAE c;  5J93 A;  4MN9 A;  2QL0 A;  2XJR A;  3RE7 A;  4YXJ A;  3QHC A;  3PVT A;  3F34 A;  4M32 A;  2PYA A;  3NP2 X;  2XJU A;  3E1Q A;  3RZ6 A;  2IB0 A;  2YJK A;  2CKC A;  3GTG L;  3S15 L;  4Y7N L;  2Y0S P;  1H7V A;  4ZJK A;  3PWQ C;  1JTS A;  4EVD A;  3HOY L;  1F4L A;  3E6R A;  5FFA A;  4Z5S A;  3AF7 X;  3C1Z A;  1BQ8 A;  3J7Y 1;  4LHN A;  3RZO L;  5JKL A;  2Z5R A;  2CLB A;  1PFY A;  3ISE A;  4C3I L;  1T9Q A;  2WLU A;  5AI2 A;  5K53 A;  5FFC A;  2NVT L;  2ZG7 X;  1JRE A;  5D8Y A;  1SMU A;  2JA5 L;  3O7S A;  2WLA A;  4P18 A;  2V2N A;  4AHW A;  3IS8 A;  1RYT A;  4YXM A;  1PFU A;  5HU6 D;  2RDV A;  5RXN A;  1L8H A;  3HOX L;  2B63 L;  4ITW A;  5M5W L;  4U67 1;  2V0F A;  3PWF A;  2XKQ A;  5D8X A;  3AK9 A;  4RC6 A;  2C6B A;  5CZU A;  5C3E L;  3ERZ A;  3S1M L;  4V19 6;  5EIN C;  3Q4Q A;  4A3I L;  4JAG A;  4AR3 A;  2FZF A;  3BVE A;  5JKL G;  2Z3R B;  3HOU L;  1LKO A;  4IWJ A;  3SH6 A;  1T9O A;  4TOC A;  1RYQ A;  4ME3 A;  4BXX L;  5M5Y L;  3TA8 A;  4CVR A;  1VEI A;  5E1U A;  3PL5 A;  3E2C A;  3RZT A;  2GYD A;  1NNQ A;  2VL6 A;  3BVL A;  4AI1 A;  3M6J A;  3LWR B;  4ZL6 A;  3LWO B;  1NXG A;  3WWN B;  2JD8 0;  2C2F A;  2ZA7 A;  4CVS A;  2ZG8 X;  3IS7 A;  3AF8 X;  2GMG A;  3V3K B;  2FKZ A;  5J8S A;  4XGH A;  2M6P A;  2AQC A;  2M4Y A;  3FI6 A;  1I50 L;  3S16 L;  5GN8 B;  4MY7 A;  4TOH A;  4ISM A;  2Z6M A;  2JI2 A;  1BFR A;  1Z4A A;  1L8I A;  2C6R A;  2WTL A;  3B0A B;  5LS9 A;  2BJY A;  3F35 A;  3H3V M;  2CN6 A;  4ERU A;  1IRO A;  1K83 L;  1LTL A;  1R9T L;  3KWO A;  5GU3 X;  2JI3 A;  4GS7 D;  1LKP A;  6RXN A;  1R03 A;  3KDQ A;  5GAG c;  3GTO L;  1BG7 A;  2V3B B;  1RCG A;  3I4N L;  2ZUR X;  4CMY A;  3B08 B;  5CMR A;  4X6A L;  4ZKW A;  4W4K B;  3UOF A;  2EY4 E;  1I6H L;  1TWA L;  5DM6 1;  1O9R A;  3VVA A;  2QQY A;  1PFW A;  5MF6 A;  2FFX J;  2NVX L;  1PFV A;  4AHY A;  4W4L B;  2C41 A;  5FFD A;  1VZH A;  3EZU A;  4E6K A;  3S1Q L;  3PWQ A;  2HTN A;  1MOJ A;  2OKC A;  4M33 A;  2GS4 A;  4A3B L;  3QD8 A;  5IP7 L;  4KVQ A;  3LPE B;  3NOZ X;  5GU0 X;  1TWF L;  4A3L L;  3OJ5 A;  4CY9 A;  2V2M A;  1RWD A;  2OH3 A;  4Z3B A;  1SMM A;  3KYV A;  2ZIX A;  2G38 B;  3QB9 A;  4CVT A;  2K2D A;  4A3G L;  1FHM A;  5AXS A;  4AM5 A;  3IU3 I;  2D5K A;  5FLM L;  3PO2 L;  3KA3 A;  2FG4 A;  3PW8 A;  4OYN A;  3F32 A;  1C09 A;  2R7Z L;  2G4H A;  2ERJ A;  5JAC A;  4LQJ A;  3MSU A;  1ZUJ A;  3HAX C;  4A3K L;  3RZD L;  1S3Q A;  4MXP A;  4AI0 A;  5D8P A;  1SQ3 A;  3K7A L;  3KYW A;  5JVG 1;  2PVX A;  3H0G L;  2KKD A;  3KX9 A;  4TO9 A;  4BY7 L;  1JKV A;  5HJF A;  2CWL A;  1DX8 A;  5IY0 A;  2JA6 L;  2PMZ P;  2NYD A;  2YW6 A;  1O9I A;  5M5X L;  3L0M A;  3PIO 1;  1QGH A;  4U3G A;  5H1S c;  1FHH A;  1BFY A;  4YWM A;  5LG2 A;  4LYU A;  3KA6 A;  2HR5 A;  4AHX A;  2A69 D;  5DM7 1;  1OTK A;  5MFZ A;  3OGH A;  3QQC E;  5I4J A;  5IX6 A;  1NF4 A;  1DAT A;  2FG8 A;  4IWK A;  4RC7 B;  3SS2 A;  3M3Y L;  2V8T A;  4AM4 A;  1B2O A;  3A68 A;  3Q4R A;  3FVB A;  4YKH A;  1R0G A;  5GN8 A;  2XJS A;  4LQN A;  2XJP A;  4TOF A;  2RFK B;  1BCF A;  5K52 A;  4IXK A;  4XGS A;  3E1M A;  3GTP L;  1FHA A;  3BT5 A;  2J9U B;  5ERK A;  1I3Q L;  3C1Y A;  4Y08 A;  2V15 A;  5FFB A;  3PKJ A;  5J9V A;  4E6Y A;  2Y3Q A;  3WWL A;  4A3J L;  1VLG A;  3H7G A;  1CAA A;  5D8O A;  2R93 L;  5E2D A;  2V8U A;  3RYG A;  3PW8 C;  3U90 A;  1DVB A;  1JGC A;  4A3E L;  5AN9 H;  3BVI A;  3F38 A;  2W0O A;  3WVW A;  1H96 A;  4QIW P;  3GHQ A;  4AYB P;  5EIO C;  1WJV A;  3WNW A;  2PPT A;  1HRS A;  1F30 A;  3EZ0 A;  1RCI A;  1YV1 A;  2JD7 0;  3S14 L;  2CHI A;  3KHK A;  4K9F A;  1IW7 D;  4XKS A;  1DPS A;  4CMY V;  3VPB E;  3BVK A;  4II4 B;  4XXB B;  3KYU A;  4PG1 A;  7RXN A;  5JKM A;  3M4O L;  3KYX A;  2B5I D;  3AJP A;  1JI5 A;  4RXN A;  3PVY B;  4WFN 1;  3EGM A;  2XJO A;  5MLC 3;  4WJG 4;  3S17 L;  2BE5 D;  4AI2 A;  1XZ1 A;  3AJO A;  1IU6 A;  1N1Q A;  5GU2 X;  4JAF A;  2WWX B;  4TVM A;  1NXE A;  1XZ3 A;  4A3D L;  3E1N A;  2V2J A;  3R2M A;  3JZA B;  2ITB A;  3PO3 L;  5GAD c;  4LYX A;  2ZA6 A;  4RC8 A;  3E1P A;  3SID A;  1VJX A;  2WB1 P;  2YJJ A;  3S2H L;  3GTQ L;  2AYJ A;  2BK6 A;  4C3J L;  5JKM G;  2XJQ A;  3RAV A;  1BE7 A;  4AHZ A;  4EVB A;  3HJY B;  2V2S A;  5J8W A;  1JI4 A;  3MQK B;  2H12 A;  5D8R A;  3GTM L;  3BVF A;  3O7R A;  1JYB A;  3S1N L;  2APO B;  4RC7 A;  3T9J A;  3NFP I;  2JD6 0;  3E1L A;  3AJQ A;  1TKP A;  2V2R A;  2V2P A;  3F33 A;  4KVR A;  2YU9 L;  1S2Z A;  1Z6O M;  4G6B A;  4REU A;  3GTK L;  5LBH A;  5IYB L;  4Y52 L;  4XKU A;  3GVY A;  4POF A;  5IYC L;  3R2S A;  2DSX A;  1QYB A;  2JA7 L;  5GAH c;  5MGN A;  1VZG A;  2V2I A;  2CHP A;  4LPM A;  5ERJ A;  3HOZ L;  4POG A;  4TOB A;  1KRQ A;  4RC5 B;  3E6S A;  3R2K A;  4KVS A;  2WAQ P;  3E1J A;  3GGZ A;  3H99 A;  4C3H L;  2Z5P A;  4UY8 1;  1PZX A;  4DE6 A;  3I4M L;  2CIH A;  4LQH A;  3UOI A;  4DI0 A;  2L0Z A;  2N02 A;  1UMN A;  1TJO A;  3A9Q A;  3ES3 A;  4LQV A;  2V2L A;  4A93 L;  3VV9 A;  4TW3 A;  4A25 A;  2FJC A;  2O5J D;  5D8Q A;  5IYD L;  3W54 A;  3LWP B;  1TWG L;  1IER A;  5HJH A;  4ISP A;  1RCC A;  2C2U A;  3R2H A;  2AUS B;  4DYU A;  4TOE A;  2FL0 A;  4II4 A;  3WVU A;  4ZL5 A;  4M35 A;  3LWV B;  1BQ9 A;  3P2A A;  4E40 A;  2V2O A;  3QHB A;  4XKT A;  3LWQ B;  3VNX A;  3PVY A;  2CN7 A;  5C6F A;  1ZS3 A;  1IU5 A;  2X17 0;  4MJY A;  3PW1 B;  4ZLW A;  2E2I L;  3S1R L;  3HOV L;  3LKD A;  1VEL A;  2Z5Q A;  3F39 A;  5AI3 A;  2CEI A;  4ZMC A;  1AEW A;  1LB3 A;  3DBY A;  1VCX A;  3ZG6 A;  4MUD A;  4ZKH A;  2NVQ L;  3P8B A;  1LKM A;  4TOD A;  4AR6 A;  1NF6 A;  2FHA A;  1SFO L;  3F37 A;  4BBR L;  3FRR A;  3N6O A;  5LG8 A;  3R2R A;  3KYY A;  3D19 A;  4DAS A;  2A6E D;  1B71 A;  4YWL A;  1B13 A;  4TOG A;  4PGI A;  1OWB A;  3MPS A;  3PVR B;  2Y44 A;  4X0J A;  3KA4 A;  1CAD A;  3A44 A;  2CLU A;  3R2O A;  5GU1 X;  3SE1 A;  5JDO B;  1RDG A;  4MKU A;  2Z3Q B;  2HVY C;  4EVC A;  2M6O A;  2RBD A;  4CYA A;  1MFR A;  3UNO A;  4PGK A;  4CYB A;  1F33 A;  3RGD A;  4BY1 L;  1RCD A;  1TWH L;  3GE4 A;  3JR7 A;  5C4J L;  8RXN A;  1JIG A;  5C44 L;  2A6H D;  3NP0 X;  3HOW L;  3AF9 X;  3RBC A;  2XGW A;  3BKN A;  1TKO A;  2Z90 A;  1NFV A;  1VZI A;  1R0I A;  4RC5 A;  5FFE A;  5C4X L;  1S30 A;  4KXR B;  2VXX A;  3HKZ P;  3KA9 A;  2CF7 A;  2ZA8 A;  1R0J A;  2AR0 A;  3E1O A;  4ITT A;  2A68 D;  1BRF A;  3H9B A;  1YUX A;  3C21 A;  4ETR A;  3FKI L;  1UVH A;  2BW1 A;  3KXU A;  4B8C D;  1ZRP A;  3IQ1 A;  5IP9 L;  2JA8 L;  3RD0 A;  3J7Z 1;  3PVT B;  4PG0 A;  1YUZ A;  2BKC A;  4ML5 A;  2M4V A;  2XJN A;  4C2M 1;  5FJ8 L;  4YVZ A;  4A3C L;  1ODH A;  2VXI A;  4R42 A;  2LCQ A;  1RDV A;  3C23 A;  3HL1 A;  4LHL A;  3K35 A;  1E8J A;  3QZ3 A;  2E2J L;  1GWG A;  2QF9 A;  1QQT A;  2IU2 A;  3PKI A;  3LNL A;  1B2J A;  4JAE A;  3PW1 A;  2MGY A;  4AR5 A;  2F7N A;  3FSE A;  4ZN1 B;  1TK6 A;  2C6A A;  3H9C A;  1YK5 A;  4ZTT A;  4TPU A;  3S2D L;  5M3F L;  4RC6 B;  4CVP A;  2KN9 A;  4DZ0 A;  3SHX A;  2ERS A;  5HQO A;  2CR8 A;  4AM2 A;  2E2H L;  1QCV A;  3PIP 1;  2R92 L;  4A3F L;  4LPJ A;  1WCM L;  3Q4O A;  1RCE A;  3AK8 A;  2XJV A;  1Y1V L;  2YW7 A;  3GTL L;  3KA8 A;  3HJW B;  4AI3 A;  1TWC L;  3H97 A;  1S24 A;  3R2L A;  1VEQ A;  2VZB A;  3PZA A;  2OC5 A;  3HIU A;  3PVR A;  2NVY L;  2PVE A;  1R0H A;  2IY4 A;  5JDO A;  4ZN3 B;  1Z6O A;  3GTJ L;  2MS3 A;  3CQZ L;  5CMQ A;  4DYX A;  1SOF A;  2PSM C;  3FDJ A;  5K2M E;  4A3M L;  3Q4N A;  2UX1 A;  1IRN A;  1J30 A;  1Z92 B;  5M3M L;  1R0F A;  1T9P A;  4M34 A;  2XJM A;  1SMW A;  3WVV A;  1Y1W L;  5MFP A;  1OWC A;  1EUM A;  2CKA A;  2PYB A;  4EVE A;  2V0E A;  2JI1 A;  2C2J A;  1JKU A;  2XJT A;  1P7P A;  4QUW A;  1IES A;  2VUM L;  3ISF A;  3FRS A;  2GYQ A;  3UFB A;  4TOA A;  3GGY A;  3JZ9 A;  5FEJ A;  4BBS L;  4ZKX A;  5D8S A; 
#chains in the Genus database with same CATH homology
 4AR4 A;  4LPN A;  2ZG9 X;  5GOU A;  4DYZ A;  5JVH 1;  3F36 A;  4DYY A;  1YK4 A;  1RB9 A;  3QVD A;  4JAD A;  5GAE c;  5J93 A;  4MN9 A;  2QL0 A;  2XJR A;  3RE7 A;  4YXJ A;  3QHC A;  3PVT A;  3F34 A;  4M32 A;  2PYA A;  3NP2 X;  2XJU A;  3E1Q A;  3RZ6 A;  2IB0 A;  2YJK A;  2CKC A;  1H7V A;  4ZJK A;  3PWQ C;  1JTS A;  4EVD A;  3E6R A;  5FFA A;  4Z5S A;  3AF7 X;  3C1Z A;  1BQ8 A;  3J7Y 1;  4LHN A;  5JKL A;  2Z5R A;  2CLB A;  3ISE A;  1T9Q A;  2WLU A;  5AI2 A;  5K53 A;  5FFC A;  2ZG7 X;  1JRE A;  5D8Y A;  1SMU A;  3O7S A;  2WLA A;  4P18 A;  2V2N A;  4AHW A;  3IS8 A;  1RYT A;  4YXM A;  5HU6 D;  2RDV A;  5RXN A;  1L8H A;  4ITW A;  4U67 1;  2V0F A;  3PWF A;  2XKQ A;  5D8X A;  3AK9 A;  4RC6 A;  2C6B A;  5CZU A;  3ERZ A;  4V19 6;  5EIN C;  3Q4Q A;  4JAG A;  4AR3 A;  2FZF A;  3BVE A;  5JKL G;  2Z3R B;  1LKO A;  4IWJ A;  3SH6 A;  1T9O A;  4TOC A;  1RYQ A;  4ME3 A;  3TA8 A;  4CVR A;  1VEI A;  5E1U A;  3E2C A;  3RZT A;  2GYD A;  1NNQ A;  2VL6 A;  3BVL A;  4AI1 A;  3M6J A;  4ZL6 A;  1NXG A;  3WWN B;  2JD8 0;  2C2F A;  2ZA7 A;  4CVS A;  2ZG8 X;  3IS7 A;  3AF8 X;  2GMG A;  3V3K B;  2FKZ A;  5J8S A;  4XGH A;  2M6P A;  2M4Y A;  3FI6 A;  5GN8 B;  4MY7 A;  4TOH A;  4ISM A;  2Z6M A;  2JI2 A;  1BFR A;  1Z4A A;  1L8I A;  2C6R A;  2WTL A;  3B0A B;  5LS9 A;  2BJY A;  3F35 A;  2CN6 A;  4ERU A;  1IRO A;  1LTL A;  3KWO A;  5GU3 X;  2JI3 A;  4GS7 D;  1LKP A;  6RXN A;  1R03 A;  3KDQ A;  5GAG c;  1BG7 A;  2V3B B;  1RCG A;  2ZUR X;  4CMY A;  3B08 B;  5CMR A;  4ZKW A;  4W4K B;  3UOF A;  5DM6 1;  1O9R A;  3VVA A;  2QQY A;  5MF6 A;  2FFX J;  4AHY A;  4W4L B;  2C41 A;  5FFD A;  1VZH A;  3EZU A;  4E6K A;  3PWQ A;  2HTN A;  1MOJ A;  2OKC A;  4M33 A;  2GS4 A;  3QD8 A;  4KVQ A;  3LPE B;  3NOZ X;  5GU0 X;  3OJ5 A;  4CY9 A;  2V2M A;  1RWD A;  2OH3 A;  4Z3B A;  1SMM A;  3KYV A;  2ZIX A;  2G38 B;  3QB9 A;  4CVT A;  2K2D A;  1FHM A;  5AXS A;  4AM5 A;  3IU3 I;  2D5K A;  3KA3 A;  2FG4 A;  3PW8 A;  4OYN A;  3F32 A;  1C09 A;  2G4H A;  2ERJ A;  5JAC A;  4LQJ A;  3MSU A;  1ZUJ A;  1S3Q A;  4MXP A;  4AI0 A;  5D8P A;  1SQ3 A;  3KYW A;  5JVG 1;  2PVX A;  2KKD A;  3KX9 A;  4TO9 A;  1JKV A;  5HJF A;  2CWL A;  1DX8 A;  5IY0 A;  2NYD A;  2YW6 A;  1O9I A;  3L0M A;  3PIO 1;  1QGH A;  4U3G A;  5H1S c;  1FHH A;  1BFY A;  4YWM A;  5LG2 A;  4LYU A;  3KA6 A;  2HR5 A;  4AHX A;  2A69 D;  5DM7 1;  1OTK A;  5MFZ A;  3OGH A;  3QQC E;  5I4J A;  5IX6 A;  1NF4 A;  1DAT A;  2FG8 A;  4IWK A;  4RC7 B;  3SS2 A;  2V8T A;  4AM4 A;  1B2O A;  3A68 A;  3Q4R A;  3FVB A;  4YKH A;  1R0G A;  5GN8 A;  2XJS A;  4LQN A;  2XJP A;  4TOF A;  1BCF A;  5K52 A;  4IXK A;  4XGS A;  3E1M A;  1FHA A;  3BT5 A;  2J9U B;  5ERK A;  3C1Y A;  4Y08 A;  2V15 A;  5FFB A;  3PKJ A;  5J9V A;  4E6Y A;  2Y3Q A;  3WWL A;  1VLG A;  3H7G A;  1CAA A;  5D8O A;  5E2D A;  2V8U A;  3RYG A;  3PW8 C;  3U90 A;  1DVB A;  1JGC A;  5AN9 H;  3BVI A;  3F38 A;  2W0O A;  3WVW A;  1H96 A;  3GHQ A;  5EIO C;  1WJV A;  3WNW A;  2PPT A;  1HRS A;  1F30 A;  3EZ0 A;  1RCI A;  1YV1 A;  2JD7 0;  2CHI A;  3KHK A;  4K9F A;  1IW7 D;  4XKS A;  1DPS A;  4CMY V;  3VPB E;  3BVK A;  4II4 B;  4XXB B;  3KYU A;  4PG1 A;  7RXN A;  5JKM A;  3KYX A;  2B5I D;  3AJP A;  1JI5 A;  4RXN A;  3PVY B;  4WFN 1;  3EGM A;  2XJO A;  5MLC 3;  4WJG 4;  2BE5 D;  4AI2 A;  1XZ1 A;  3AJO A;  1IU6 A;  1N1Q A;  5GU2 X;  4JAF A;  2WWX B;  4TVM A;  1NXE A;  1XZ3 A;  3E1N A;  2V2J A;  3R2M A;  3JZA B;  2ITB A;  5GAD c;  4LYX A;  2ZA6 A;  4RC8 A;  3E1P A;  3SID A;  1VJX A;  2YJJ A;  2AYJ A;  2BK6 A;  5JKM G;  2XJQ A;  3RAV A;  1BE7 A;  4AHZ A;  4EVB A;  2V2S A;  5J8W A;  1JI4 A;  2H12 A;  5D8R A;  3BVF A;  3O7R A;  1JYB A;  4RC7 A;  3T9J A;  3NFP I;  2JD6 0;  3E1L A;  3AJQ A;  1TKP A;  2V2R A;  2V2P A;  3F33 A;  4KVR A;  1S2Z A;  1Z6O M;  4G6B A;  4REU A;  5LBH A;  4XKU A;  3GVY A;  4POF A;  3R2S A;  2DSX A;  1QYB A;  5GAH c;  5MGN A;  1VZG A;  2V2I A;  2CHP A;  4LPM A;  5ERJ A;  4POG A;  4TOB A;  1KRQ A;  4RC5 B;  3E6S A;  3R2K A;  4KVS A;  3E1J A;  3GGZ A;  4UY8 1;  2Z5P A;  4DE6 A;  2CIH A;  4LQH A;  3UOI A;  4DI0 A;  2L0Z A;  2N02 A;  1UMN A;  1TJO A;  3A9Q A;  3ES3 A;  4LQV A;  2V2L A;  3VV9 A;  4TW3 A;  4A25 A;  2FJC A;  2O5J D;  5D8Q A;  3W54 A;  1IER A;  5HJH A;  4ISP A;  1RCC A;  2C2U A;  3R2H A;  4DYU A;  4TOE A;  2FL0 A;  4II4 A;  3WVU A;  4ZL5 A;  4M35 A;  1BQ9 A;  3P2A A;  4E40 A;  2V2O A;  3QHB A;  4XKT A;  3VNX A;  3PVY A;  2CN7 A;  5C6F A;  1ZS3 A;  1IU5 A;  2X17 0;  4MJY A;  3PW1 B;  4ZLW A;  3LKD A;  1VEL A;  2Z5Q A;  3F39 A;  5AI3 A;  2CEI A;  4ZMC A;  1AEW A;  1LB3 A;  3DBY A;  1VCX A;  3ZG6 A;  4MUD A;  4ZKH A;  3P8B A;  1LKM A;  4TOD A;  4AR6 A;  1NF6 A;  2FHA A;  3F37 A;  3FRR A;  3N6O A;  5LG8 A;  3R2R A;  3KYY A;  3D19 A;  4DAS A;  2A6E D;  1B71 A;  4YWL A;  1B13 A;  4TOG A;  4PGI A;  1OWB A;  3MPS A;  3PVR B;  2Y44 A;  4X0J A;  3KA4 A;  1CAD A;  3A44 A;  2CLU A;  3R2O A;  5GU1 X;  3SE1 A;  5JDO B;  1RDG A;  4MKU A;  2Z3Q B;  4EVC A;  2M6O A;  2RBD A;  4CYA A;  1MFR A;  3UNO A;  4PGK A;  4CYB A;  1F33 A;  3RGD A;  1RCD A;  3GE4 A;  8RXN A;  1JIG A;  2A6H D;  3NP0 X;  3AF9 X;  3RBC A;  2XGW A;  3BKN A;  1TKO A;  2Z90 A;  1NFV A;  1VZI A;  1R0I A;  4RC5 A;  5FFE A;  1S30 A;  4KXR B;  2VXX A;  3KA9 A;  2CF7 A;  2ZA8 A;  1R0J A;  2AR0 A;  3E1O A;  4ITT A;  2A68 D;  1BRF A;  1YUX A;  3C21 A;  4ETR A;  1UVH A;  2BW1 A;  3KXU A;  4B8C D;  1ZRP A;  3IQ1 A;  3RD0 A;  3J7Z 1;  3PVT B;  4PG0 A;  1YUZ A;  2BKC A;  4ML5 A;  2M4V A;  2XJN A;  4YVZ A;  1ODH A;  2VXI A;  4R42 A;  2LCQ A;  1RDV A;  3C23 A;  3HL1 A;  4LHL A;  3K35 A;  1E8J A;  3QZ3 A;  1GWG A;  2QF9 A;  2IU2 A;  3PKI A;  3LNL A;  1B2J A;  4JAE A;  3PW1 A;  2MGY A;  4AR5 A;  2F7N A;  3FSE A;  4ZN1 B;  1TK6 A;  2C6A A;  1YK5 A;  4ZTT A;  4TPU A;  4RC6 B;  4CVP A;  2KN9 A;  4DZ0 A;  3SHX A;  2ERS A;  5HQO A;  2CR8 A;  4AM2 A;  1QCV A;  3PIP 1;  4LPJ A;  3Q4O A;  1RCE A;  3AK8 A;  2XJV A;  2YW7 A;  3KA8 A;  4AI3 A;  1S24 A;  3R2L A;  1VEQ A;  2VZB A;  3PZA A;  2OC5 A;  3HIU A;  3PVR A;  2PVE A;  1R0H A;  2IY4 A;  5JDO A;  4ZN3 B;  1Z6O A;  2MS3 A;  5CMQ A;  4DYX A;  1SOF A;  2PSM C;  5K2M E;  3Q4N A;  2UX1 A;  1IRN A;  1J30 A;  1Z92 B;  1R0F A;  1T9P A;  4M34 A;  2XJM A;  1SMW A;  3WVV A;  5MFP A;  1OWC A;  1EUM A;  2CKA A;  2PYB A;  4EVE A;  2V0E A;  2JI1 A;  2C2J A;  1JKU A;  2XJT A;  4QUW A;  1IES A;  3ISF A;  3FRS A;  2GYQ A;  3UFB A;  4TOA A;  3GGY A;  3JZ9 A;  5FEJ A;  4ZKX A;  5D8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...