3UOFA

Mycobacterium tuberculosis bacterioferritin, bfra
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
159
structure length
159
Chain Sequence
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Bacterioferritin
publication title Mycobacterium tuberculosis bacterioferritin, BfrA
rcsb
source organism Mycobacterium tuberculosis
total genus 68
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3uofA00
5D8PA 2FG8A 2OC5A 2HR5A 5GU2X 5E1UA 1KRQA 4DZ0A 1BFRA 3FI6A 4LQJA 4E6KA 1RYTA 2BKCA 4AM4A 2YJKA 2D5KA 3E1NA 4TODA 4YKHA 5J8WA 2ZURX 3E1QA 2C2JA 4TOGA 4DE6A 1QGHA 2C6RA 3E2CA 2Y3QA 2ZG8X 4ITTA 1TJOA 5D8RA 3KWOA 4CMYV 1F33A 3WVVA 4Z3BA 3R2SA 2BK6A 3RBCA 1LKOA 2F7NA 4DYXA 2Z5RA 2Z5PA 3Q4OA 2V2RA 5FFBA 2CN7A 2V2MA 2BW1A 1NF6A 5HJFA 1MOJA 3VNXA 3O7RA 3F39A 4REUA 4XKTA 4M33A 4M32A 5LS9A 3F35A 3PVTA 4DYUA 1FHAA 2GS4A 1QYBA 3AJOA 1XZ1A 5FEJA 1O9IA 3AK8A 5ERJA 3BVKA 5JKLA 3WNWA 1S2ZA 3EGMA 4LYXA 4KVSA 2OH3A 4II4B 1R03A 4MUDA 3T9JA 4IWJA 2CLBA 5ERKA 3RGDA 2WTLA 5GN8B 2C41A 4LYUA 3QHCA 1SOFA 3KA3A 5LBHA 2V2OA 1H96A 4A25A 2FJCA 2CLUA 5CMQA 1YV1A 2CHPA 3NOZX 3R2OA 3KA9A 4LQHA 3KA4A 5E2DA 2QQYA 2XJMA 1VEQA 4RC7A 1S30A 3F37A 2C2FA 3F38A 2JD80 4LQNA 1Z4AA 1L8HA 3A68A 4R42A 3AK9A 4OYNA 5FFEA 4CVRA 1NNQA 3R2HA 3KXUA 4RC6A 5D8YA 4RC7B 2V2IA 1JIGA 3PWQC 5GU3X 3GHQA 1DPSA 4DYZA 5J9VA 2YJJA 4QUWA 4P18A 5JKMA 5D8OA 4PGKA 2IY4A 4TOCA 3FSEA 3ISFA 3PVYA 1F30A 2ZA8A 4CVSA 5JKMG 1VEIA 4DYYA 4TOBA 2Z6MA 2W0OA 3PW1A 4DI0A 4CMYA 4ZKWA 5J8SA 2BJYA 1HRSA 1XZ3A 1JYBA 3GE4A 1JKVA 2CEIA 1RCIA 3IS7A 4ZKHA 5CMRA 1DVBA 4AM5A 4ZL6A 3Q4QA 4ISMA 1JI4A 1IESA 3BVLA 4ERUA 3PW1B 3R2LA 5J93A 2VXXA 2WLUA 3WVWA 1RCEA 3F36A 1VJXA 2FFXJ 1L8IA 4ZKXA 3OGHA 4TO9A 3SHXA 5HQOA 4CVPA 2X170 1JKUA 3MPSA 2FKZA 4CY9A 3BVIA 4PGIA 5HJHA 2XKQA 1JI5A 3RAVA 3BT5A 2XGWA 5FFDA 3PWQA 2ZA6A 3PVTB 4XKSA 4CVTA 3OJ5A 3HL1A 3Q4RA 3F32A 4EVBA 3PW8C 5K52A 3NP0X 4PG1A 3E1PA 2FZFA 1VLGA 4MY7A 5FFAA 2VZBA 2G4HA 1UMNA 4TOHA 3IQ1A 3KX9A 3BVEA 1EUMA 4RC8A 3AF7X 4MJYA 4DASA 3QB9A 1S3QA 3FVBA 1TKOA 3SIDA 3BKNA 4U3GA 1YUZA 2V2SA 3SH6A 3ES3A 3E1LA 3AJQA 4ITWA 1SQ3A 2C2UA 4IWKA 2YW6A 3WVUA 2RBDA 2V2JA 2XJOA 2JD70 3IS8A 3UOFA 4ZMCA 2VXIA 4ETRA 3KA6A 3TA8A 1GWGA 3O7SA 3E1MA 1B71A 4PG0A 2V15A 4LPNA 2IB0A 1RCDA 3E1OA 1JTSA 1RCGA 4RC6B 4M35A 3GVYA 4EVDA 4ML5A 2Z90A 3PVRA 5K53A 3RD0A 2Z5QA 1AEWA 2IU2A 5I4JA 1N1QA 4ISPA 2GYDA 3F33A 1VELA 3A9QA 3PW8A 3SE1A 3E6SA 3UNOA 3PVYB 3E1JA 1JREA 5GU1X 4ZJKA 4TOAA 3PVRB 2CF7A 4TOFA 3H7GA 3ISEA 2PYBA 3E6RA 3AF9X 4XGSA 3QZ3A 2FL0A 5IX6A 3PWFA 3RE7A 3BVFA 1UVHA 2UX1A 4TOEA 1BCFA 3EZUA 1TK6A 4EVCA 5D8QA 1DATA 3R2RA 3EZ0A 3AJPA 2CN6A 2ZG9X 2YW7A 4MN9A 4II4A 3R2KA 5GOUA 4IXKA 2V2PA 5LG8A 3R2MA 3QHBA 4KVQA 2CHIA 2HTNA 3QD8A 5GN8A 2JD60 4ZL5A 3KA8A 2ZG7X 1TKPA 1Z6OM 5FFCA 4M34A 1RCCA 4Z5SA 5JKLG 3AF8X 3NP2X 4CYBA 5C6FA 3UOIA 2GYQA 2FG4A 1ZS3A 4XKUA 4CYAA 2V2NA 1MFRA 1LKMA 4LPMA 4MKUA 5GU0X 4TW3A 3ERZA 5LG2A 3F34A 3QVDA 1NFVA 4LQVA 1IERA 1NF4A 1ZUJA 1LKPA 1J30A 4RC5A 2WLAA 2ITBA 4EVEA 4LPJA 5D8XA 3PZAA 5D8SA 2CIHA 2QF9A 4KVRA 1LB3A 2XJNA 1Z6OA 1YUXA 5AXSA 4Y08A 1O9RA 3U90A 1BG7A 2ZA7A 3HIUA 4ZLWA 5JACA 1OTKA 4ZTTA 4RC5B 5CZUA 2V2LA 3Q4NA 2FHAA 4AM2A 1JGCA
chains in the Genus database with same CATH superfamily
5D8PA 2FG8A 2OC5A 2HR5A 5GU2X 5E1UA 1KRQA 4DZ0A 1BFRA 3FI6A 4LQJA 4E6KA 1RYTA 2BKCA 4W4LB 4AM4A 2YJKA 2D5KA 3E1NA 4TODA 4YKHA 5J8WA 2ZURX 3E1QA 2C2JA 4TOGA 4DE6A 1QGHA 2C6RA 3C23A 3E2CA 2Y3QA 2ZG8X 4ITTA 1TJOA 5D8RA 3KWOA 4CMYV 1F33A 3WVVA 4Z3BA 3R2SA 2BK6A 3RBCA 1LKOA 2AR0A 2F7NA 4DYXA 2Z5RA 2Z5PA 3Q4OA 2V2RA 4YVZA 5FFBA 2CN7A 2V2MA 2BW1A 1NF6A 4X0JA 5HJFA 1MOJA 3VNXA 3O7RA 3F39A 4REUA 4XKTA 4KXRB 4M33A 4YXJA 4M32A 5LS9A 3F35A 3PVTA 4DYUA 1FHAA 2GS4A 1QYBA 3KHKA 3AJOA 1XZ1A 5FEJA 1O9IA 3AK8A 5ERJA 3BVKA 5JKLA 3WNWA 1S2ZA 3EGMA 4LYXA 4KVSA 2WWXB 3FRRA 2OH3A 4II4B 1R03A 4MUDA 3T9JA 4IWJA 2CLBA 5ERKA 3RGDA 2WTLA 5GN8B 2C41A 4LYUA 3QHCA 1SOFA 3KA3A 5LBHA 2V2OA 3C1YA 1H96A 4A25A 2FJCA 2CLUA 5CMQA 1YV1A 2CHPA 3NOZX 3R2OA 3KA9A 4LQHA 3KA4A 5E2DA 2QQYA 2XJMA 1VEQA 4RC7A 1S30A 3C1ZA 3F37A 2C2FA 3F38A 2JD80 4LQNA 1Z4AA 5HU6D 1L8HA 3A68A 4R42A 3AK9A 4YXMA 4OYNA 5FFEA 2MGYA 4CVRA 1NNQA 3R2HA 3KXUA 4RC6A 5D8YA 4RC7B 2V2IA 1JIGA 3PWQC 5GU3X 3GHQA 3M6JA 3KDQA 1DPSA 5JDOA 4DYZA 5J9VA 2YJJA 4QUWA 4P18A 5JKMA 5D8OA 4PGKA 2IY4A 4TOCA 3FSEA 3ISFA 3PVYA 1F30A 2ZA8A 4CVSA 5JKMG 1VEIA 4DYYA 4TOBA 2Z6MA 2W0OA 3PW1A 4DI0A 4CMYA 4ZKWA 5J8SA 2BJYA 5JDOB 1HRSA 1XZ3A 1JYBA 3GE4A 1JKVA 2CEIA 1RCIA 3IS7A 4ZKHA 5CMRA 1DVBA 4AM5A 3JZAB 4ZL6A 3Q4QA 4ISMA 1JI4A 1IESA 3V3KB 3BVLA 4ERUA 3PW1B 3R2LA 5J93A 2VXXA 2WLUA 3WVWA 1RCEA 4W4KB 3F36A 1VJXA 2FFXJ 1L8IA 4ZKXA 3OGHA 4TO9A 3SHXA 5HQOA 4CVPA 2X170 1JKUA 3MPSA 2FKZA 3JZ9A 4CY9A 3C21A 3BVIA 4PGIA 5HJHA 2XKQA 1JI5A 3RAVA 3BT5A 2XGWA 5FFDA 2G38B 2ZA6A 3PWQA 3PVTB 4XKSA 3UFBA 4CVTA 3OJ5A 3HL1A 3Q4RA 3F32A 4EVBA 3PW8C 5K52A 3NP0X 4PG1A 3E1PA 2FZFA 1VLGA 4MY7A 5FFAA 2VZBA 3FRSA 2G4HA 1UMNA 4TOHA 3IQ1A 3KX9A 3BVEA 1EUMA 4RC8A 3AF7X 4MJYA 4WJG4 4DASA 3QB9A 1S3QA 3FVBA 1TKOA 3SIDA 3BKNA 4U3GA 1YUZA 2V2SA 3SH6A 3ES3A 3E1LA 3AJQA 4ITWA 1SQ3A 2C2UA 4IWKA 3N6OA 2YW6A 3WVUA 2RBDA 2V2JA 2XJOA 2JD70 3IS8A 3UOFA 4ZMCA 2VXIA 4ETRA 3KA6A 3TA8A 1GWGA 3O7SA 3E1MA 1B71A 2CWLA 4PG0A 2V15A 4LPNA 2IB0A 1RCDA 3E1OA 1JTSA 1RCGA 4RC6B 4M35A 3GVYA 4EVDA 4ML5A 2Z90A 3GGZA 3PVRA 5K53A 3RD0A 2Z5QA 1AEWA 2IU2A 5I4JA 1N1QA 4ISPA 2GYDA 3F33A 1VELA 3A9QA 3PW8A 3SE1A 3GGYA 3E6SA 3UNOA 3PVYB 3E1JA 4E40A 1JREA 5GU1X 4ZJKA 4TOAA 3PVRB 2CF7A 4TOFA 3VVAA 3H7GA 3ISEA 2PYBA 3E6RA 3AF9X 2V8TA 4XGSA 3QZ3A 2FL0A 5IX6A 3PWFA 3RE7A 3BVFA 1UVHA 2UX1A 3DBYA 2OKCA 4TOEA 1BCFA 3EZUA 3VV9A 1TK6A 3L0MA 3LKDA 4EVCA 5D8QA 1DATA 3R2RA 3EZ0A 3AJPA 4MXPA 2CN6A 2ZG9X 2YW7A 4MN9A 4II4A 3R2KA 5GOUA 4IXKA 2V2PA 5LG8A 3R2MA 3QHBA 4KVQA 2CHIA 2HTNA 3QD8A 5GN8A 2JD60 4ZL5A 3KA8A 2ZG7X 1TKPA 1Z6OM 5FFCA 4M34A 1RCCA 4Z5SA 5JKLG 3W54A 3AF8X 3NP2X 4CYBA 5C6FA 3UOIA 2GYQA 2FG4A 1ZS3A 4XKUA 4CYAA 3D19A 2V2NA 1MFRA 2N02A 1LKMA 4LPMA 4MKUA 5GU0X 4TW3A 3ERZA 5LG2A 3F34A 3QVDA 1NFVA 4LQVA 1IERA 1NF4A 1ZUJA 1LKPA 1J30A 4RC5A 2WLAA 2ITBA 4EVEA 4LPJA 5D8XA 3PZAA 5D8SA 2V8UA 2CIHA 2QF9A 4KVRA 1LB3A 2XJNA 1Z6OA 1YUXA 5AXSA 4Y08A 1O9RA 3U90A 2Y44A 1BG7A 2ZA7A 3HIUA 4ZLWA 5JACA 1OTKA 4ZTTA 4RC5B 5CZUA 2V2LA 3Q4NA 2FHAA 4AM2A 1JGCA
chains in the Genus database with same CATH topology
5D8PA 2FG8A 2OC5A 2HR5A 5GU2X 5E1UA 1KRQA 4DZ0A 1BFRA 3FI6A 4LQJA 4E6KA 1RYTA 2BKCA 4W4LB 4AM4A 2YJKA 2D5KA 3E1NA 4TODA 4YKHA 5J8WA 2ZURX 3E1QA 2C2JA 4TOGA 4DE6A 1QGHA 2C6RA 3C23A 3E2CA 2Y3QA 2ZG8X 4ITTA 1TJOA 5D8RA 3KWOA 4CMYV 1F33A 3WVVA 4Z3BA 3R2SA 2BK6A 3RBCA 1LKOA 2AR0A 2F7NA 4DYXA 2Z5RA 2Z5PA 3Q4OA 2V2RA 4YVZA 5FFBA 2CN7A 2V2MA 2BW1A 1NF6A 4X0JA 5HJFA 1MOJA 3VNXA 3O7RA 3F39A 4REUA 4XKTA 4KXRB 4M33A 4YXJA 4M32A 5LS9A 3F35A 3PVTA 4DYUA 1FHAA 2GS4A 1QYBA 3KHKA 3AJOA 1XZ1A 5FEJA 1O9IA 3AK8A 5ERJA 3BVKA 5JKLA 3WNWA 1S2ZA 3EGMA 4LYXA 4KVSA 2WWXB 3FRRA 2OH3A 4II4B 1R03A 4MUDA 3T9JA 4IWJA 2CLBA 5ERKA 3RGDA 2WTLA 5GN8B 2C41A 4LYUA 3QHCA 1SOFA 3KA3A 5LBHA 2V2OA 3C1YA 1H96A 4A25A 2FJCA 2CLUA 5CMQA 1YV1A 2CHPA 3NOZX 3R2OA 3KA9A 4LQHA 3KA4A 5E2DA 2QQYA 2XJMA 1VEQA 4RC7A 1S30A 3C1ZA 3F37A 2C2FA 3F38A 2JD80 4LQNA 1Z4AA 5HU6D 1L8HA 3A68A 4R42A 3AK9A 4YXMA 4OYNA 5FFEA 2MGYA 4CVRA 1NNQA 3R2HA 3KXUA 4RC6A 5D8YA 4RC7B 2V2IA 1JIGA 3PWQC 5GU3X 3GHQA 3M6JA 3KDQA 1DPSA 5JDOA 4DYZA 5J9VA 2YJJA 4QUWA 4P18A 5JKMA 5D8OA 4PGKA 2IY4A 4TOCA 3FSEA 3ISFA 3PVYA 1F30A 2ZA8A 4CVSA 5JKMG 1VEIA 4DYYA 4TOBA 2Z6MA 2W0OA 3PW1A 4DI0A 4CMYA 4ZKWA 5J8SA 2BJYA 5JDOB 1HRSA 1XZ3A 1JYBA 3GE4A 1JKVA 2CEIA 1RCIA 3IS7A 4ZKHA 5CMRA 1DVBA 4AM5A 3JZAB 4ZL6A 3Q4QA 4ISMA 1JI4A 1IESA 3V3KB 3BVLA 4ERUA 3PW1B 3R2LA 5J93A 2VXXA 2WLUA 3WVWA 1RCEA 4W4KB 3F36A 1VJXA 2FFXJ 1L8IA 4ZKXA 3OGHA 4TO9A 3SHXA 5HQOA 4CVPA 2X170 1JKUA 3MPSA 2FKZA 3JZ9A 4CY9A 3C21A 3BVIA 4PGIA 5HJHA 2XKQA 1JI5A 3RAVA 3BT5A 2XGWA 5FFDA 2G38B 2ZA6A 3PWQA 3PVTB 4XKSA 3UFBA 4CVTA 3OJ5A 3HL1A 3Q4RA 3F32A 4EVBA 3PW8C 5K52A 3NP0X 4PG1A 3E1PA 2FZFA 1VLGA 4MY7A 5FFAA 2VZBA 3FRSA 2G4HA 1UMNA 4TOHA 3IQ1A 3KX9A 3BVEA 1EUMA 4RC8A 3AF7X 4MJYA 4WJG4 4DASA 3QB9A 1S3QA 3FVBA 1TKOA 3SIDA 3BKNA 4U3GA 1YUZA 2V2SA 3SH6A 3ES3A 3E1LA 3AJQA 4ITWA 1SQ3A 2C2UA 4IWKA 3N6OA 2YW6A 3WVUA 2RBDA 2V2JA 2XJOA 2JD70 3IS8A 3UOFA 4ZMCA 2VXIA 4ETRA 3KA6A 3TA8A 1GWGA 3O7SA 3E1MA 1B71A 2CWLA 4PG0A 2V15A 4LPNA 2IB0A 1RCDA 3E1OA 1JTSA 1RCGA 4RC6B 4M35A 3GVYA 4EVDA 4ML5A 2Z90A 3GGZA 3PVRA 5K53A 3RD0A 2Z5QA 1AEWA 2IU2A 5I4JA 1N1QA 4ISPA 2GYDA 3F33A 1VELA 3A9QA 3PW8A 3SE1A 3GGYA 3E6SA 3UNOA 3PVYB 3E1JA 4E40A 1JREA 5GU1X 4ZJKA 4TOAA 3PVRB 2CF7A 4TOFA 3VVAA 3H7GA 3ISEA 2PYBA 3E6RA 3AF9X 2V8TA 4XGSA 3QZ3A 2FL0A 5IX6A 3PWFA 3RE7A 3BVFA 1UVHA 2UX1A 3DBYA 2OKCA 4TOEA 1BCFA 3EZUA 3VV9A 1TK6A 3L0MA 3LKDA 4EVCA 5D8QA 1DATA 3R2RA 3EZ0A 3AJPA 4MXPA 2CN6A 2ZG9X 2YW7A 4MN9A 4II4A 3R2KA 5GOUA 4IXKA 2V2PA 5LG8A 3R2MA 3QHBA 4KVQA 2CHIA 2HTNA 3QD8A 5GN8A 2JD60 4ZL5A 3KA8A 2ZG7X 1TKPA 1Z6OM 5FFCA 4M34A 1RCCA 4Z5SA 5JKLG 3W54A 3AF8X 3NP2X 4CYBA 5C6FA 3UOIA 2GYQA 2FG4A 1ZS3A 4XKUA 4CYAA 3D19A 2V2NA 1MFRA 2N02A 1LKMA 4LPMA 4MKUA 5GU0X 4TW3A 3ERZA 5LG2A 3F34A 3QVDA 1NFVA 4LQVA 1IERA 1NF4A 1ZUJA 1LKPA 1J30A 4RC5A 2WLAA 2ITBA 4EVEA 4LPJA 5D8XA 3PZAA 5D8SA 2V8UA 2CIHA 2QF9A 4KVRA 1LB3A 2XJNA 1Z6OA 1YUXA 5AXSA 4Y08A 1O9RA 3U90A 2Y44A 1BG7A 2ZA7A 3HIUA 4ZLWA 5JACA 1OTKA 4ZTTA 4RC5B 5CZUA 2V2LA 3Q4NA 2FHAA 4AM2A 1JGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8P A;  2FG8 A;  2OC5 A;  2HR5 A;  5GU2 X;  5E1U A;  1KRQ A;  4DZ0 A;  1BFR A;  3FI6 A;  4LQJ A;  4E6K A;  1RYT A;  2BKC A;  4AM4 A;  2YJK A;  2D5K A;  3E1N A;  4TOD A;  4YKH A;  5J8W A;  2ZUR X;  3E1Q A;  2C2J A;  4TOG A;  4DE6 A;  1QGH A;  2C6R A;  3E2C A;  2Y3Q A;  2ZG8 X;  4ITT A;  1TJO A;  5D8R A;  3KWO A;  4CMY V;  1F33 A;  3WVV A;  4Z3B A;  3R2S A;  2BK6 A;  3RBC A;  1LKO A;  2F7N A;  4DYX A;  2Z5R A;  2Z5P A;  3Q4O A;  2V2R A;  5FFB A;  2CN7 A;  2V2M A;  2BW1 A;  1NF6 A;  5HJF A;  1MOJ A;  3VNX A;  3O7R A;  3F39 A;  4REU A;  4XKT A;  4M33 A;  4M32 A;  5LS9 A;  3F35 A;  3PVT A;  4DYU A;  1FHA A;  2GS4 A;  1QYB A;  3AJO A;  1XZ1 A;  5FEJ A;  1O9I A;  3AK8 A;  5ERJ A;  3BVK A;  5JKL A;  3WNW A;  1S2Z A;  3EGM A;  4LYX A;  4KVS A;  2OH3 A;  4II4 B;  1R03 A;  4MUD A;  3T9J A;  4IWJ A;  2CLB A;  5ERK A;  3RGD A;  2WTL A;  5GN8 B;  2C41 A;  4LYU A;  3QHC A;  1SOF A;  3KA3 A;  5LBH A;  2V2O A;  1H96 A;  4A25 A;  2FJC A;  2CLU A;  5CMQ A;  1YV1 A;  2CHP A;  3NOZ X;  3R2O A;  3KA9 A;  4LQH A;  3KA4 A;  5E2D A;  2QQY A;  2XJM A;  1VEQ A;  4RC7 A;  1S30 A;  3F37 A;  2C2F A;  3F38 A;  2JD8 0;  4LQN A;  1Z4A A;  1L8H A;  3A68 A;  4R42 A;  3AK9 A;  4OYN A;  5FFE A;  4CVR A;  1NNQ A;  3R2H A;  3KXU A;  4RC6 A;  5D8Y A;  4RC7 B;  2V2I A;  1JIG A;  3PWQ C;  5GU3 X;  3GHQ A;  1DPS A;  4DYZ A;  5J9V A;  2YJJ A;  4QUW A;  4P18 A;  5JKM A;  5D8O A;  4PGK A;  2IY4 A;  4TOC A;  3FSE A;  3ISF A;  3PVY A;  1F30 A;  2ZA8 A;  4CVS A;  5JKM G;  1VEI A;  4DYY A;  4TOB A;  2Z6M A;  2W0O A;  3PW1 A;  4DI0 A;  4CMY A;  4ZKW A;  5J8S A;  2BJY A;  1HRS A;  1XZ3 A;  1JYB A;  3GE4 A;  1JKV A;  2CEI A;  1RCI A;  3IS7 A;  4ZKH A;  5CMR A;  1DVB A;  4AM5 A;  4ZL6 A;  3Q4Q A;  4ISM A;  1JI4 A;  1IES A;  3BVL A;  4ERU A;  3PW1 B;  3R2L A;  5J93 A;  2VXX A;  2WLU A;  3WVW A;  1RCE A;  3F36 A;  1VJX A;  2FFX J;  1L8I A;  4ZKX A;  3OGH A;  4TO9 A;  3SHX A;  5HQO A;  4CVP A;  2X17 0;  1JKU A;  3MPS A;  2FKZ A;  4CY9 A;  3BVI A;  4PGI A;  5HJH A;  2XKQ A;  1JI5 A;  3RAV A;  3BT5 A;  2XGW A;  5FFD A;  3PWQ A;  2ZA6 A;  3PVT B;  4XKS A;  4CVT A;  3OJ5 A;  3HL1 A;  3Q4R A;  3F32 A;  4EVB A;  3PW8 C;  5K52 A;  3NP0 X;  4PG1 A;  3E1P A;  2FZF A;  1VLG A;  4MY7 A;  5FFA A;  2VZB A;  2G4H A;  1UMN A;  4TOH A;  3IQ1 A;  3KX9 A;  3BVE A;  1EUM A;  4RC8 A;  3AF7 X;  4MJY A;  4DAS A;  3QB9 A;  1S3Q A;  3FVB A;  1TKO A;  3SID A;  3BKN A;  4U3G A;  1YUZ A;  2V2S A;  3SH6 A;  3ES3 A;  3E1L A;  3AJQ A;  4ITW A;  1SQ3 A;  2C2U A;  4IWK A;  2YW6 A;  3WVU A;  2RBD A;  2V2J A;  2XJO A;  2JD7 0;  3IS8 A;  3UOF A;  4ZMC A;  2VXI A;  4ETR A;  3KA6 A;  3TA8 A;  1GWG A;  3O7S A;  3E1M A;  1B71 A;  4PG0 A;  2V15 A;  4LPN A;  2IB0 A;  1RCD A;  3E1O A;  1JTS A;  1RCG A;  4RC6 B;  4M35 A;  3GVY A;  4EVD A;  4ML5 A;  2Z90 A;  3PVR A;  5K53 A;  3RD0 A;  2Z5Q A;  1AEW A;  2IU2 A;  5I4J A;  1N1Q A;  4ISP A;  2GYD A;  3F33 A;  1VEL A;  3A9Q A;  3PW8 A;  3SE1 A;  3E6S A;  3UNO A;  3PVY B;  3E1J A;  1JRE A;  5GU1 X;  4ZJK A;  4TOA A;  3PVR B;  2CF7 A;  4TOF A;  3H7G A;  3ISE A;  2PYB A;  3E6R A;  3AF9 X;  4XGS A;  3QZ3 A;  2FL0 A;  5IX6 A;  3PWF A;  3RE7 A;  3BVF A;  1UVH A;  2UX1 A;  4TOE A;  1BCF A;  3EZU A;  1TK6 A;  4EVC A;  5D8Q A;  1DAT A;  3R2R A;  3EZ0 A;  3AJP A;  2CN6 A;  2ZG9 X;  2YW7 A;  4MN9 A;  4II4 A;  3R2K A;  5GOU A;  4IXK A;  2V2P A;  5LG8 A;  3R2M A;  3QHB A;  4KVQ A;  2CHI A;  2HTN A;  3QD8 A;  5GN8 A;  2JD6 0;  4ZL5 A;  3KA8 A;  2ZG7 X;  1TKP A;  1Z6O M;  5FFC A;  4M34 A;  1RCC A;  4Z5S A;  5JKL G;  3AF8 X;  3NP2 X;  4CYB A;  5C6F A;  3UOI A;  2GYQ A;  2FG4 A;  1ZS3 A;  4XKU A;  4CYA A;  2V2N A;  1MFR A;  1LKM A;  4LPM A;  4MKU A;  5GU0 X;  4TW3 A;  3ERZ A;  5LG2 A;  3F34 A;  3QVD A;  1NFV A;  4LQV A;  1IER A;  1NF4 A;  1ZUJ A;  1LKP A;  1J30 A;  4RC5 A;  2WLA A;  2ITB A;  4EVE A;  4LPJ A;  5D8X A;  3PZA A;  5D8S A;  2CIH A;  2QF9 A;  4KVR A;  1LB3 A;  2XJN A;  1Z6O A;  1YUX A;  5AXS A;  4Y08 A;  1O9R A;  3U90 A;  1BG7 A;  2ZA7 A;  3HIU A;  4ZLW A;  5JAC A;  1OTK A;  4ZTT A;  4RC5 B;  5CZU A;  2V2L A;  3Q4N A;  2FHA A;  4AM2 A;  1JGC A; 
#chains in the Genus database with same CATH topology
 5D8P A;  2FG8 A;  2OC5 A;  2HR5 A;  5GU2 X;  5E1U A;  1KRQ A;  4DZ0 A;  1BFR A;  3FI6 A;  4LQJ A;  4E6K A;  1RYT A;  2BKC A;  4W4L B;  4AM4 A;  2YJK A;  2D5K A;  3E1N A;  4TOD A;  4YKH A;  5J8W A;  2ZUR X;  3E1Q A;  2C2J A;  4TOG A;  4DE6 A;  1QGH A;  2C6R A;  3C23 A;  3E2C A;  2Y3Q A;  2ZG8 X;  4ITT A;  1TJO A;  5D8R A;  3KWO A;  4CMY V;  1F33 A;  3WVV A;  4Z3B A;  3R2S A;  2BK6 A;  3RBC A;  1LKO A;  2AR0 A;  2F7N A;  4DYX A;  2Z5R A;  2Z5P A;  3Q4O A;  2V2R A;  4YVZ A;  5FFB A;  2CN7 A;  2V2M A;  2BW1 A;  1NF6 A;  4X0J A;  5HJF A;  1MOJ A;  3VNX A;  3O7R A;  3F39 A;  4REU A;  4XKT A;  4KXR B;  4M33 A;  4YXJ A;  4M32 A;  5LS9 A;  3F35 A;  3PVT A;  4DYU A;  1FHA A;  2GS4 A;  1QYB A;  3KHK A;  3AJO A;  1XZ1 A;  5FEJ A;  1O9I A;  3AK8 A;  5ERJ A;  3BVK A;  5JKL A;  3WNW A;  1S2Z A;  3EGM A;  4LYX A;  4KVS A;  2WWX B;  3FRR A;  2OH3 A;  4II4 B;  1R03 A;  4MUD A;  3T9J A;  4IWJ A;  2CLB A;  5ERK A;  3RGD A;  2WTL A;  5GN8 B;  2C41 A;  4LYU A;  3QHC A;  1SOF A;  3KA3 A;  5LBH A;  2V2O A;  3C1Y A;  1H96 A;  4A25 A;  2FJC A;  2CLU A;  5CMQ A;  1YV1 A;  2CHP A;  3NOZ X;  3R2O A;  3KA9 A;  4LQH A;  3KA4 A;  5E2D A;  2QQY A;  2XJM A;  1VEQ A;  4RC7 A;  1S30 A;  3C1Z A;  3F37 A;  2C2F A;  3F38 A;  2JD8 0;  4LQN A;  1Z4A A;  5HU6 D;  1L8H A;  3A68 A;  4R42 A;  3AK9 A;  4YXM A;  4OYN A;  5FFE A;  2MGY A;  4CVR A;  1NNQ A;  3R2H A;  3KXU A;  4RC6 A;  5D8Y A;  4RC7 B;  2V2I A;  1JIG A;  3PWQ C;  5GU3 X;  3GHQ A;  3M6J A;  3KDQ A;  1DPS A;  5JDO A;  4DYZ A;  5J9V A;  2YJJ A;  4QUW A;  4P18 A;  5JKM A;  5D8O A;  4PGK A;  2IY4 A;  4TOC A;  3FSE A;  3ISF A;  3PVY A;  1F30 A;  2ZA8 A;  4CVS A;  5JKM G;  1VEI A;  4DYY A;  4TOB A;  2Z6M A;  2W0O A;  3PW1 A;  4DI0 A;  4CMY A;  4ZKW A;  5J8S A;  2BJY A;  5JDO B;  1HRS A;  1XZ3 A;  1JYB A;  3GE4 A;  1JKV A;  2CEI A;  1RCI A;  3IS7 A;  4ZKH A;  5CMR A;  1DVB A;  4AM5 A;  3JZA B;  4ZL6 A;  3Q4Q A;  4ISM A;  1JI4 A;  1IES A;  3V3K B;  3BVL A;  4ERU A;  3PW1 B;  3R2L A;  5J93 A;  2VXX A;  2WLU A;  3WVW A;  1RCE A;  4W4K B;  3F36 A;  1VJX A;  2FFX J;  1L8I A;  4ZKX A;  3OGH A;  4TO9 A;  3SHX A;  5HQO A;  4CVP A;  2X17 0;  1JKU A;  3MPS A;  2FKZ A;  3JZ9 A;  4CY9 A;  3C21 A;  3BVI A;  4PGI A;  5HJH A;  2XKQ A;  1JI5 A;  3RAV A;  3BT5 A;  2XGW A;  5FFD A;  2G38 B;  2ZA6 A;  3PWQ A;  3PVT B;  4XKS A;  3UFB A;  4CVT A;  3OJ5 A;  3HL1 A;  3Q4R A;  3F32 A;  4EVB A;  3PW8 C;  5K52 A;  3NP0 X;  4PG1 A;  3E1P A;  2FZF A;  1VLG A;  4MY7 A;  5FFA A;  2VZB A;  3FRS A;  2G4H A;  1UMN A;  4TOH A;  3IQ1 A;  3KX9 A;  3BVE A;  1EUM A;  4RC8 A;  3AF7 X;  4MJY A;  4WJG 4;  4DAS A;  3QB9 A;  1S3Q A;  3FVB A;  1TKO A;  3SID A;  3BKN A;  4U3G A;  1YUZ A;  2V2S A;  3SH6 A;  3ES3 A;  3E1L A;  3AJQ A;  4ITW A;  1SQ3 A;  2C2U A;  4IWK A;  3N6O A;  2YW6 A;  3WVU A;  2RBD A;  2V2J A;  2XJO A;  2JD7 0;  3IS8 A;  3UOF A;  4ZMC A;  2VXI A;  4ETR A;  3KA6 A;  3TA8 A;  1GWG A;  3O7S A;  3E1M A;  1B71 A;  2CWL A;  4PG0 A;  2V15 A;  4LPN A;  2IB0 A;  1RCD A;  3E1O A;  1JTS A;  1RCG A;  4RC6 B;  4M35 A;  3GVY A;  4EVD A;  4ML5 A;  2Z90 A;  3GGZ A;  3PVR A;  5K53 A;  3RD0 A;  2Z5Q A;  1AEW A;  2IU2 A;  5I4J A;  1N1Q A;  4ISP A;  2GYD A;  3F33 A;  1VEL A;  3A9Q A;  3PW8 A;  3SE1 A;  3GGY A;  3E6S A;  3UNO A;  3PVY B;  3E1J A;  4E40 A;  1JRE A;  5GU1 X;  4ZJK A;  4TOA A;  3PVR B;  2CF7 A;  4TOF A;  3VVA A;  3H7G A;  3ISE A;  2PYB A;  3E6R A;  3AF9 X;  2V8T A;  4XGS A;  3QZ3 A;  2FL0 A;  5IX6 A;  3PWF A;  3RE7 A;  3BVF A;  1UVH A;  2UX1 A;  3DBY A;  2OKC A;  4TOE A;  1BCF A;  3EZU A;  3VV9 A;  1TK6 A;  3L0M A;  3LKD A;  4EVC A;  5D8Q A;  1DAT A;  3R2R A;  3EZ0 A;  3AJP A;  4MXP A;  2CN6 A;  2ZG9 X;  2YW7 A;  4MN9 A;  4II4 A;  3R2K A;  5GOU A;  4IXK A;  2V2P A;  5LG8 A;  3R2M A;  3QHB A;  4KVQ A;  2CHI A;  2HTN A;  3QD8 A;  5GN8 A;  2JD6 0;  4ZL5 A;  3KA8 A;  2ZG7 X;  1TKP A;  1Z6O M;  5FFC A;  4M34 A;  1RCC A;  4Z5S A;  5JKL G;  3W54 A;  3AF8 X;  3NP2 X;  4CYB A;  5C6F A;  3UOI A;  2GYQ A;  2FG4 A;  1ZS3 A;  4XKU A;  4CYA A;  3D19 A;  2V2N A;  1MFR A;  2N02 A;  1LKM A;  4LPM A;  4MKU A;  5GU0 X;  4TW3 A;  3ERZ A;  5LG2 A;  3F34 A;  3QVD A;  1NFV A;  4LQV A;  1IER A;  1NF4 A;  1ZUJ A;  1LKP A;  1J30 A;  4RC5 A;  2WLA A;  2ITB A;  4EVE A;  4LPJ A;  5D8X A;  3PZA A;  5D8S A;  2V8U A;  2CIH A;  2QF9 A;  4KVR A;  1LB3 A;  2XJN A;  1Z6O A;  1YUX A;  5AXS A;  4Y08 A;  1O9R A;  3U90 A;  2Y44 A;  1BG7 A;  2ZA7 A;  3HIU A;  4ZLW A;  5JAC A;  1OTK A;  4ZTT A;  4RC5 B;  5CZU A;  2V2L A;  3Q4N A;  2FHA A;  4AM2 A;  1JGC A; 
#chains in the Genus database with same CATH homology
 5D8P A;  2FG8 A;  2OC5 A;  2HR5 A;  5GU2 X;  5E1U A;  1KRQ A;  4DZ0 A;  1BFR A;  3FI6 A;  4LQJ A;  4E6K A;  1RYT A;  2BKC A;  4W4L B;  4AM4 A;  2YJK A;  2D5K A;  3E1N A;  4TOD A;  4YKH A;  5J8W A;  2ZUR X;  3E1Q A;  2C2J A;  4TOG A;  4DE6 A;  1QGH A;  2C6R A;  3C23 A;  3E2C A;  2Y3Q A;  2ZG8 X;  4ITT A;  1TJO A;  5D8R A;  3KWO A;  4CMY V;  1F33 A;  3WVV A;  4Z3B A;  3R2S A;  2BK6 A;  3RBC A;  1LKO A;  2AR0 A;  2F7N A;  4DYX A;  2Z5R A;  2Z5P A;  3Q4O A;  2V2R A;  4YVZ A;  5FFB A;  2CN7 A;  2V2M A;  2BW1 A;  1NF6 A;  4X0J A;  5HJF A;  1MOJ A;  3VNX A;  3O7R A;  3F39 A;  4REU A;  4XKT A;  4KXR B;  4M33 A;  4YXJ A;  4M32 A;  5LS9 A;  3F35 A;  3PVT A;  4DYU A;  1FHA A;  2GS4 A;  1QYB A;  3KHK A;  3AJO A;  1XZ1 A;  5FEJ A;  1O9I A;  3AK8 A;  5ERJ A;  3BVK A;  5JKL A;  3WNW A;  1S2Z A;  3EGM A;  4LYX A;  4KVS A;  2WWX B;  3FRR A;  2OH3 A;  4II4 B;  1R03 A;  4MUD A;  3T9J A;  4IWJ A;  2CLB A;  5ERK A;  3RGD A;  2WTL A;  5GN8 B;  2C41 A;  4LYU A;  3QHC A;  1SOF A;  3KA3 A;  5LBH A;  2V2O A;  3C1Y A;  1H96 A;  4A25 A;  2FJC A;  2CLU A;  5CMQ A;  1YV1 A;  2CHP A;  3NOZ X;  3R2O A;  3KA9 A;  4LQH A;  3KA4 A;  5E2D A;  2QQY A;  2XJM A;  1VEQ A;  4RC7 A;  1S30 A;  3C1Z A;  3F37 A;  2C2F A;  3F38 A;  2JD8 0;  4LQN A;  1Z4A A;  5HU6 D;  1L8H A;  3A68 A;  4R42 A;  3AK9 A;  4YXM A;  4OYN A;  5FFE A;  2MGY A;  4CVR A;  1NNQ A;  3R2H A;  3KXU A;  4RC6 A;  5D8Y A;  4RC7 B;  2V2I A;  1JIG A;  3PWQ C;  5GU3 X;  3GHQ A;  3M6J A;  3KDQ A;  1DPS A;  5JDO A;  4DYZ A;  5J9V A;  2YJJ A;  4QUW A;  4P18 A;  5JKM A;  5D8O A;  4PGK A;  2IY4 A;  4TOC A;  3FSE A;  3ISF A;  3PVY A;  1F30 A;  2ZA8 A;  4CVS A;  5JKM G;  1VEI A;  4DYY A;  4TOB A;  2Z6M A;  2W0O A;  3PW1 A;  4DI0 A;  4CMY A;  4ZKW A;  5J8S A;  2BJY A;  5JDO B;  1HRS A;  1XZ3 A;  1JYB A;  3GE4 A;  1JKV A;  2CEI A;  1RCI A;  3IS7 A;  4ZKH A;  5CMR A;  1DVB A;  4AM5 A;  3JZA B;  4ZL6 A;  3Q4Q A;  4ISM A;  1JI4 A;  1IES A;  3V3K B;  3BVL A;  4ERU A;  3PW1 B;  3R2L A;  5J93 A;  2VXX A;  2WLU A;  3WVW A;  1RCE A;  4W4K B;  3F36 A;  1VJX A;  2FFX J;  1L8I A;  4ZKX A;  3OGH A;  4TO9 A;  3SHX A;  5HQO A;  4CVP A;  2X17 0;  1JKU A;  3MPS A;  2FKZ A;  3JZ9 A;  4CY9 A;  3C21 A;  3BVI A;  4PGI A;  5HJH A;  2XKQ A;  1JI5 A;  3RAV A;  3BT5 A;  2XGW A;  5FFD A;  2G38 B;  2ZA6 A;  3PWQ A;  3PVT B;  4XKS A;  3UFB A;  4CVT A;  3OJ5 A;  3HL1 A;  3Q4R A;  3F32 A;  4EVB A;  3PW8 C;  5K52 A;  3NP0 X;  4PG1 A;  3E1P A;  2FZF A;  1VLG A;  4MY7 A;  5FFA A;  2VZB A;  3FRS A;  2G4H A;  1UMN A;  4TOH A;  3IQ1 A;  3KX9 A;  3BVE A;  1EUM A;  4RC8 A;  3AF7 X;  4MJY A;  4WJG 4;  4DAS A;  3QB9 A;  1S3Q A;  3FVB A;  1TKO A;  3SID A;  3BKN A;  4U3G A;  1YUZ A;  2V2S A;  3SH6 A;  3ES3 A;  3E1L A;  3AJQ A;  4ITW A;  1SQ3 A;  2C2U A;  4IWK A;  3N6O A;  2YW6 A;  3WVU A;  2RBD A;  2V2J A;  2XJO A;  2JD7 0;  3IS8 A;  3UOF A;  4ZMC A;  2VXI A;  4ETR A;  3KA6 A;  3TA8 A;  1GWG A;  3O7S A;  3E1M A;  1B71 A;  2CWL A;  4PG0 A;  2V15 A;  4LPN A;  2IB0 A;  1RCD A;  3E1O A;  1JTS A;  1RCG A;  4RC6 B;  4M35 A;  3GVY A;  4EVD A;  4ML5 A;  2Z90 A;  3GGZ A;  3PVR A;  5K53 A;  3RD0 A;  2Z5Q A;  1AEW A;  2IU2 A;  5I4J A;  1N1Q A;  4ISP A;  2GYD A;  3F33 A;  1VEL A;  3A9Q A;  3PW8 A;  3SE1 A;  3GGY A;  3E6S A;  3UNO A;  3PVY B;  3E1J A;  4E40 A;  1JRE A;  5GU1 X;  4ZJK A;  4TOA A;  3PVR B;  2CF7 A;  4TOF A;  3VVA A;  3H7G A;  3ISE A;  2PYB A;  3E6R A;  3AF9 X;  2V8T A;  4XGS A;  3QZ3 A;  2FL0 A;  5IX6 A;  3PWF A;  3RE7 A;  3BVF A;  1UVH A;  2UX1 A;  3DBY A;  2OKC A;  4TOE A;  1BCF A;  3EZU A;  3VV9 A;  1TK6 A;  3L0M A;  3LKD A;  4EVC A;  5D8Q A;  1DAT A;  3R2R A;  3EZ0 A;  3AJP A;  4MXP A;  2CN6 A;  2ZG9 X;  2YW7 A;  4MN9 A;  4II4 A;  3R2K A;  5GOU A;  4IXK A;  2V2P A;  5LG8 A;  3R2M A;  3QHB A;  4KVQ A;  2CHI A;  2HTN A;  3QD8 A;  5GN8 A;  2JD6 0;  4ZL5 A;  3KA8 A;  2ZG7 X;  1TKP A;  1Z6O M;  5FFC A;  4M34 A;  1RCC A;  4Z5S A;  5JKL G;  3W54 A;  3AF8 X;  3NP2 X;  4CYB A;  5C6F A;  3UOI A;  2GYQ A;  2FG4 A;  1ZS3 A;  4XKU A;  4CYA A;  3D19 A;  2V2N A;  1MFR A;  2N02 A;  1LKM A;  4LPM A;  4MKU A;  5GU0 X;  4TW3 A;  3ERZ A;  5LG2 A;  3F34 A;  3QVD A;  1NFV A;  4LQV A;  1IER A;  1NF4 A;  1ZUJ A;  1LKP A;  1J30 A;  4RC5 A;  2WLA A;  2ITB A;  4EVE A;  4LPJ A;  5D8X A;  3PZA A;  5D8S A;  2V8U A;  2CIH A;  2QF9 A;  4KVR A;  1LB3 A;  2XJN A;  1Z6O A;  1YUX A;  5AXS A;  4Y08 A;  1O9R A;  3U90 A;  2Y44 A;  1BG7 A;  2ZA7 A;  3HIU A;  4ZLW A;  5JAC A;  1OTK A;  4ZTT A;  4RC5 B;  5CZU A;  2V2L A;  3Q4N A;  2FHA A;  4AM2 A;  1JGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...