2FL0A

Oxidized (all ferric) form of the azotobacter vinelandii bacterioferritin
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
155
structure length
155
Chain Sequence
MKGDKIVIQHLNKILGNELIAINQYFLHARMYEDWGLEKLGKHEYHESIDEMKHADKLIKRILFLEGLPNLQELGKLLIGEHTKEMLECDLKLEQAGLPDLKAAIAYCESVGDYASRELLEDILESEEDHIDWLETQLDLIDKIGLENYLQSQMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Bacterioferritin
publication title Redox-Dependent Structural Changes in the Azotobacter vinelandii Bacterioferritin: New Insights into the Ferroxidase and Iron Transport Mechanism(,).
pubmed doi rcsb
total genus 64
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2006-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2fl0A00
4MN9A 3F39A 5D8QA 2YJJA 5E2DA 4TW3A 3KA9A 2CLUA 2C2JA 4Y08A 2FG4A 3SE1A 1NFVA 3SHXA 3PVTB 4ZL5A 5K52A 2V15A 1JIGA 3A68A 2GS4A 3PVTA 3WVUA 1MFRA 3BT5A 1L8HA 2ZA7A 3BKNA 1YUZA 5JKMG 5C6FA 2CN7A 1KRQA 1QYBA 3NOZX 1JYBA 1N1QA 4M34A 2V2IA 3GVYA 4DYXA 1S2ZA 1XZ1A 3E1QA 1LKPA 5CMQA 2XJOA 3T9JA 1NNQA 2OH3A 4EVEA 4QUWA 3PW1B 2V2JA 3SH6A 3AF9X 5FFAA 4DYZA 5FFCA 4ETRA 1JI5A 2YW6A 2WTLA 3BVKA 3E6RA 5CZUA 1IERA 5D8RA 5FFEA 3PW1A 1IESA 3EZUA 1RCIA 3HIUA 2YW7A 4CVPA 4LQVA 3UNOA 4RC7B 3AF8X 1AEWA 3ES3A 3IS8A 3IS7A 4RC5B 1RCCA 2QQYA 1DVBA 2UX1A 5GN8B 3BVIA 3BVLA 1H96A 2W0OA 4MJYA 3KA8A 4RC7A 4RC5A 2V2LA 3ISEA 3E1PA 4ZMCA 5GN8A 3R2MA 5LBHA 1ZS3A 5J8SA 2OC5A 3WVVA 5GOUA 5JKLA 4ML5A 1B71A 4LPNA 1YUXA 3MPSA 5K53A 5FFBA 4KVQA 4CYAA 2VXXA 2V2NA 2ZURX 1EUMA 2JD70 3UOIA 3F36A 4TOBA 4CVSA 3RAVA 4DYUA 5LG2A 3ISFA 4EVCA 1RCDA 2C2FA 4TOFA 2XKQA 3Q4NA 1YV1A 3E1LA 2FZFA 5HQOA 1VLGA 3O7RA 3AJQA 2IU2A 4LPJA 4PGIA 1RYTA 4RC6B 4CY9A 4PG1A 4EVBA 4TOAA 2ZA8A 3AK9A 1JKVA 4IXKA 1NF6A 4ERUA 4KVSA 1SQ3A 4RC6A 3QVDA 2WLUA 3SIDA 4RC8A 2BK6A 2VZBA 1SOFA 2IY4A 2Z5PA 5FEJA 1OTKA 1BCFA 3KA6A 3RD0A 3F35A 3HL1A 3QB9A 4XKTA 2Z5RA 1XZ3A 1VELA 4TO9A 2ZA6A 1Z4AA 5J8WA 4TODA 2C41A 2HTNA 4ZKHA 3AF7X 1J30A 4ZL6A 4CMYV 3IQ1A 3PW8A 4LYUA 4R42A 3PVRB 3NP2X 3E1NA 5GU0X 2CN6A 2YJKA 5ERJA 3PVRA 2FHAA 5J93A 3VNXA 4LQNA 5GU1X 1VEQA 4ITTA 2C2UA 4EVDA 2BJYA 4ZKWA 1LKOA 1TKPA 2CHPA 1F30A 5GU2X 5JKMA 3UOFA 2XGWA 2CIHA 2V2SA 1JTSA 4ISPA 2V2RA 3AJPA 4II4B 1L8IA 3KWOA 5D8OA 5J9VA 4II4A 4OYNA 4CVTA 3Q4OA 2VXIA 3Q4RA 4DE6A 1TKOA 3QHBA 3PW8C 2C6RA 3E1JA 3KX9A 2FL0A 1DATA 3R2OA 3FVBA 2ZG9X 5I4JA 1BG7A 4AM2A 5AXSA 1DPSA 2GYDA 1MOJA 3QD8A 3F37A 1TJOA 1UVHA 2G4HA 3OGHA 4M32A 4MKUA 1QGHA 4LQHA 2BKCA 3PWQA 2FFXJ 2CLBA 4CMYA 2FG8A 3FSEA 3PZAA 3QHCA 1S30A 3EGMA 4U3GA 3R2KA 3FI6A 4TOEA 1HRSA 4DI0A 1RCEA 3NP0X 4AM5A 2V2OA 4ZTTA 4IWJA 4LYXA 5D8PA 2FJCA 3Q4QA 1JKUA 4REUA 5ERKA 2JD80 3RE7A 2HR5A 4M33A 3BVEA 1UMNA 3WNWA 3RBCA 2F7NA 4Z3BA 5HJFA 4CYBA 3PVYB 2V2PA 4XKSA 5LS9A 2XJMA 3AK8A 3F32A 4A25A 4MUDA 4TOCA 1LKMA 4ITWA 4TOGA 3PVYA 4P18A 2FKZA 1O9RA 4AM4A 4TOHA 4DZ0A 2XJNA 3KA3A 2RBDA 3PWQC 4YKHA 4PGKA 4DYYA 3PWFA 2WLAA 1RCGA 4M35A 1LB3A 3E2CA 5JKLG 5E1UA 1R03A 5IX6A 4ZLWA 4DASA 2ZG7X 3WVWA 1F33A 2Z6MA 3O7SA 1NF4A 3R2SA 1JGCA 3TA8A 3OJ5A 2CHIA 3R2LA 3H7GA 4XKUA 4E6KA 2BW1A 2PYBA 1JI4A 3AJOA 1O9IA 3E1OA 4Z5SA 4LQJA 4ZKXA 3ERZA 5GU3X 5JACA 5CMRA 3E1MA 3QZ3A 3GE4A 3R2HA 1VJXA 1Z6OA 2GYQA 2V2MA 5D8YA 2Z5QA 3GHQA 3EZ0A 1S3QA 4IWKA 4PG0A 2D5KA 4ZJKA 5LG8A 3BVFA 1TK6A 5HJHA 2QF9A 3F33A 3A9QA 1Z6OM 5D8XA 4XGSA 2CEIA 1BFRA 5FFDA 2ZG8X 1FHAA 1GWGA 1JREA 3KA4A 4CVRA 3U90A 3R2RA 3F38A 2Z90A 2ITBA 2JD60 4LPMA 2X170 4ISMA 2IB0A 3KXUA 2Y3QA 4MY7A 5D8SA 2CF7A 3E6SA 1ZUJA 4KVRA 3F34A 1VEIA 3RGDA
chains in the Genus database with same CATH superfamily
4MN9A 3F39A 5D8QA 2YJJA 5E2DA 4TW3A 3KA9A 2CLUA 3DBYA 2C2JA 4Y08A 2FG4A 3SE1A 1NFVA 3W54A 3SHXA 3C1ZA 3PVTB 3C23A 4ZL5A 5K52A 2V15A 1JIGA 3A68A 2GS4A 3PVTA 3WVUA 1MFRA 3BT5A 1L8HA 2ZA7A 3BKNA 1YUZA 5JKMG 5C6FA 2CN7A 1KRQA 2G38B 1QYBA 3NOZX 1JYBA 1N1QA 4M34A 2V2IA 3GVYA 4DYXA 1S2ZA 1XZ1A 3E1QA 1LKPA 5CMQA 2XJOA 3T9JA 1NNQA 2OH3A 4EVEA 4QUWA 3PW1B 2V2JA 3SH6A 3AF9X 5FFAA 4DYZA 5FFCA 4ETRA 1JI5A 2YW6A 2WTLA 3BVKA 3E6RA 5CZUA 1IERA 5D8RA 5FFEA 3PW1A 1IESA 3EZUA 1RCIA 3HIUA 2YW7A 4CVPA 4LQVA 3UNOA 3AF8X 3ES3A 1AEWA 4RC7B 3IS8A 3IS7A 4RC5B 1RCCA 2QQYA 1DVBA 2UX1A 3VV9A 5GN8B 3BVIA 3BVLA 1H96A 2W0OA 4MJYA 3KA8A 4RC7A 4RC5A 2V2LA 3ISEA 3E1PA 4ZMCA 5GN8A 3R2MA 5LBHA 1ZS3A 5J8SA 2OC5A 3WVVA 5GOUA 5JKLA 4ML5A 1B71A 4LPNA 4X0JA 1YUXA 3MPSA 5K53A 5FFBA 2OKCA 4KVQA 4CYAA 2WWXB 2VXXA 3C1YA 2V2NA 2ZURX 1EUMA 2JD70 3UOIA 3F36A 4TOBA 3FRSA 4CVSA 3RAVA 4DYUA 5LG2A 3ISFA 4EVCA 1RCDA 2C2FA 4TOFA 2XKQA 4WJG4 3Q4NA 1YV1A 3E1LA 2FZFA 5HQOA 1VLGA 3O7RA 3AJQA 2IU2A 4LPJA 4PGIA 1RYTA 4RC6B 4CY9A 4PG1A 4EVBA 4TOAA 2ZA8A 3AK9A 1JKVA 4IXKA 2V8UA 1NF6A 4YXJA 4E40A 4ERUA 4KVSA 1SQ3A 4RC6A 3QVDA 2WLUA 2N02A 3SIDA 4RC8A 2BK6A 2VZBA 1SOFA 3V3KB 2IY4A 2Z5PA 5FEJA 1OTKA 1BCFA 3KA6A 3RD0A 3F35A 3HL1A 3QB9A 4XKTA 2Z5RA 1XZ3A 1VELA 4TO9A 2ZA6A 1Z4AA 5J8WA 4TODA 2C41A 2HTNA 4MXPA 4ZKHA 3GGZA 3AF7X 1J30A 4ZL6A 3VVAA 4CMYV 3IQ1A 3PW8A 4LYUA 4R42A 3PVRB 3NP2X 3E1NA 5GU0X 2CN6A 2YJKA 5ERJA 3PVRA 2FHAA 4KXRB 5J93A 3VNXA 4LQNA 5GU1X 1VEQA 4ITTA 2C2UA 4EVDA 2BJYA 4ZKWA 1LKOA 1TKPA 2CHPA 1F30A 5GU2X 5JKMA 3UOFA 2XGWA 2CIHA 2V2SA 1JTSA 4ISPA 2V2RA 3AJPA 4II4B 1L8IA 3KWOA 2Y44A 3JZAB 5D8OA 5J9VA 4II4A 4OYNA 4CVTA 3Q4OA 4YVZA 2VXIA 3Q4RA 4DE6A 1TKOA 3QHBA 3PW8C 2C6RA 3E1JA 3KX9A 2FL0A 1DATA 3R2OA 3FVBA 3FRRA 2ZG9X 5I4JA 1BG7A 4AM2A 5AXSA 1DPSA 2GYDA 1MOJA 3QD8A 3F37A 1TJOA 1UVHA 2G4HA 3OGHA 4M32A 4MKUA 1QGHA 4LQHA 2BKCA 3PWQA 2FFXJ 3LKDA 2CLBA 4CMYA 2FG8A 3FSEA 3PZAA 3QHCA 1S30A 3EGMA 4U3GA 3R2KA 3FI6A 4TOEA 1HRSA 4DI0A 1RCEA 3NP0X 4AM5A 2V2OA 4ZTTA 4IWJA 4LYXA 5JDOB 5D8PA 2FJCA 3Q4QA 1JKUA 4REUA 5ERKA 2JD80 3RE7A 2HR5A 3N6OA 3JZ9A 4M33A 5JDOA 3BVEA 1UMNA 3WNWA 3RBCA 2F7NA 3UFBA 4Z3BA 5HJFA 4CYBA 3GGYA 3PVYB 2V2PA 4XKSA 5LS9A 4W4LB 2XJMA 3AK8A 3F32A 4A25A 4MUDA 4TOCA 1LKMA 4ITWA 4TOGA 3PVYA 4P18A 2FKZA 1O9RA 4AM4A 4TOHA 4DZ0A 2XJNA 2MGYA 3KA3A 2RBDA 3PWQC 4YKHA 4PGKA 4DYYA 3PWFA 2WLAA 2AR0A 1RCGA 4M35A 1LB3A 3E2CA 5JKLG 5E1UA 1R03A 4W4KB 5IX6A 4ZLWA 3D19A 4DASA 2ZG7X 3WVWA 1F33A 3C21A 2Z6MA 3O7SA 1NF4A 3R2SA 1JGCA 3TA8A 3OJ5A 2CHIA 3R2LA 3H7GA 4XKUA 4E6KA 2BW1A 2PYBA 1JI4A 3AJOA 1O9IA 3E1OA 4Z5SA 4LQJA 4ZKXA 3ERZA 5GU3X 5JACA 5CMRA 3E1MA 3QZ3A 3GE4A 3R2HA 1VJXA 1Z6OA 2GYQA 2V2MA 5D8YA 2Z5QA 3GHQA 3KHKA 3EZ0A 1S3QA 5HU6D 4IWKA 3L0MA 4YXMA 4PG0A 2D5KA 3M6JA 4ZJKA 5LG8A 3BVFA 1TK6A 5HJHA 2QF9A 3F33A 3A9QA 1Z6OM 5D8XA 4XGSA 2CEIA 1BFRA 5FFDA 2ZG8X 1FHAA 1GWGA 1JREA 3KA4A 4CVRA 3U90A 3R2RA 3F38A 2Z90A 2ITBA 2JD60 4LPMA 2X170 4ISMA 2IB0A 2V8TA 2CWLA 3KXUA 2Y3QA 4MY7A 5D8SA 2CF7A 3KDQA 3E6SA 1ZUJA 4KVRA 3F34A 1VEIA 3RGDA
chains in the Genus database with same CATH topology
4MN9A 3F39A 5D8QA 2YJJA 5E2DA 4TW3A 3KA9A 2CLUA 3DBYA 2C2JA 4Y08A 2FG4A 3SE1A 1NFVA 3W54A 3SHXA 3C1ZA 3PVTB 3C23A 4ZL5A 5K52A 2V15A 1JIGA 3A68A 2GS4A 3PVTA 3WVUA 1MFRA 3BT5A 1L8HA 2ZA7A 3BKNA 1YUZA 5JKMG 5C6FA 2CN7A 1KRQA 2G38B 1QYBA 3NOZX 1JYBA 1N1QA 4M34A 2V2IA 3GVYA 4DYXA 1S2ZA 1XZ1A 3E1QA 1LKPA 5CMQA 2XJOA 3T9JA 1NNQA 2OH3A 4EVEA 4QUWA 3PW1B 2V2JA 3SH6A 3AF9X 5FFAA 4DYZA 5FFCA 4ETRA 1JI5A 2YW6A 2WTLA 3BVKA 3E6RA 5CZUA 1IERA 5D8RA 5FFEA 3PW1A 1IESA 3EZUA 1RCIA 3HIUA 2YW7A 4CVPA 4LQVA 3UNOA 3AF8X 3ES3A 1AEWA 4RC7B 3IS8A 3IS7A 4RC5B 1RCCA 2QQYA 1DVBA 2UX1A 3VV9A 5GN8B 3BVIA 3BVLA 1H96A 2W0OA 4MJYA 3KA8A 4RC7A 4RC5A 2V2LA 3ISEA 3E1PA 4ZMCA 5GN8A 3R2MA 5LBHA 1ZS3A 5J8SA 2OC5A 3WVVA 5GOUA 5JKLA 4ML5A 1B71A 4LPNA 4X0JA 1YUXA 3MPSA 5K53A 5FFBA 2OKCA 4KVQA 4CYAA 2WWXB 2VXXA 3C1YA 2V2NA 2ZURX 1EUMA 2JD70 3UOIA 3F36A 4TOBA 3FRSA 4CVSA 3RAVA 4DYUA 5LG2A 3ISFA 4EVCA 1RCDA 2C2FA 4TOFA 2XKQA 4WJG4 3Q4NA 1YV1A 3E1LA 2FZFA 5HQOA 1VLGA 3O7RA 3AJQA 2IU2A 4LPJA 4PGIA 1RYTA 4RC6B 4CY9A 4PG1A 4EVBA 4TOAA 2ZA8A 3AK9A 1JKVA 4IXKA 2V8UA 1NF6A 4YXJA 4E40A 4ERUA 4KVSA 1SQ3A 4RC6A 3QVDA 2WLUA 2N02A 3SIDA 4RC8A 2BK6A 2VZBA 1SOFA 3V3KB 2IY4A 2Z5PA 5FEJA 1OTKA 1BCFA 3KA6A 3RD0A 3F35A 3HL1A 3QB9A 4XKTA 2Z5RA 1XZ3A 1VELA 4TO9A 2ZA6A 1Z4AA 5J8WA 4TODA 2C41A 2HTNA 4MXPA 4ZKHA 3GGZA 3AF7X 1J30A 4ZL6A 3VVAA 4CMYV 3IQ1A 3PW8A 4LYUA 4R42A 3PVRB 3NP2X 3E1NA 5GU0X 2CN6A 2YJKA 5ERJA 3PVRA 2FHAA 4KXRB 5J93A 3VNXA 4LQNA 5GU1X 1VEQA 4ITTA 2C2UA 4EVDA 2BJYA 4ZKWA 1LKOA 1TKPA 2CHPA 1F30A 5GU2X 5JKMA 3UOFA 2XGWA 2CIHA 2V2SA 1JTSA 4ISPA 2V2RA 3AJPA 4II4B 1L8IA 3KWOA 2Y44A 3JZAB 5D8OA 5J9VA 4II4A 4OYNA 4CVTA 3Q4OA 4YVZA 2VXIA 3Q4RA 4DE6A 1TKOA 3QHBA 3PW8C 2C6RA 3E1JA 3KX9A 2FL0A 1DATA 3R2OA 3FVBA 3FRRA 2ZG9X 5I4JA 1BG7A 4AM2A 5AXSA 1DPSA 2GYDA 1MOJA 3QD8A 3F37A 1TJOA 1UVHA 2G4HA 3OGHA 4M32A 4MKUA 1QGHA 4LQHA 2BKCA 3PWQA 2FFXJ 3LKDA 2CLBA 4CMYA 2FG8A 3FSEA 3PZAA 3QHCA 1S30A 3EGMA 4U3GA 3R2KA 3FI6A 4TOEA 1HRSA 4DI0A 1RCEA 3NP0X 4AM5A 2V2OA 4ZTTA 4IWJA 4LYXA 5JDOB 5D8PA 2FJCA 3Q4QA 1JKUA 4REUA 5ERKA 2JD80 3RE7A 2HR5A 3N6OA 3JZ9A 4M33A 5JDOA 3BVEA 1UMNA 3WNWA 3RBCA 2F7NA 3UFBA 4Z3BA 5HJFA 4CYBA 3GGYA 3PVYB 2V2PA 4XKSA 5LS9A 4W4LB 2XJMA 3AK8A 3F32A 4A25A 4MUDA 4TOCA 1LKMA 4ITWA 4TOGA 3PVYA 4P18A 2FKZA 1O9RA 4AM4A 4TOHA 4DZ0A 2XJNA 2MGYA 3KA3A 2RBDA 3PWQC 4YKHA 4PGKA 4DYYA 3PWFA 2WLAA 2AR0A 1RCGA 4M35A 1LB3A 3E2CA 5JKLG 5E1UA 1R03A 4W4KB 5IX6A 4ZLWA 3D19A 4DASA 2ZG7X 3WVWA 1F33A 3C21A 2Z6MA 3O7SA 1NF4A 3R2SA 1JGCA 3TA8A 3OJ5A 2CHIA 3R2LA 3H7GA 4XKUA 4E6KA 2BW1A 2PYBA 1JI4A 3AJOA 1O9IA 3E1OA 4Z5SA 4LQJA 4ZKXA 3ERZA 5GU3X 5JACA 5CMRA 3E1MA 3QZ3A 3GE4A 3R2HA 1VJXA 1Z6OA 2GYQA 2V2MA 5D8YA 2Z5QA 3GHQA 3KHKA 3EZ0A 1S3QA 5HU6D 4IWKA 3L0MA 4YXMA 4PG0A 2D5KA 3M6JA 4ZJKA 5LG8A 3BVFA 1TK6A 5HJHA 2QF9A 3F33A 3A9QA 1Z6OM 5D8XA 4XGSA 2CEIA 1BFRA 5FFDA 2ZG8X 1FHAA 1GWGA 1JREA 3KA4A 4CVRA 3U90A 3R2RA 3F38A 2Z90A 2ITBA 2JD60 4LPMA 2X170 4ISMA 2IB0A 2V8TA 2CWLA 3KXUA 2Y3QA 4MY7A 5D8SA 2CF7A 3KDQA 3E6SA 1ZUJA 4KVRA 3F34A 1VEIA 3RGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN9 A;  3F39 A;  5D8Q A;  2YJJ A;  5E2D A;  4TW3 A;  3KA9 A;  2CLU A;  2C2J A;  4Y08 A;  2FG4 A;  3SE1 A;  1NFV A;  3SHX A;  3PVT B;  4ZL5 A;  5K52 A;  2V15 A;  1JIG A;  3A68 A;  2GS4 A;  3PVT A;  3WVU A;  1MFR A;  3BT5 A;  1L8H A;  2ZA7 A;  3BKN A;  1YUZ A;  5JKM G;  5C6F A;  2CN7 A;  1KRQ A;  1QYB A;  3NOZ X;  1JYB A;  1N1Q A;  4M34 A;  2V2I A;  3GVY A;  4DYX A;  1S2Z A;  1XZ1 A;  3E1Q A;  1LKP A;  5CMQ A;  2XJO A;  3T9J A;  1NNQ A;  2OH3 A;  4EVE A;  4QUW A;  3PW1 B;  2V2J A;  3SH6 A;  3AF9 X;  5FFA A;  4DYZ A;  5FFC A;  4ETR A;  1JI5 A;  2YW6 A;  2WTL A;  3BVK A;  3E6R A;  5CZU A;  1IER A;  5D8R A;  5FFE A;  3PW1 A;  1IES A;  3EZU A;  1RCI A;  3HIU A;  2YW7 A;  4CVP A;  4LQV A;  3UNO A;  4RC7 B;  3AF8 X;  1AEW A;  3ES3 A;  3IS8 A;  3IS7 A;  4RC5 B;  1RCC A;  2QQY A;  1DVB A;  2UX1 A;  5GN8 B;  3BVI A;  3BVL A;  1H96 A;  2W0O A;  4MJY A;  3KA8 A;  4RC7 A;  4RC5 A;  2V2L A;  3ISE A;  3E1P A;  4ZMC A;  5GN8 A;  3R2M A;  5LBH A;  1ZS3 A;  5J8S A;  2OC5 A;  3WVV A;  5GOU A;  5JKL A;  4ML5 A;  1B71 A;  4LPN A;  1YUX A;  3MPS A;  5K53 A;  5FFB A;  4KVQ A;  4CYA A;  2VXX A;  2V2N A;  2ZUR X;  1EUM A;  2JD7 0;  3UOI A;  3F36 A;  4TOB A;  4CVS A;  3RAV A;  4DYU A;  5LG2 A;  3ISF A;  4EVC A;  1RCD A;  2C2F A;  4TOF A;  2XKQ A;  3Q4N A;  1YV1 A;  3E1L A;  2FZF A;  5HQO A;  1VLG A;  3O7R A;  3AJQ A;  2IU2 A;  4LPJ A;  4PGI A;  1RYT A;  4RC6 B;  4CY9 A;  4PG1 A;  4EVB A;  4TOA A;  2ZA8 A;  3AK9 A;  1JKV A;  4IXK A;  1NF6 A;  4ERU A;  4KVS A;  1SQ3 A;  4RC6 A;  3QVD A;  2WLU A;  3SID A;  4RC8 A;  2BK6 A;  2VZB A;  1SOF A;  2IY4 A;  2Z5P A;  5FEJ A;  1OTK A;  1BCF A;  3KA6 A;  3RD0 A;  3F35 A;  3HL1 A;  3QB9 A;  4XKT A;  2Z5R A;  1XZ3 A;  1VEL A;  4TO9 A;  2ZA6 A;  1Z4A A;  5J8W A;  4TOD A;  2C41 A;  2HTN A;  4ZKH A;  3AF7 X;  1J30 A;  4ZL6 A;  4CMY V;  3IQ1 A;  3PW8 A;  4LYU A;  4R42 A;  3PVR B;  3NP2 X;  3E1N A;  5GU0 X;  2CN6 A;  2YJK A;  5ERJ A;  3PVR A;  2FHA A;  5J93 A;  3VNX A;  4LQN A;  5GU1 X;  1VEQ A;  4ITT A;  2C2U A;  4EVD A;  2BJY A;  4ZKW A;  1LKO A;  1TKP A;  2CHP A;  1F30 A;  5GU2 X;  5JKM A;  3UOF A;  2XGW A;  2CIH A;  2V2S A;  1JTS A;  4ISP A;  2V2R A;  3AJP A;  4II4 B;  1L8I A;  3KWO A;  5D8O A;  5J9V A;  4II4 A;  4OYN A;  4CVT A;  3Q4O A;  2VXI A;  3Q4R A;  4DE6 A;  1TKO A;  3QHB A;  3PW8 C;  2C6R A;  3E1J A;  3KX9 A;  2FL0 A;  1DAT A;  3R2O A;  3FVB A;  2ZG9 X;  5I4J A;  1BG7 A;  4AM2 A;  5AXS A;  1DPS A;  2GYD A;  1MOJ A;  3QD8 A;  3F37 A;  1TJO A;  1UVH A;  2G4H A;  3OGH A;  4M32 A;  4MKU A;  1QGH A;  4LQH A;  2BKC A;  3PWQ A;  2FFX J;  2CLB A;  4CMY A;  2FG8 A;  3FSE A;  3PZA A;  3QHC A;  1S30 A;  3EGM A;  4U3G A;  3R2K A;  3FI6 A;  4TOE A;  1HRS A;  4DI0 A;  1RCE A;  3NP0 X;  4AM5 A;  2V2O A;  4ZTT A;  4IWJ A;  4LYX A;  5D8P A;  2FJC A;  3Q4Q A;  1JKU A;  4REU A;  5ERK A;  2JD8 0;  3RE7 A;  2HR5 A;  4M33 A;  3BVE A;  1UMN A;  3WNW A;  3RBC A;  2F7N A;  4Z3B A;  5HJF A;  4CYB A;  3PVY B;  2V2P A;  4XKS A;  5LS9 A;  2XJM A;  3AK8 A;  3F32 A;  4A25 A;  4MUD A;  4TOC A;  1LKM A;  4ITW A;  4TOG A;  3PVY A;  4P18 A;  2FKZ A;  1O9R A;  4AM4 A;  4TOH A;  4DZ0 A;  2XJN A;  3KA3 A;  2RBD A;  3PWQ C;  4YKH A;  4PGK A;  4DYY A;  3PWF A;  2WLA A;  1RCG A;  4M35 A;  1LB3 A;  3E2C A;  5JKL G;  5E1U A;  1R03 A;  5IX6 A;  4ZLW A;  4DAS A;  2ZG7 X;  3WVW A;  1F33 A;  2Z6M A;  3O7S A;  1NF4 A;  3R2S A;  1JGC A;  3TA8 A;  3OJ5 A;  2CHI A;  3R2L A;  3H7G A;  4XKU A;  4E6K A;  2BW1 A;  2PYB A;  1JI4 A;  3AJO A;  1O9I A;  3E1O A;  4Z5S A;  4LQJ A;  4ZKX A;  3ERZ A;  5GU3 X;  5JAC A;  5CMR A;  3E1M A;  3QZ3 A;  3GE4 A;  3R2H A;  1VJX A;  1Z6O A;  2GYQ A;  2V2M A;  5D8Y A;  2Z5Q A;  3GHQ A;  3EZ0 A;  1S3Q A;  4IWK A;  4PG0 A;  2D5K A;  4ZJK A;  5LG8 A;  3BVF A;  1TK6 A;  5HJH A;  2QF9 A;  3F33 A;  3A9Q A;  1Z6O M;  5D8X A;  4XGS A;  2CEI A;  1BFR A;  5FFD A;  2ZG8 X;  1FHA A;  1GWG A;  1JRE A;  3KA4 A;  4CVR A;  3U90 A;  3R2R A;  3F38 A;  2Z90 A;  2ITB A;  2JD6 0;  4LPM A;  2X17 0;  4ISM A;  2IB0 A;  3KXU A;  2Y3Q A;  4MY7 A;  5D8S A;  2CF7 A;  3E6S A;  1ZUJ A;  4KVR A;  3F34 A;  1VEI A;  3RGD A; 
#chains in the Genus database with same CATH topology
 4MN9 A;  3F39 A;  5D8Q A;  2YJJ A;  5E2D A;  4TW3 A;  3KA9 A;  2CLU A;  3DBY A;  2C2J A;  4Y08 A;  2FG4 A;  3SE1 A;  1NFV A;  3W54 A;  3SHX A;  3C1Z A;  3PVT B;  3C23 A;  4ZL5 A;  5K52 A;  2V15 A;  1JIG A;  3A68 A;  2GS4 A;  3PVT A;  3WVU A;  1MFR A;  3BT5 A;  1L8H A;  2ZA7 A;  3BKN A;  1YUZ A;  5JKM G;  5C6F A;  2CN7 A;  1KRQ A;  2G38 B;  1QYB A;  3NOZ X;  1JYB A;  1N1Q A;  4M34 A;  2V2I A;  3GVY A;  4DYX A;  1S2Z A;  1XZ1 A;  3E1Q A;  1LKP A;  5CMQ A;  2XJO A;  3T9J A;  1NNQ A;  2OH3 A;  4EVE A;  4QUW A;  3PW1 B;  2V2J A;  3SH6 A;  3AF9 X;  5FFA A;  4DYZ A;  5FFC A;  4ETR A;  1JI5 A;  2YW6 A;  2WTL A;  3BVK A;  3E6R A;  5CZU A;  1IER A;  5D8R A;  5FFE A;  3PW1 A;  1IES A;  3EZU A;  1RCI A;  3HIU A;  2YW7 A;  4CVP A;  4LQV A;  3UNO A;  3AF8 X;  3ES3 A;  1AEW A;  4RC7 B;  3IS8 A;  3IS7 A;  4RC5 B;  1RCC A;  2QQY A;  1DVB A;  2UX1 A;  3VV9 A;  5GN8 B;  3BVI A;  3BVL A;  1H96 A;  2W0O A;  4MJY A;  3KA8 A;  4RC7 A;  4RC5 A;  2V2L A;  3ISE A;  3E1P A;  4ZMC A;  5GN8 A;  3R2M A;  5LBH A;  1ZS3 A;  5J8S A;  2OC5 A;  3WVV A;  5GOU A;  5JKL A;  4ML5 A;  1B71 A;  4LPN A;  4X0J A;  1YUX A;  3MPS A;  5K53 A;  5FFB A;  2OKC A;  4KVQ A;  4CYA A;  2WWX B;  2VXX A;  3C1Y A;  2V2N A;  2ZUR X;  1EUM A;  2JD7 0;  3UOI A;  3F36 A;  4TOB A;  3FRS A;  4CVS A;  3RAV A;  4DYU A;  5LG2 A;  3ISF A;  4EVC A;  1RCD A;  2C2F A;  4TOF A;  2XKQ A;  4WJG 4;  3Q4N A;  1YV1 A;  3E1L A;  2FZF A;  5HQO A;  1VLG A;  3O7R A;  3AJQ A;  2IU2 A;  4LPJ A;  4PGI A;  1RYT A;  4RC6 B;  4CY9 A;  4PG1 A;  4EVB A;  4TOA A;  2ZA8 A;  3AK9 A;  1JKV A;  4IXK A;  2V8U A;  1NF6 A;  4YXJ A;  4E40 A;  4ERU A;  4KVS A;  1SQ3 A;  4RC6 A;  3QVD A;  2WLU A;  2N02 A;  3SID A;  4RC8 A;  2BK6 A;  2VZB A;  1SOF A;  3V3K B;  2IY4 A;  2Z5P A;  5FEJ A;  1OTK A;  1BCF A;  3KA6 A;  3RD0 A;  3F35 A;  3HL1 A;  3QB9 A;  4XKT A;  2Z5R A;  1XZ3 A;  1VEL A;  4TO9 A;  2ZA6 A;  1Z4A A;  5J8W A;  4TOD A;  2C41 A;  2HTN A;  4MXP A;  4ZKH A;  3GGZ A;  3AF7 X;  1J30 A;  4ZL6 A;  3VVA A;  4CMY V;  3IQ1 A;  3PW8 A;  4LYU A;  4R42 A;  3PVR B;  3NP2 X;  3E1N A;  5GU0 X;  2CN6 A;  2YJK A;  5ERJ A;  3PVR A;  2FHA A;  4KXR B;  5J93 A;  3VNX A;  4LQN A;  5GU1 X;  1VEQ A;  4ITT A;  2C2U A;  4EVD A;  2BJY A;  4ZKW A;  1LKO A;  1TKP A;  2CHP A;  1F30 A;  5GU2 X;  5JKM A;  3UOF A;  2XGW A;  2CIH A;  2V2S A;  1JTS A;  4ISP A;  2V2R A;  3AJP A;  4II4 B;  1L8I A;  3KWO A;  2Y44 A;  3JZA B;  5D8O A;  5J9V A;  4II4 A;  4OYN A;  4CVT A;  3Q4O A;  4YVZ A;  2VXI A;  3Q4R A;  4DE6 A;  1TKO A;  3QHB A;  3PW8 C;  2C6R A;  3E1J A;  3KX9 A;  2FL0 A;  1DAT A;  3R2O A;  3FVB A;  3FRR A;  2ZG9 X;  5I4J A;  1BG7 A;  4AM2 A;  5AXS A;  1DPS A;  2GYD A;  1MOJ A;  3QD8 A;  3F37 A;  1TJO A;  1UVH A;  2G4H A;  3OGH A;  4M32 A;  4MKU A;  1QGH A;  4LQH A;  2BKC A;  3PWQ A;  2FFX J;  3LKD A;  2CLB A;  4CMY A;  2FG8 A;  3FSE A;  3PZA A;  3QHC A;  1S30 A;  3EGM A;  4U3G A;  3R2K A;  3FI6 A;  4TOE A;  1HRS A;  4DI0 A;  1RCE A;  3NP0 X;  4AM5 A;  2V2O A;  4ZTT A;  4IWJ A;  4LYX A;  5JDO B;  5D8P A;  2FJC A;  3Q4Q A;  1JKU A;  4REU A;  5ERK A;  2JD8 0;  3RE7 A;  2HR5 A;  3N6O A;  3JZ9 A;  4M33 A;  5JDO A;  3BVE A;  1UMN A;  3WNW A;  3RBC A;  2F7N A;  3UFB A;  4Z3B A;  5HJF A;  4CYB A;  3GGY A;  3PVY B;  2V2P A;  4XKS A;  5LS9 A;  4W4L B;  2XJM A;  3AK8 A;  3F32 A;  4A25 A;  4MUD A;  4TOC A;  1LKM A;  4ITW A;  4TOG A;  3PVY A;  4P18 A;  2FKZ A;  1O9R A;  4AM4 A;  4TOH A;  4DZ0 A;  2XJN A;  2MGY A;  3KA3 A;  2RBD A;  3PWQ C;  4YKH A;  4PGK A;  4DYY A;  3PWF A;  2WLA A;  2AR0 A;  1RCG A;  4M35 A;  1LB3 A;  3E2C A;  5JKL G;  5E1U A;  1R03 A;  4W4K B;  5IX6 A;  4ZLW A;  3D19 A;  4DAS A;  2ZG7 X;  3WVW A;  1F33 A;  3C21 A;  2Z6M A;  3O7S A;  1NF4 A;  3R2S A;  1JGC A;  3TA8 A;  3OJ5 A;  2CHI A;  3R2L A;  3H7G A;  4XKU A;  4E6K A;  2BW1 A;  2PYB A;  1JI4 A;  3AJO A;  1O9I A;  3E1O A;  4Z5S A;  4LQJ A;  4ZKX A;  3ERZ A;  5GU3 X;  5JAC A;  5CMR A;  3E1M A;  3QZ3 A;  3GE4 A;  3R2H A;  1VJX A;  1Z6O A;  2GYQ A;  2V2M A;  5D8Y A;  2Z5Q A;  3GHQ A;  3KHK A;  3EZ0 A;  1S3Q A;  5HU6 D;  4IWK A;  3L0M A;  4YXM A;  4PG0 A;  2D5K A;  3M6J A;  4ZJK A;  5LG8 A;  3BVF A;  1TK6 A;  5HJH A;  2QF9 A;  3F33 A;  3A9Q A;  1Z6O M;  5D8X A;  4XGS A;  2CEI A;  1BFR A;  5FFD A;  2ZG8 X;  1FHA A;  1GWG A;  1JRE A;  3KA4 A;  4CVR A;  3U90 A;  3R2R A;  3F38 A;  2Z90 A;  2ITB A;  2JD6 0;  4LPM A;  2X17 0;  4ISM A;  2IB0 A;  2V8T A;  2CWL A;  3KXU A;  2Y3Q A;  4MY7 A;  5D8S A;  2CF7 A;  3KDQ A;  3E6S A;  1ZUJ A;  4KVR A;  3F34 A;  1VEI A;  3RGD A; 
#chains in the Genus database with same CATH homology
 4MN9 A;  3F39 A;  5D8Q A;  2YJJ A;  5E2D A;  4TW3 A;  3KA9 A;  2CLU A;  3DBY A;  2C2J A;  4Y08 A;  2FG4 A;  3SE1 A;  1NFV A;  3W54 A;  3SHX A;  3C1Z A;  3PVT B;  3C23 A;  4ZL5 A;  5K52 A;  2V15 A;  1JIG A;  3A68 A;  2GS4 A;  3PVT A;  3WVU A;  1MFR A;  3BT5 A;  1L8H A;  2ZA7 A;  3BKN A;  1YUZ A;  5JKM G;  5C6F A;  2CN7 A;  1KRQ A;  2G38 B;  1QYB A;  3NOZ X;  1JYB A;  1N1Q A;  4M34 A;  2V2I A;  3GVY A;  4DYX A;  1S2Z A;  1XZ1 A;  3E1Q A;  1LKP A;  5CMQ A;  2XJO A;  3T9J A;  1NNQ A;  2OH3 A;  4EVE A;  4QUW A;  3PW1 B;  2V2J A;  3SH6 A;  3AF9 X;  5FFA A;  4DYZ A;  5FFC A;  4ETR A;  1JI5 A;  2YW6 A;  2WTL A;  3BVK A;  3E6R A;  5CZU A;  1IER A;  5D8R A;  5FFE A;  3PW1 A;  1IES A;  3EZU A;  1RCI A;  3HIU A;  2YW7 A;  4CVP A;  4LQV A;  3UNO A;  3AF8 X;  3ES3 A;  1AEW A;  4RC7 B;  3IS8 A;  3IS7 A;  4RC5 B;  1RCC A;  2QQY A;  1DVB A;  2UX1 A;  3VV9 A;  5GN8 B;  3BVI A;  3BVL A;  1H96 A;  2W0O A;  4MJY A;  3KA8 A;  4RC7 A;  4RC5 A;  2V2L A;  3ISE A;  3E1P A;  4ZMC A;  5GN8 A;  3R2M A;  5LBH A;  1ZS3 A;  5J8S A;  2OC5 A;  3WVV A;  5GOU A;  5JKL A;  4ML5 A;  1B71 A;  4LPN A;  4X0J A;  1YUX A;  3MPS A;  5K53 A;  5FFB A;  2OKC A;  4KVQ A;  4CYA A;  2WWX B;  2VXX A;  3C1Y A;  2V2N A;  2ZUR X;  1EUM A;  2JD7 0;  3UOI A;  3F36 A;  4TOB A;  3FRS A;  4CVS A;  3RAV A;  4DYU A;  5LG2 A;  3ISF A;  4EVC A;  1RCD A;  2C2F A;  4TOF A;  2XKQ A;  4WJG 4;  3Q4N A;  1YV1 A;  3E1L A;  2FZF A;  5HQO A;  1VLG A;  3O7R A;  3AJQ A;  2IU2 A;  4LPJ A;  4PGI A;  1RYT A;  4RC6 B;  4CY9 A;  4PG1 A;  4EVB A;  4TOA A;  2ZA8 A;  3AK9 A;  1JKV A;  4IXK A;  2V8U A;  1NF6 A;  4YXJ A;  4E40 A;  4ERU A;  4KVS A;  1SQ3 A;  4RC6 A;  3QVD A;  2WLU A;  2N02 A;  3SID A;  4RC8 A;  2BK6 A;  2VZB A;  1SOF A;  3V3K B;  2IY4 A;  2Z5P A;  5FEJ A;  1OTK A;  1BCF A;  3KA6 A;  3RD0 A;  3F35 A;  3HL1 A;  3QB9 A;  4XKT A;  2Z5R A;  1XZ3 A;  1VEL A;  4TO9 A;  2ZA6 A;  1Z4A A;  5J8W A;  4TOD A;  2C41 A;  2HTN A;  4MXP A;  4ZKH A;  3GGZ A;  3AF7 X;  1J30 A;  4ZL6 A;  3VVA A;  4CMY V;  3IQ1 A;  3PW8 A;  4LYU A;  4R42 A;  3PVR B;  3NP2 X;  3E1N A;  5GU0 X;  2CN6 A;  2YJK A;  5ERJ A;  3PVR A;  2FHA A;  4KXR B;  5J93 A;  3VNX A;  4LQN A;  5GU1 X;  1VEQ A;  4ITT A;  2C2U A;  4EVD A;  2BJY A;  4ZKW A;  1LKO A;  1TKP A;  2CHP A;  1F30 A;  5GU2 X;  5JKM A;  3UOF A;  2XGW A;  2CIH A;  2V2S A;  1JTS A;  4ISP A;  2V2R A;  3AJP A;  4II4 B;  1L8I A;  3KWO A;  2Y44 A;  3JZA B;  5D8O A;  5J9V A;  4II4 A;  4OYN A;  4CVT A;  3Q4O A;  4YVZ A;  2VXI A;  3Q4R A;  4DE6 A;  1TKO A;  3QHB A;  3PW8 C;  2C6R A;  3E1J A;  3KX9 A;  2FL0 A;  1DAT A;  3R2O A;  3FVB A;  3FRR A;  2ZG9 X;  5I4J A;  1BG7 A;  4AM2 A;  5AXS A;  1DPS A;  2GYD A;  1MOJ A;  3QD8 A;  3F37 A;  1TJO A;  1UVH A;  2G4H A;  3OGH A;  4M32 A;  4MKU A;  1QGH A;  4LQH A;  2BKC A;  3PWQ A;  2FFX J;  3LKD A;  2CLB A;  4CMY A;  2FG8 A;  3FSE A;  3PZA A;  3QHC A;  1S30 A;  3EGM A;  4U3G A;  3R2K A;  3FI6 A;  4TOE A;  1HRS A;  4DI0 A;  1RCE A;  3NP0 X;  4AM5 A;  2V2O A;  4ZTT A;  4IWJ A;  4LYX A;  5JDO B;  5D8P A;  2FJC A;  3Q4Q A;  1JKU A;  4REU A;  5ERK A;  2JD8 0;  3RE7 A;  2HR5 A;  3N6O A;  3JZ9 A;  4M33 A;  5JDO A;  3BVE A;  1UMN A;  3WNW A;  3RBC A;  2F7N A;  3UFB A;  4Z3B A;  5HJF A;  4CYB A;  3GGY A;  3PVY B;  2V2P A;  4XKS A;  5LS9 A;  4W4L B;  2XJM A;  3AK8 A;  3F32 A;  4A25 A;  4MUD A;  4TOC A;  1LKM A;  4ITW A;  4TOG A;  3PVY A;  4P18 A;  2FKZ A;  1O9R A;  4AM4 A;  4TOH A;  4DZ0 A;  2XJN A;  2MGY A;  3KA3 A;  2RBD A;  3PWQ C;  4YKH A;  4PGK A;  4DYY A;  3PWF A;  2WLA A;  2AR0 A;  1RCG A;  4M35 A;  1LB3 A;  3E2C A;  5JKL G;  5E1U A;  1R03 A;  4W4K B;  5IX6 A;  4ZLW A;  3D19 A;  4DAS A;  2ZG7 X;  3WVW A;  1F33 A;  3C21 A;  2Z6M A;  3O7S A;  1NF4 A;  3R2S A;  1JGC A;  3TA8 A;  3OJ5 A;  2CHI A;  3R2L A;  3H7G A;  4XKU A;  4E6K A;  2BW1 A;  2PYB A;  1JI4 A;  3AJO A;  1O9I A;  3E1O A;  4Z5S A;  4LQJ A;  4ZKX A;  3ERZ A;  5GU3 X;  5JAC A;  5CMR A;  3E1M A;  3QZ3 A;  3GE4 A;  3R2H A;  1VJX A;  1Z6O A;  2GYQ A;  2V2M A;  5D8Y A;  2Z5Q A;  3GHQ A;  3KHK A;  3EZ0 A;  1S3Q A;  5HU6 D;  4IWK A;  3L0M A;  4YXM A;  4PG0 A;  2D5K A;  3M6J A;  4ZJK A;  5LG8 A;  3BVF A;  1TK6 A;  5HJH A;  2QF9 A;  3F33 A;  3A9Q A;  1Z6O M;  5D8X A;  4XGS A;  2CEI A;  1BFR A;  5FFD A;  2ZG8 X;  1FHA A;  1GWG A;  1JRE A;  3KA4 A;  4CVR A;  3U90 A;  3R2R A;  3F38 A;  2Z90 A;  2ITB A;  2JD6 0;  4LPM A;  2X17 0;  4ISM A;  2IB0 A;  2V8T A;  2CWL A;  3KXU A;  2Y3Q A;  4MY7 A;  5D8S A;  2CF7 A;  3KDQ A;  3E6S A;  1ZUJ A;  4KVR A;  3F34 A;  1VEI A;  3RGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...