5GOUA

Structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
141
Chain Sequence
b'EAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin heavy chain
publication title Conversion of the Native 24-mer Ferritin Nanocage into Its Non-Native 16-mer Analogue by Insertion of Extra Amino Acid Residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 50
structure length 141
sequence length 168
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5gouA00
5K53A 1JKUA 3MPSA 4TO9A 4RC6A 4E6KA 5FFBA 3QHCA 4XKTA 1ZUJA 3KA4A 4PG1A 2Z5RA 2C2JA 4IXKA 4PG0A 3F35A 5JACA 3EGMA 5CMRA 3AJQA 4M34A 2V2NA 4AM5A 3F39A 5FFDA 2Z90A 2W0OA 1SOFA 4PGKA 2C2FA 3TA8A 4CMYA 2QQYA 2PYBA 3KX9A 3RE7A 3PVRB 3SH6A 3OJ5A 1Z4AA 3QHBA 5E1UA 2ZA7A 1LKPA 3BVLA 1DATA 5IX6A 2ZG9X 4ZMCA 5D8PA 2YJKA 1H96A 4LPMA 4AM2A 3PW8C 4II4A 4XGSA 2FZFA 2C6RA 3VNXA 1F33A 4TOEA 3QZ3A 3A9QA 2FKZA 2V2RA 3BVKA 3PW8A 2XGWA 5HJHA 4TOAA 3E1QA 3H7GA 2HTNA 1JI5A 2IB0A 3PVYA 3ERZA 5HJFA 4TODA 1IERA 4MUDA 1ZS3A 2ZA8A 4RC7A 4IWKA 3F33A 5D8XA 3NOZX 5E2DA 5FEJA 4Z5SA 4DYZA 2V2MA 3AK9A 3PWFA 1TK6A 2FG8A 3R2SA 3Q4RA 1JI4A 2CEIA 2VXXA 3RBCA 4LPNA 3R2KA 2Z5QA 4LPJA 4YKHA 3Q4NA 4TW3A 3KA6A 5GU1X 3E1LA 1LKOA 3AJPA 3HL1A 1L8HA 3SE1A 4TOGA 4IWJA 3E1MA 1JTSA 5JKLA 2CHIA 5LG2A 5FFEA 4P18A 3Q4QA 1BFRA 1OTKA 3UOFA 2D5KA 3IS7A 2CLBA 4ITWA 1O9RA 1S2ZA 1HRSA 3E6RA 3O7SA 3RGDA 5I4JA 4M32A 1JIGA 2CIHA 2ZA6A 2GYQA 2V2OA 4CVTA 2HR5A 1SQ3A 1RCCA 2QF9A 5JKMG 4DYYA 1VEQA 1XZ1A 5J8SA 4TOFA 2X170 4DYUA 3PVTB 4RC5B 1QYBA 3A68A 3PVRA 3WVUA 3ISEA 3RAVA 3T9JA 4ZLWA 4EVDA 3U90A 1VJXA 4ZL6A 5GN8B 2YW7A 4R42A 5LG8A 1MFRA 5D8SA 2WLAA 5D8OA 2XJOA 1L8IA 1XZ3A 3PW1B 4ETRA 2VXIA 1YUZA 5CZUA 4Z3BA 2FHAA 5HQOA 4MY7A 2FG4A 3FI6A 1VLGA 2V2JA 1FHAA 1RCIA 1YV1A 2JD80 3Q4OA 2WTLA 4PGIA 1RCGA 1JKVA 2YJJA 1F30A 5GU0X 1RYTA 1DPSA 2IU2A 3PWQC 1YUXA 4ZJKA 5J93A 1LKMA 3ES3A 3WNWA 4DZ0A 3BVEA 1TKPA 4REUA 1TKOA 3GVYA 4QUWA 5K52A 4LQJA 2RBDA 4OYNA 4ITTA 2XKQA 5ERKA 2FFXJ 4CYAA 4LYXA 4MJYA 4U3GA 5D8YA 4ZL5A 3PWQA 5GU2X 1EUMA 1JYBA 4KVSA 3KA3A 2CN7A 4LQNA 5C6FA 3R2LA 1R03A 3AF9X 4DYXA 2CHPA 1B71A 3QB9A 3QVDA 2XJMA 4LQHA 3O7RA 1Z6OM 2VZBA 4KVQA 3WVVA 2V2PA 3AF8X 1NF6A 3GE4A 3F37A 3KA9A 1LB3A 2GS4A 4ML5A 2CLUA 3E6SA 1TJOA 3AJOA 4TOBA 5LBHA 5J8WA 2G4HA 3QD8A 1NFVA 1MOJA 4RC6B 1DVBA 4CMYV 1BG7A 2CN6A 1VEIA 2F7NA 3BT5A 5JKLG 5AXSA 2V2IA 3NP2X 3PVTA 3WVWA 4RC5A 1NNQA 1O9IA 2V15A 1S30A 4DASA 2OC5A 4M33A 5GOUA 2JD70 4DI0A 5GN8A 4EVBA 1JGCA 3R2RA 3AK8A 4KVRA 4LQVA 1S3QA 2ZG8X 3UOIA 3IQ1A 5LS9A 2BKCA 1BCFA 5D8QA 3PW1A 4Y08A 2BK6A 4ZKXA 4TOCA 4ZTTA 1VELA 2FJCA 4CVSA 1QGHA 4II4B 2Z5PA 3SIDA 4LYUA 4EVEA 1RCEA 4CYBA 4EVCA 2OH3A 3F36A 3ISFA 1J30A 4MKUA 3F38A 3GHQA 3BVFA 2C2UA 4A25A 2V2LA 3KXUA 3R2OA 2YW6A 3UNOA 3RD0A 3E2CA 1GWGA 2FL0A 4DE6A 3PVYB 3HIUA 1IESA 2JD60 5J9VA 3SHXA 3PZAA 3F32A 3E1PA 1N1QA 3EZUA 4RC8A 4RC7B 2ITBA 3R2HA 4M35A 2IY4A 5ERJA 4ISMA 3FVBA 4ZKHA 2C41A 3IS8A 1Z6OA 4AM4A 4ISPA 4ERUA 2Y3QA 3AF7X 1KRQA 2V2SA 1UVHA 5D8RA 2ZG7X 3E1JA 2ZURX 4XKUA 3F34A 4ZKWA 1UMNA 2CF7A 4CVPA 2WLUA 4CVRA 3FSEA 3KWOA 4CY9A 5FFCA 3KA8A 4MN9A 2BJYA 5CMQA 3NP0X 1JREA 2GYDA 4XKSA 3BKNA 5GU3X 1RCDA 3BVIA 3OGHA 2XJNA 1NF4A 5JKMA 3E1OA 3EZ0A 5FFAA 4TOHA 1AEWA 2BW1A 2UX1A 3R2MA 3E1NA 2Z6MA
chains in the Genus database with same CATH superfamily
5K53A 1JKUA 3MPSA 4TO9A 4RC6A 3V3KB 4E6KA 5FFBA 3QHCA 4XKTA 1ZUJA 3KA4A 4PG1A 2Z5RA 2C2JA 4IXKA 4PG0A 3F35A 4WJG4 5JACA 3EGMA 5CMRA 3AJQA 4M34A 2V2NA 4AM5A 3F39A 5FFDA 2Z90A 2W0OA 2V8TA 1SOFA 4PGKA 2C2FA 3FRRA 3TA8A 4CMYA 2QQYA 2PYBA 3KX9A 3RE7A 3PVRB 3SH6A 3C21A 1Z4AA 3OJ5A 3QHBA 5E1UA 2ZA7A 1LKPA 3BVLA 1DATA 5IX6A 2ZG9X 4ZMCA 5D8PA 2YJKA 1H96A 4LPMA 4AM2A 3PW8C 4II4A 4XGSA 2FZFA 3L0MA 2C6RA 3VNXA 1F33A 4TOEA 3QZ3A 3LKDA 3A9QA 2FKZA 2V2RA 3BVKA 3PW8A 2XGWA 5HJHA 4TOAA 3E1QA 3H7GA 2HTNA 1JI5A 2IB0A 3PVYA 3ERZA 5HJFA 4TODA 4W4KB 1IERA 4MUDA 1ZS3A 2ZA8A 4RC7A 4YXMA 4IWKA 3F33A 5D8XA 3NOZX 5E2DA 5FEJA 4Z5SA 4DYZA 2V2MA 3AK9A 3PWFA 1TK6A 2FG8A 3R2SA 3Q4RA 1JI4A 2CEIA 2VXXA 3RBCA 4LPNA 3R2KA 2Z5QA 2V8UA 4LPJA 4YKHA 3Q4NA 4TW3A 3DBYA 3KA6A 5GU1X 3E1LA 1LKOA 4KXRB 2MGYA 3AJPA 3HL1A 1L8HA 3SE1A 4TOGA 4IWJA 3E1MA 3FRSA 3JZ9A 1JTSA 5JKLA 2G38B 2CHIA 5LG2A 5FFEA 4P18A 3Q4QA 1BFRA 1OTKA 3UOFA 2D5KA 3IS7A 2CLBA 4ITWA 1O9RA 1S2ZA 1HRSA 3E6RA 3O7SA 3RGDA 5I4JA 4M32A 1JIGA 2CIHA 2ZA6A 2GYQA 2V2OA 4CVTA 2HR5A 1SQ3A 1RCCA 3GGYA 2Y44A 2QF9A 5JKMG 4DYYA 1VEQA 1XZ1A 5J8SA 4TOFA 2X170 4DYUA 3PVTB 4RC5B 1QYBA 3A68A 3PVRA 3WVUA 3ISEA 3RAVA 3T9JA 4ZLWA 4EVDA 3U90A 1VJXA 4ZL6A 5GN8B 2YW7A 4R42A 5LG8A 1MFRA 5D8SA 2WLAA 5D8OA 2XJOA 1L8IA 3GGZA 1XZ3A 3PW1B 4ETRA 2VXIA 1YUZA 5CZUA 4Z3BA 2FHAA 5HQOA 4MY7A 2FG4A 3FI6A 1VLGA 2V2JA 1FHAA 1RCIA 1YV1A 2JD80 3Q4OA 2WWXB 2WTLA 4PGIA 2N02A 2OKCA 1RCGA 1JKVA 2YJJA 1F30A 5JDOB 5GU0X 1RYTA 1DPSA 2IU2A 3PWQC 1YUXA 4ZJKA 5J93A 1LKMA 3ES3A 3WNWA 4DZ0A 4E40A 3BVEA 1TKPA 4REUA 1TKOA 3GVYA 4QUWA 5K52A 4LQJA 2RBDA 4OYNA 4ITTA 2XKQA 5ERKA 5HU6D 2FFXJ 4CYAA 4LYXA 4MJYA 4U3GA 5D8YA 4ZL5A 3PWQA 5GU2X 1EUMA 1JYBA 4KVSA 3KA3A 2CN7A 4LQNA 5C6FA 3R2LA 1R03A 3AF9X 4DYXA 2CHPA 1B71A 3QB9A 3QVDA 3VVAA 2XJMA 4LQHA 3O7RA 1Z6OM 3W54A 2VZBA 4KVQA 3WVVA 2V2PA 3AF8X 1NF6A 3GE4A 3F37A 3KA9A 1LB3A 3D19A 2GS4A 4ML5A 2CLUA 3E6SA 1TJOA 3AJOA 4TOBA 5LBHA 5J8WA 2G4HA 3QD8A 1NFVA 1MOJA 4RC6B 1DVBA 4CMYV 1BG7A 2CN6A 3C23A 1VEIA 2F7NA 3BT5A 5JKLG 5AXSA 2V2IA 3NP2X 3PVTA 3WVWA 4RC5A 1NNQA 1O9IA 2V15A 1S30A 4DASA 2OC5A 4M33A 5GOUA 2JD70 4DI0A 5GN8A 4EVBA 1JGCA 3R2RA 3AK8A 4KVRA 4LQVA 1S3QA 2ZG8X 3UOIA 3IQ1A 5LS9A 2BKCA 2CWLA 1BCFA 4YVZA 5D8QA 3PW1A 4Y08A 2BK6A 4ZKXA 4TOCA 4X0JA 4ZTTA 1VELA 2FJCA 4CVSA 1QGHA 4II4B 4YXJA 2Z5PA 3SIDA 4LYUA 4EVEA 1RCEA 4CYBA 4EVCA 2OH3A 3F36A 3ISFA 2AR0A 1J30A 4MKUA 3F38A 3GHQA 3BVFA 5JDOA 2C2UA 3C1ZA 4A25A 3KHKA 2V2LA 3KXUA 3R2OA 2YW6A 3UNOA 3RD0A 3E2CA 1GWGA 3JZAB 2FL0A 4DE6A 3PVYB 3HIUA 1IESA 2JD60 5J9VA 3N6OA 3SHXA 3PZAA 3UFBA 3F32A 3M6JA 3E1PA 1N1QA 3EZUA 4RC8A 4RC7B 2ITBA 3R2HA 4M35A 2IY4A 5ERJA 4ISMA 3FVBA 4ZKHA 2C41A 3IS8A 1Z6OA 4AM4A 4ISPA 4ERUA 2Y3QA 3AF7X 1KRQA 3VV9A 3C1YA 2V2SA 1UVHA 5D8RA 2ZG7X 3E1JA 2ZURX 4XKUA 3F34A 4ZKWA 1UMNA 2CF7A 4CVPA 2WLUA 4CVRA 3FSEA 3KWOA 4CY9A 5FFCA 3KA8A 4MN9A 2BJYA 5CMQA 3NP0X 1JREA 2GYDA 4XKSA 3BKNA 4W4LB 5GU3X 1RCDA 3BVIA 3OGHA 2XJNA 1NF4A 5JKMA 3E1OA 3EZ0A 5FFAA 4TOHA 3KDQA 1AEWA 2BW1A 2UX1A 3R2MA 4MXPA 3E1NA 2Z6MA
chains in the Genus database with same CATH topology
5K53A 1JKUA 3MPSA 4TO9A 4RC6A 3V3KB 4E6KA 5FFBA 3QHCA 4XKTA 1ZUJA 3KA4A 4PG1A 2Z5RA 2C2JA 4IXKA 4PG0A 3F35A 4WJG4 5JACA 3EGMA 5CMRA 3AJQA 4M34A 2V2NA 4AM5A 3F39A 5FFDA 2Z90A 2W0OA 2V8TA 1SOFA 4PGKA 2C2FA 3FRRA 3TA8A 4CMYA 2QQYA 2PYBA 3KX9A 3RE7A 3PVRB 3SH6A 3C21A 1Z4AA 3OJ5A 3QHBA 5E1UA 2ZA7A 1LKPA 3BVLA 1DATA 5IX6A 2ZG9X 4ZMCA 5D8PA 2YJKA 1H96A 4LPMA 4AM2A 3PW8C 4II4A 4XGSA 2FZFA 3L0MA 2C6RA 3VNXA 1F33A 4TOEA 3QZ3A 3LKDA 3A9QA 2FKZA 2V2RA 3BVKA 3PW8A 2XGWA 5HJHA 4TOAA 3E1QA 3H7GA 2HTNA 1JI5A 2IB0A 3PVYA 3ERZA 5HJFA 4TODA 4W4KB 1IERA 4MUDA 1ZS3A 2ZA8A 4RC7A 4YXMA 4IWKA 3F33A 5D8XA 3NOZX 5E2DA 5FEJA 4Z5SA 4DYZA 2V2MA 3AK9A 3PWFA 1TK6A 2FG8A 3R2SA 3Q4RA 1JI4A 2CEIA 2VXXA 3RBCA 4LPNA 3R2KA 2Z5QA 2V8UA 4LPJA 4YKHA 3Q4NA 4TW3A 3DBYA 3KA6A 5GU1X 3E1LA 1LKOA 4KXRB 2MGYA 3AJPA 3HL1A 1L8HA 3SE1A 4TOGA 4IWJA 3E1MA 3FRSA 3JZ9A 1JTSA 5JKLA 2G38B 2CHIA 5LG2A 5FFEA 4P18A 3Q4QA 1BFRA 1OTKA 3UOFA 2D5KA 3IS7A 2CLBA 4ITWA 1O9RA 1S2ZA 1HRSA 3E6RA 3O7SA 3RGDA 5I4JA 4M32A 1JIGA 2CIHA 2ZA6A 2GYQA 2V2OA 4CVTA 2HR5A 1SQ3A 1RCCA 3GGYA 2Y44A 2QF9A 5JKMG 4DYYA 1VEQA 1XZ1A 5J8SA 4TOFA 2X170 4DYUA 3PVTB 4RC5B 1QYBA 3A68A 3PVRA 3WVUA 3ISEA 3RAVA 3T9JA 4ZLWA 4EVDA 3U90A 1VJXA 4ZL6A 5GN8B 2YW7A 4R42A 5LG8A 1MFRA 5D8SA 2WLAA 5D8OA 2XJOA 1L8IA 3GGZA 1XZ3A 3PW1B 4ETRA 2VXIA 1YUZA 5CZUA 4Z3BA 2FHAA 5HQOA 4MY7A 2FG4A 3FI6A 1VLGA 2V2JA 1FHAA 1RCIA 1YV1A 2JD80 3Q4OA 2WWXB 2WTLA 4PGIA 2N02A 2OKCA 1RCGA 1JKVA 2YJJA 1F30A 5JDOB 5GU0X 1RYTA 1DPSA 2IU2A 3PWQC 1YUXA 4ZJKA 5J93A 1LKMA 3ES3A 3WNWA 4DZ0A 4E40A 3BVEA 1TKPA 4REUA 1TKOA 3GVYA 4QUWA 5K52A 4LQJA 2RBDA 4OYNA 4ITTA 2XKQA 5ERKA 5HU6D 2FFXJ 4CYAA 4LYXA 4MJYA 4U3GA 5D8YA 4ZL5A 3PWQA 5GU2X 1EUMA 1JYBA 4KVSA 3KA3A 2CN7A 4LQNA 5C6FA 3R2LA 1R03A 3AF9X 4DYXA 2CHPA 1B71A 3QB9A 3QVDA 3VVAA 2XJMA 4LQHA 3O7RA 1Z6OM 3W54A 2VZBA 4KVQA 3WVVA 2V2PA 3AF8X 1NF6A 3GE4A 3F37A 3KA9A 1LB3A 3D19A 2GS4A 4ML5A 2CLUA 3E6SA 1TJOA 3AJOA 4TOBA 5LBHA 5J8WA 2G4HA 3QD8A 1NFVA 1MOJA 4RC6B 1DVBA 4CMYV 1BG7A 2CN6A 3C23A 1VEIA 2F7NA 3BT5A 5JKLG 5AXSA 2V2IA 3NP2X 3PVTA 3WVWA 4RC5A 1NNQA 1O9IA 2V15A 1S30A 4DASA 2OC5A 4M33A 5GOUA 2JD70 4DI0A 5GN8A 4EVBA 1JGCA 3R2RA 3AK8A 4KVRA 4LQVA 1S3QA 2ZG8X 3UOIA 3IQ1A 5LS9A 2BKCA 2CWLA 1BCFA 4YVZA 5D8QA 3PW1A 4Y08A 2BK6A 4ZKXA 4TOCA 4X0JA 4ZTTA 1VELA 2FJCA 4CVSA 1QGHA 4II4B 4YXJA 2Z5PA 3SIDA 4LYUA 4EVEA 1RCEA 4CYBA 4EVCA 2OH3A 3F36A 3ISFA 2AR0A 1J30A 4MKUA 3F38A 3GHQA 3BVFA 5JDOA 2C2UA 3C1ZA 4A25A 3KHKA 2V2LA 3KXUA 3R2OA 2YW6A 3UNOA 3RD0A 3E2CA 1GWGA 3JZAB 2FL0A 4DE6A 3PVYB 3HIUA 1IESA 2JD60 5J9VA 3N6OA 3SHXA 3PZAA 3UFBA 3F32A 3M6JA 3E1PA 1N1QA 3EZUA 4RC8A 4RC7B 2ITBA 3R2HA 4M35A 2IY4A 5ERJA 4ISMA 3FVBA 4ZKHA 2C41A 3IS8A 1Z6OA 4AM4A 4ISPA 4ERUA 2Y3QA 3AF7X 1KRQA 3VV9A 3C1YA 2V2SA 1UVHA 5D8RA 2ZG7X 3E1JA 2ZURX 4XKUA 3F34A 4ZKWA 1UMNA 2CF7A 4CVPA 2WLUA 4CVRA 3FSEA 3KWOA 4CY9A 5FFCA 3KA8A 4MN9A 2BJYA 5CMQA 3NP0X 1JREA 2GYDA 4XKSA 3BKNA 4W4LB 5GU3X 1RCDA 3BVIA 3OGHA 2XJNA 1NF4A 5JKMA 3E1OA 3EZ0A 5FFAA 4TOHA 3KDQA 1AEWA 2BW1A 2UX1A 3R2MA 4MXPA 3E1NA 2Z6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K53 A;  1JKU A;  3MPS A;  4TO9 A;  4RC6 A;  4E6K A;  5FFB A;  3QHC A;  4XKT A;  1ZUJ A;  3KA4 A;  4PG1 A;  2Z5R A;  2C2J A;  4IXK A;  4PG0 A;  3F35 A;  5JAC A;  3EGM A;  5CMR A;  3AJQ A;  4M34 A;  2V2N A;  4AM5 A;  3F39 A;  5FFD A;  2Z90 A;  2W0O A;  1SOF A;  4PGK A;  2C2F A;  3TA8 A;  4CMY A;  2QQY A;  2PYB A;  3KX9 A;  3RE7 A;  3PVR B;  3SH6 A;  3OJ5 A;  1Z4A A;  3QHB A;  5E1U A;  2ZA7 A;  1LKP A;  3BVL A;  1DAT A;  5IX6 A;  2ZG9 X;  4ZMC A;  5D8P A;  2YJK A;  1H96 A;  4LPM A;  4AM2 A;  3PW8 C;  4II4 A;  4XGS A;  2FZF A;  2C6R A;  3VNX A;  1F33 A;  4TOE A;  3QZ3 A;  3A9Q A;  2FKZ A;  2V2R A;  3BVK A;  3PW8 A;  2XGW A;  5HJH A;  4TOA A;  3E1Q A;  3H7G A;  2HTN A;  1JI5 A;  2IB0 A;  3PVY A;  3ERZ A;  5HJF A;  4TOD A;  1IER A;  4MUD A;  1ZS3 A;  2ZA8 A;  4RC7 A;  4IWK A;  3F33 A;  5D8X A;  3NOZ X;  5E2D A;  5FEJ A;  4Z5S A;  4DYZ A;  2V2M A;  3AK9 A;  3PWF A;  1TK6 A;  2FG8 A;  3R2S A;  3Q4R A;  1JI4 A;  2CEI A;  2VXX A;  3RBC A;  4LPN A;  3R2K A;  2Z5Q A;  4LPJ A;  4YKH A;  3Q4N A;  4TW3 A;  3KA6 A;  5GU1 X;  3E1L A;  1LKO A;  3AJP A;  3HL1 A;  1L8H A;  3SE1 A;  4TOG A;  4IWJ A;  3E1M A;  1JTS A;  5JKL A;  2CHI A;  5LG2 A;  5FFE A;  4P18 A;  3Q4Q A;  1BFR A;  1OTK A;  3UOF A;  2D5K A;  3IS7 A;  2CLB A;  4ITW A;  1O9R A;  1S2Z A;  1HRS A;  3E6R A;  3O7S A;  3RGD A;  5I4J A;  4M32 A;  1JIG A;  2CIH A;  2ZA6 A;  2GYQ A;  2V2O A;  4CVT A;  2HR5 A;  1SQ3 A;  1RCC A;  2QF9 A;  5JKM G;  4DYY A;  1VEQ A;  1XZ1 A;  5J8S A;  4TOF A;  2X17 0;  4DYU A;  3PVT B;  4RC5 B;  1QYB A;  3A68 A;  3PVR A;  3WVU A;  3ISE A;  3RAV A;  3T9J A;  4ZLW A;  4EVD A;  3U90 A;  1VJX A;  4ZL6 A;  5GN8 B;  2YW7 A;  4R42 A;  5LG8 A;  1MFR A;  5D8S A;  2WLA A;  5D8O A;  2XJO A;  1L8I A;  1XZ3 A;  3PW1 B;  4ETR A;  2VXI A;  1YUZ A;  5CZU A;  4Z3B A;  2FHA A;  5HQO A;  4MY7 A;  2FG4 A;  3FI6 A;  1VLG A;  2V2J A;  1FHA A;  1RCI A;  1YV1 A;  2JD8 0;  3Q4O A;  2WTL A;  4PGI A;  1RCG A;  1JKV A;  2YJJ A;  1F30 A;  5GU0 X;  1RYT A;  1DPS A;  2IU2 A;  3PWQ C;  1YUX A;  4ZJK A;  5J93 A;  1LKM A;  3ES3 A;  3WNW A;  4DZ0 A;  3BVE A;  1TKP A;  4REU A;  1TKO A;  3GVY A;  4QUW A;  5K52 A;  4LQJ A;  2RBD A;  4OYN A;  4ITT A;  2XKQ A;  5ERK A;  2FFX J;  4CYA A;  4LYX A;  4MJY A;  4U3G A;  5D8Y A;  4ZL5 A;  3PWQ A;  5GU2 X;  1EUM A;  1JYB A;  4KVS A;  3KA3 A;  2CN7 A;  4LQN A;  5C6F A;  3R2L A;  1R03 A;  3AF9 X;  4DYX A;  2CHP A;  1B71 A;  3QB9 A;  3QVD A;  2XJM A;  4LQH A;  3O7R A;  1Z6O M;  2VZB A;  4KVQ A;  3WVV A;  2V2P A;  3AF8 X;  1NF6 A;  3GE4 A;  3F37 A;  3KA9 A;  1LB3 A;  2GS4 A;  4ML5 A;  2CLU A;  3E6S A;  1TJO A;  3AJO A;  4TOB A;  5LBH A;  5J8W A;  2G4H A;  3QD8 A;  1NFV A;  1MOJ A;  4RC6 B;  1DVB A;  4CMY V;  1BG7 A;  2CN6 A;  1VEI A;  2F7N A;  3BT5 A;  5JKL G;  5AXS A;  2V2I A;  3NP2 X;  3PVT A;  3WVW A;  4RC5 A;  1NNQ A;  1O9I A;  2V15 A;  1S30 A;  4DAS A;  2OC5 A;  4M33 A;  5GOU A;  2JD7 0;  4DI0 A;  5GN8 A;  4EVB A;  1JGC A;  3R2R A;  3AK8 A;  4KVR A;  4LQV A;  1S3Q A;  2ZG8 X;  3UOI A;  3IQ1 A;  5LS9 A;  2BKC A;  1BCF A;  5D8Q A;  3PW1 A;  4Y08 A;  2BK6 A;  4ZKX A;  4TOC A;  4ZTT A;  1VEL A;  2FJC A;  4CVS A;  1QGH A;  4II4 B;  2Z5P A;  3SID A;  4LYU A;  4EVE A;  1RCE A;  4CYB A;  4EVC A;  2OH3 A;  3F36 A;  3ISF A;  1J30 A;  4MKU A;  3F38 A;  3GHQ A;  3BVF A;  2C2U A;  4A25 A;  2V2L A;  3KXU A;  3R2O A;  2YW6 A;  3UNO A;  3RD0 A;  3E2C A;  1GWG A;  2FL0 A;  4DE6 A;  3PVY B;  3HIU A;  1IES A;  2JD6 0;  5J9V A;  3SHX A;  3PZA A;  3F32 A;  3E1P A;  1N1Q A;  3EZU A;  4RC8 A;  4RC7 B;  2ITB A;  3R2H A;  4M35 A;  2IY4 A;  5ERJ A;  4ISM A;  3FVB A;  4ZKH A;  2C41 A;  3IS8 A;  1Z6O A;  4AM4 A;  4ISP A;  4ERU A;  2Y3Q A;  3AF7 X;  1KRQ A;  2V2S A;  1UVH A;  5D8R A;  2ZG7 X;  3E1J A;  2ZUR X;  4XKU A;  3F34 A;  4ZKW A;  1UMN A;  2CF7 A;  4CVP A;  2WLU A;  4CVR A;  3FSE A;  3KWO A;  4CY9 A;  5FFC A;  3KA8 A;  4MN9 A;  2BJY A;  5CMQ A;  3NP0 X;  1JRE A;  2GYD A;  4XKS A;  3BKN A;  5GU3 X;  1RCD A;  3BVI A;  3OGH A;  2XJN A;  1NF4 A;  5JKM A;  3E1O A;  3EZ0 A;  5FFA A;  4TOH A;  1AEW A;  2BW1 A;  2UX1 A;  3R2M A;  3E1N A;  2Z6M A; 
#chains in the Genus database with same CATH topology
 5K53 A;  1JKU A;  3MPS A;  4TO9 A;  4RC6 A;  3V3K B;  4E6K A;  5FFB A;  3QHC A;  4XKT A;  1ZUJ A;  3KA4 A;  4PG1 A;  2Z5R A;  2C2J A;  4IXK A;  4PG0 A;  3F35 A;  4WJG 4;  5JAC A;  3EGM A;  5CMR A;  3AJQ A;  4M34 A;  2V2N A;  4AM5 A;  3F39 A;  5FFD A;  2Z90 A;  2W0O A;  2V8T A;  1SOF A;  4PGK A;  2C2F A;  3FRR A;  3TA8 A;  4CMY A;  2QQY A;  2PYB A;  3KX9 A;  3RE7 A;  3PVR B;  3SH6 A;  3C21 A;  1Z4A A;  3OJ5 A;  3QHB A;  5E1U A;  2ZA7 A;  1LKP A;  3BVL A;  1DAT A;  5IX6 A;  2ZG9 X;  4ZMC A;  5D8P A;  2YJK A;  1H96 A;  4LPM A;  4AM2 A;  3PW8 C;  4II4 A;  4XGS A;  2FZF A;  3L0M A;  2C6R A;  3VNX A;  1F33 A;  4TOE A;  3QZ3 A;  3LKD A;  3A9Q A;  2FKZ A;  2V2R A;  3BVK A;  3PW8 A;  2XGW A;  5HJH A;  4TOA A;  3E1Q A;  3H7G A;  2HTN A;  1JI5 A;  2IB0 A;  3PVY A;  3ERZ A;  5HJF A;  4TOD A;  4W4K B;  1IER A;  4MUD A;  1ZS3 A;  2ZA8 A;  4RC7 A;  4YXM A;  4IWK A;  3F33 A;  5D8X A;  3NOZ X;  5E2D A;  5FEJ A;  4Z5S A;  4DYZ A;  2V2M A;  3AK9 A;  3PWF A;  1TK6 A;  2FG8 A;  3R2S A;  3Q4R A;  1JI4 A;  2CEI A;  2VXX A;  3RBC A;  4LPN A;  3R2K A;  2Z5Q A;  2V8U A;  4LPJ A;  4YKH A;  3Q4N A;  4TW3 A;  3DBY A;  3KA6 A;  5GU1 X;  3E1L A;  1LKO A;  4KXR B;  2MGY A;  3AJP A;  3HL1 A;  1L8H A;  3SE1 A;  4TOG A;  4IWJ A;  3E1M A;  3FRS A;  3JZ9 A;  1JTS A;  5JKL A;  2G38 B;  2CHI A;  5LG2 A;  5FFE A;  4P18 A;  3Q4Q A;  1BFR A;  1OTK A;  3UOF A;  2D5K A;  3IS7 A;  2CLB A;  4ITW A;  1O9R A;  1S2Z A;  1HRS A;  3E6R A;  3O7S A;  3RGD A;  5I4J A;  4M32 A;  1JIG A;  2CIH A;  2ZA6 A;  2GYQ A;  2V2O A;  4CVT A;  2HR5 A;  1SQ3 A;  1RCC A;  3GGY A;  2Y44 A;  2QF9 A;  5JKM G;  4DYY A;  1VEQ A;  1XZ1 A;  5J8S A;  4TOF A;  2X17 0;  4DYU A;  3PVT B;  4RC5 B;  1QYB A;  3A68 A;  3PVR A;  3WVU A;  3ISE A;  3RAV A;  3T9J A;  4ZLW A;  4EVD A;  3U90 A;  1VJX A;  4ZL6 A;  5GN8 B;  2YW7 A;  4R42 A;  5LG8 A;  1MFR A;  5D8S A;  2WLA A;  5D8O A;  2XJO A;  1L8I A;  3GGZ A;  1XZ3 A;  3PW1 B;  4ETR A;  2VXI A;  1YUZ A;  5CZU A;  4Z3B A;  2FHA A;  5HQO A;  4MY7 A;  2FG4 A;  3FI6 A;  1VLG A;  2V2J A;  1FHA A;  1RCI A;  1YV1 A;  2JD8 0;  3Q4O A;  2WWX B;  2WTL A;  4PGI A;  2N02 A;  2OKC A;  1RCG A;  1JKV A;  2YJJ A;  1F30 A;  5JDO B;  5GU0 X;  1RYT A;  1DPS A;  2IU2 A;  3PWQ C;  1YUX A;  4ZJK A;  5J93 A;  1LKM A;  3ES3 A;  3WNW A;  4DZ0 A;  4E40 A;  3BVE A;  1TKP A;  4REU A;  1TKO A;  3GVY A;  4QUW A;  5K52 A;  4LQJ A;  2RBD A;  4OYN A;  4ITT A;  2XKQ A;  5ERK A;  5HU6 D;  2FFX J;  4CYA A;  4LYX A;  4MJY A;  4U3G A;  5D8Y A;  4ZL5 A;  3PWQ A;  5GU2 X;  1EUM A;  1JYB A;  4KVS A;  3KA3 A;  2CN7 A;  4LQN A;  5C6F A;  3R2L A;  1R03 A;  3AF9 X;  4DYX A;  2CHP A;  1B71 A;  3QB9 A;  3QVD A;  3VVA A;  2XJM A;  4LQH A;  3O7R A;  1Z6O M;  3W54 A;  2VZB A;  4KVQ A;  3WVV A;  2V2P A;  3AF8 X;  1NF6 A;  3GE4 A;  3F37 A;  3KA9 A;  1LB3 A;  3D19 A;  2GS4 A;  4ML5 A;  2CLU A;  3E6S A;  1TJO A;  3AJO A;  4TOB A;  5LBH A;  5J8W A;  2G4H A;  3QD8 A;  1NFV A;  1MOJ A;  4RC6 B;  1DVB A;  4CMY V;  1BG7 A;  2CN6 A;  3C23 A;  1VEI A;  2F7N A;  3BT5 A;  5JKL G;  5AXS A;  2V2I A;  3NP2 X;  3PVT A;  3WVW A;  4RC5 A;  1NNQ A;  1O9I A;  2V15 A;  1S30 A;  4DAS A;  2OC5 A;  4M33 A;  5GOU A;  2JD7 0;  4DI0 A;  5GN8 A;  4EVB A;  1JGC A;  3R2R A;  3AK8 A;  4KVR A;  4LQV A;  1S3Q A;  2ZG8 X;  3UOI A;  3IQ1 A;  5LS9 A;  2BKC A;  2CWL A;  1BCF A;  4YVZ A;  5D8Q A;  3PW1 A;  4Y08 A;  2BK6 A;  4ZKX A;  4TOC A;  4X0J A;  4ZTT A;  1VEL A;  2FJC A;  4CVS A;  1QGH A;  4II4 B;  4YXJ A;  2Z5P A;  3SID A;  4LYU A;  4EVE A;  1RCE A;  4CYB A;  4EVC A;  2OH3 A;  3F36 A;  3ISF A;  2AR0 A;  1J30 A;  4MKU A;  3F38 A;  3GHQ A;  3BVF A;  5JDO A;  2C2U A;  3C1Z A;  4A25 A;  3KHK A;  2V2L A;  3KXU A;  3R2O A;  2YW6 A;  3UNO A;  3RD0 A;  3E2C A;  1GWG A;  3JZA B;  2FL0 A;  4DE6 A;  3PVY B;  3HIU A;  1IES A;  2JD6 0;  5J9V A;  3N6O A;  3SHX A;  3PZA A;  3UFB A;  3F32 A;  3M6J A;  3E1P A;  1N1Q A;  3EZU A;  4RC8 A;  4RC7 B;  2ITB A;  3R2H A;  4M35 A;  2IY4 A;  5ERJ A;  4ISM A;  3FVB A;  4ZKH A;  2C41 A;  3IS8 A;  1Z6O A;  4AM4 A;  4ISP A;  4ERU A;  2Y3Q A;  3AF7 X;  1KRQ A;  3VV9 A;  3C1Y A;  2V2S A;  1UVH A;  5D8R A;  2ZG7 X;  3E1J A;  2ZUR X;  4XKU A;  3F34 A;  4ZKW A;  1UMN A;  2CF7 A;  4CVP A;  2WLU A;  4CVR A;  3FSE A;  3KWO A;  4CY9 A;  5FFC A;  3KA8 A;  4MN9 A;  2BJY A;  5CMQ A;  3NP0 X;  1JRE A;  2GYD A;  4XKS A;  3BKN A;  4W4L B;  5GU3 X;  1RCD A;  3BVI A;  3OGH A;  2XJN A;  1NF4 A;  5JKM A;  3E1O A;  3EZ0 A;  5FFA A;  4TOH A;  3KDQ A;  1AEW A;  2BW1 A;  2UX1 A;  3R2M A;  4MXP A;  3E1N A;  2Z6M A; 
#chains in the Genus database with same CATH homology
 5K53 A;  1JKU A;  3MPS A;  4TO9 A;  4RC6 A;  3V3K B;  4E6K A;  5FFB A;  3QHC A;  4XKT A;  1ZUJ A;  3KA4 A;  4PG1 A;  2Z5R A;  2C2J A;  4IXK A;  4PG0 A;  3F35 A;  4WJG 4;  5JAC A;  3EGM A;  5CMR A;  3AJQ A;  4M34 A;  2V2N A;  4AM5 A;  3F39 A;  5FFD A;  2Z90 A;  2W0O A;  2V8T A;  1SOF A;  4PGK A;  2C2F A;  3FRR A;  3TA8 A;  4CMY A;  2QQY A;  2PYB A;  3KX9 A;  3RE7 A;  3PVR B;  3SH6 A;  3C21 A;  1Z4A A;  3OJ5 A;  3QHB A;  5E1U A;  2ZA7 A;  1LKP A;  3BVL A;  1DAT A;  5IX6 A;  2ZG9 X;  4ZMC A;  5D8P A;  2YJK A;  1H96 A;  4LPM A;  4AM2 A;  3PW8 C;  4II4 A;  4XGS A;  2FZF A;  3L0M A;  2C6R A;  3VNX A;  1F33 A;  4TOE A;  3QZ3 A;  3LKD A;  3A9Q A;  2FKZ A;  2V2R A;  3BVK A;  3PW8 A;  2XGW A;  5HJH A;  4TOA A;  3E1Q A;  3H7G A;  2HTN A;  1JI5 A;  2IB0 A;  3PVY A;  3ERZ A;  5HJF A;  4TOD A;  4W4K B;  1IER A;  4MUD A;  1ZS3 A;  2ZA8 A;  4RC7 A;  4YXM A;  4IWK A;  3F33 A;  5D8X A;  3NOZ X;  5E2D A;  5FEJ A;  4Z5S A;  4DYZ A;  2V2M A;  3AK9 A;  3PWF A;  1TK6 A;  2FG8 A;  3R2S A;  3Q4R A;  1JI4 A;  2CEI A;  2VXX A;  3RBC A;  4LPN A;  3R2K A;  2Z5Q A;  2V8U A;  4LPJ A;  4YKH A;  3Q4N A;  4TW3 A;  3DBY A;  3KA6 A;  5GU1 X;  3E1L A;  1LKO A;  4KXR B;  2MGY A;  3AJP A;  3HL1 A;  1L8H A;  3SE1 A;  4TOG A;  4IWJ A;  3E1M A;  3FRS A;  3JZ9 A;  1JTS A;  5JKL A;  2G38 B;  2CHI A;  5LG2 A;  5FFE A;  4P18 A;  3Q4Q A;  1BFR A;  1OTK A;  3UOF A;  2D5K A;  3IS7 A;  2CLB A;  4ITW A;  1O9R A;  1S2Z A;  1HRS A;  3E6R A;  3O7S A;  3RGD A;  5I4J A;  4M32 A;  1JIG A;  2CIH A;  2ZA6 A;  2GYQ A;  2V2O A;  4CVT A;  2HR5 A;  1SQ3 A;  1RCC A;  3GGY A;  2Y44 A;  2QF9 A;  5JKM G;  4DYY A;  1VEQ A;  1XZ1 A;  5J8S A;  4TOF A;  2X17 0;  4DYU A;  3PVT B;  4RC5 B;  1QYB A;  3A68 A;  3PVR A;  3WVU A;  3ISE A;  3RAV A;  3T9J A;  4ZLW A;  4EVD A;  3U90 A;  1VJX A;  4ZL6 A;  5GN8 B;  2YW7 A;  4R42 A;  5LG8 A;  1MFR A;  5D8S A;  2WLA A;  5D8O A;  2XJO A;  1L8I A;  3GGZ A;  1XZ3 A;  3PW1 B;  4ETR A;  2VXI A;  1YUZ A;  5CZU A;  4Z3B A;  2FHA A;  5HQO A;  4MY7 A;  2FG4 A;  3FI6 A;  1VLG A;  2V2J A;  1FHA A;  1RCI A;  1YV1 A;  2JD8 0;  3Q4O A;  2WWX B;  2WTL A;  4PGI A;  2N02 A;  2OKC A;  1RCG A;  1JKV A;  2YJJ A;  1F30 A;  5JDO B;  5GU0 X;  1RYT A;  1DPS A;  2IU2 A;  3PWQ C;  1YUX A;  4ZJK A;  5J93 A;  1LKM A;  3ES3 A;  3WNW A;  4DZ0 A;  4E40 A;  3BVE A;  1TKP A;  4REU A;  1TKO A;  3GVY A;  4QUW A;  5K52 A;  4LQJ A;  2RBD A;  4OYN A;  4ITT A;  2XKQ A;  5ERK A;  5HU6 D;  2FFX J;  4CYA A;  4LYX A;  4MJY A;  4U3G A;  5D8Y A;  4ZL5 A;  3PWQ A;  5GU2 X;  1EUM A;  1JYB A;  4KVS A;  3KA3 A;  2CN7 A;  4LQN A;  5C6F A;  3R2L A;  1R03 A;  3AF9 X;  4DYX A;  2CHP A;  1B71 A;  3QB9 A;  3QVD A;  3VVA A;  2XJM A;  4LQH A;  3O7R A;  1Z6O M;  3W54 A;  2VZB A;  4KVQ A;  3WVV A;  2V2P A;  3AF8 X;  1NF6 A;  3GE4 A;  3F37 A;  3KA9 A;  1LB3 A;  3D19 A;  2GS4 A;  4ML5 A;  2CLU A;  3E6S A;  1TJO A;  3AJO A;  4TOB A;  5LBH A;  5J8W A;  2G4H A;  3QD8 A;  1NFV A;  1MOJ A;  4RC6 B;  1DVB A;  4CMY V;  1BG7 A;  2CN6 A;  3C23 A;  1VEI A;  2F7N A;  3BT5 A;  5JKL G;  5AXS A;  2V2I A;  3NP2 X;  3PVT A;  3WVW A;  4RC5 A;  1NNQ A;  1O9I A;  2V15 A;  1S30 A;  4DAS A;  2OC5 A;  4M33 A;  5GOU A;  2JD7 0;  4DI0 A;  5GN8 A;  4EVB A;  1JGC A;  3R2R A;  3AK8 A;  4KVR A;  4LQV A;  1S3Q A;  2ZG8 X;  3UOI A;  3IQ1 A;  5LS9 A;  2BKC A;  2CWL A;  1BCF A;  4YVZ A;  5D8Q A;  3PW1 A;  4Y08 A;  2BK6 A;  4ZKX A;  4TOC A;  4X0J A;  4ZTT A;  1VEL A;  2FJC A;  4CVS A;  1QGH A;  4II4 B;  4YXJ A;  2Z5P A;  3SID A;  4LYU A;  4EVE A;  1RCE A;  4CYB A;  4EVC A;  2OH3 A;  3F36 A;  3ISF A;  2AR0 A;  1J30 A;  4MKU A;  3F38 A;  3GHQ A;  3BVF A;  5JDO A;  2C2U A;  3C1Z A;  4A25 A;  3KHK A;  2V2L A;  3KXU A;  3R2O A;  2YW6 A;  3UNO A;  3RD0 A;  3E2C A;  1GWG A;  3JZA B;  2FL0 A;  4DE6 A;  3PVY B;  3HIU A;  1IES A;  2JD6 0;  5J9V A;  3N6O A;  3SHX A;  3PZA A;  3UFB A;  3F32 A;  3M6J A;  3E1P A;  1N1Q A;  3EZU A;  4RC8 A;  4RC7 B;  2ITB A;  3R2H A;  4M35 A;  2IY4 A;  5ERJ A;  4ISM A;  3FVB A;  4ZKH A;  2C41 A;  3IS8 A;  1Z6O A;  4AM4 A;  4ISP A;  4ERU A;  2Y3Q A;  3AF7 X;  1KRQ A;  3VV9 A;  3C1Y A;  2V2S A;  1UVH A;  5D8R A;  2ZG7 X;  3E1J A;  2ZUR X;  4XKU A;  3F34 A;  4ZKW A;  1UMN A;  2CF7 A;  4CVP A;  2WLU A;  4CVR A;  3FSE A;  3KWO A;  4CY9 A;  5FFC A;  3KA8 A;  4MN9 A;  2BJY A;  5CMQ A;  3NP0 X;  1JRE A;  2GYD A;  4XKS A;  3BKN A;  4W4L B;  5GU3 X;  1RCD A;  3BVI A;  3OGH A;  2XJN A;  1NF4 A;  5JKM A;  3E1O A;  3EZ0 A;  5FFA A;  4TOH A;  3KDQ A;  1AEW A;  2BW1 A;  2UX1 A;  3R2M A;  4MXP A;  3E1N A;  2Z6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...