5GOUA

Structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
141
Chain Sequence
EAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin heavy chain
publication title Conversion of the Native 24-mer Ferritin Nanocage into Its Non-Native 16-mer Analogue by Insertion of Extra Amino Acid Residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 50
structure length 141
sequence length 168
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5gouA00
4U3GA 3WVVA 4OYNA 5FFAA 2Y3QA 5JKMG 4IXKA 3EZ0A 3PW8C 4M35A 1BFRA 3RAVA 3E6RA 1RYTA 3NP2X 3ES3A 4LQNA 3HL1A 3KA8A 1LB3A 3F32A 4LQJA 2ZURX 4RC7A 1TJOA 3E1LA 5JACA 2BK6A 3KA4A 2V2SA 3E1QA 4AM2A 3VNXA 2V2MA 5D8SA 4CVTA 3BT5A 3Q4OA 5J8SA 4TOHA 4REUA 1GWGA 2D5KA 2BW1A 2Z5PA 4DYUA 3R2LA 4CVSA 4TOFA 1EUMA 4PG0A 3KXUA 5GU3X 2XJNA 2W0OA 5CZUA 2JD80 1F30A 3AJQA 3SH6A 1KRQA 2C6RA 2V2LA 4ISMA 3SE1A 3IS7A 2HTNA 4EVCA 3E1NA 4RC5B 1JYBA 1DPSA 4E6KA 4CYAA 3GHQA 3EGMA 1BG7A 4TOGA 1VLGA 3UOFA 5K53A 3PWQA 3QZ3A 3UOIA 1UMNA 3F38A 3FVBA 2QQYA 4TOAA 3BVIA 4ETRA 1HRSA 2IB0A 1YUXA 4ZLWA 2CN6A 3E1PA 3WNWA 4RC5A 5JKLA 3PZAA 3WVUA 5E1UA 1IESA 4TOCA 4ZL5A 2ZA8A 3OJ5A 3PVTB 1DATA 2V2NA 1TKOA 3RE7A 2G4HA 4LPMA 1BCFA 2FG8A 3NP0X 4DYZA 5LG8A 2ZA7A 4MUDA 5I4JA 1NF6A 5ERJA 2WLUA 2QF9A 4AM4A 4Y08A 2F7NA 3U90A 3F34A 4QUWA 1IERA 4DYXA 3F39A 3QD8A 1O9IA 5D8XA 5JKLG 1QGHA 1L8IA 3PVTA 1NNQA 5D8QA 1DVBA 4TOBA 1LKPA 1N1QA 3PWQC 3R2MA 2CN7A 3EZUA 3AK9A 3KWOA 4P18A 4KVRA 2VZBA 3PVRB 3PVYB 3ISEA 1JKVA 3F33A 3R2SA 1VELA 2Z5RA 1OTKA 3Q4RA 1Z4AA 2RBDA 2WTLA 2GS4A 5LBHA 4DASA 5GU0X 1JREA 4EVDA 1R03A 2FJCA 5HQOA 5CMRA 4ZJKA 2FG4A 3PVRA 2JD70 1JTSA 3PVYA 3RBCA 3TA8A 2CLBA 3AF8X 2Z5QA 4ERUA 4LQVA 1TKPA 3IQ1A 2BJYA 2PYBA 1XZ1A 3AF7X 4ITWA 1VJXA 3OGHA 2HR5A 3E1MA 1YV1A 4ML5A 3O7SA 4XKUA 5D8RA 1ZUJA 5K52A 4DYYA 5D8OA 1TK6A 1AEWA 2UX1A 3E1JA 2CIHA 2FZFA 4Z3BA 3FI6A 5ERKA 1VEIA 5D8YA 1LKOA 1RCEA 2ZG7X 2V2IA 1XZ3A 2GYQA 5J93A 4RC8A 3QB9A 3R2RA 4EVBA 5FFBA 2X170 5D8PA 1YUZA 4ZTTA 3AJOA 3A68A 3BVKA 4AM5A 2CF7A 2YJJA 4A25A 3NOZX 4TW3A 2ZG8X 4CVRA 1NFVA 4CY9A 5FFCA 2FHAA 4ZKWA 4TODA 2VXXA 3QHCA 5LG2A 3PW8A 4KVSA 3R2OA 4CVPA 3AF9X 4MN9A 3O7RA 3F35A 3AK8A 1LKMA 1JGCA 3RGDA 2C2UA 1MFRA 3KA9A 2XJOA 1RCGA 2IY4A 2CHIA 1QYBA 5HJHA 5E2DA 1S3QA 3FSEA 2OC5A 4KVQA 3PW1B 3BVFA 3BVLA 2JD60 1JIGA 2XGWA 2ITBA 4ZKXA 2YJKA 4DZ0A 1ZS3A 3KX9A 4XGSA 2C2JA 1FHAA 3PWFA 1O9RA 1SOFA 5C6FA 1VEQA 2C41A 5IX6A 4DI0A 4IWKA 4MJYA 1JI4A 5FEJA 4PG1A 1F33A 2YW7A 1S2ZA 5FFDA 4XKSA 3UNOA 3H7GA 3PW1A 4LYXA 3SIDA 3SHXA 1JI5A 4LPJA 4ZMCA 3WVWA 4ISPA 4TO9A 4IWJA 1B71A 3KA6A 4CMYV 1RCDA 1L8HA 3IS8A 4PGKA 4M32A 2YW6A 2FKZA 4RC6B 4ZL6A 2OH3A 2Z90A 3E2CA 4MKUA 5GU1X 2V2OA 3R2HA 4YKHA 3HIUA 4R42A 3F36A 2CHPA 2ZG9X 3KA3A 2V15A 4PGIA 3T9JA 2CEIA 4ZKHA 1H96A 4II4B 3BVEA 1S30A 4RC6A 1NF4A 3GVYA 2VXIA 4M34A 5LS9A 4Z5SA 4M33A 3AJPA 1SQ3A 1RCCA 4TOEA 4LQHA 3A9QA 3E1OA 4DE6A 2XKQA 4CMYA 3F37A 4XKTA 2XJMA 3BKNA 2WLAA 2IU2A 3QHBA 4EVEA 4II4A 3E6SA 2ZA6A 4MY7A 2BKCA 2V2PA 3Q4NA 1UVHA 2Z6MA 2CLUA 5GN8B 3GE4A 5JKMA 1Z6OM 2V2JA 5GU2X 2GYDA 3ERZA 2C2FA 3R2KA 5GOUA 2FL0A 5HJFA 5J8WA 3ISFA 5FFEA 4LYUA 3RD0A 3QVDA 4CYBA 5J9VA 2V2RA 2FFXJ 1JKUA 4LPNA 4ITTA 1RCIA 3Q4QA 5AXSA 1MOJA 4RC7B 3MPSA 5CMQA 1Z6OA 5GN8A 1J30A
chains in the Genus database with same CATH superfamily
4U3GA 3WVVA 4OYNA 5FFAA 2Y3QA 5HU6D 5JKMG 4IXKA 3EZ0A 3PW8C 4M35A 1BFRA 3RAVA 3E6RA 1RYTA 3NP2X 3ES3A 4LQNA 3HL1A 3KA8A 1LB3A 3F32A 4LQJA 2ZURX 3DBYA 4RC7A 1TJOA 3E1LA 5JACA 2BK6A 3KA4A 2V2SA 3E1QA 4AM2A 3VNXA 2V2MA 5D8SA 2AR0A 3BT5A 3Q4OA 4CVTA 5J8SA 4MXPA 2V8TA 3KDQA 4TOHA 4REUA 1GWGA 2D5KA 2BW1A 2Z5PA 4DYUA 3R2LA 4CVSA 4TOFA 1EUMA 4PG0A 3KXUA 5GU3X 2XJNA 2W0OA 5CZUA 2V8UA 2JD80 1F30A 3AJQA 3SH6A 1KRQA 2C6RA 2V2LA 4ISMA 3SE1A 3W54A 3IS7A 2HTNA 4EVCA 3E1NA 4RC5B 1JYBA 1DPSA 4E6KA 4CYAA 3GHQA 3EGMA 1BG7A 4TOGA 1VLGA 3UOFA 3L0MA 5K53A 3PWQA 3QZ3A 3UOIA 1UMNA 3F38A 3FVBA 2QQYA 3C1YA 4TOAA 3BVIA 3KHKA 3VVAA 4ETRA 1HRSA 4KXRB 3UFBA 2IB0A 1YUXA 4ZLWA 2CN6A 3E1PA 3WNWA 4RC5A 5JKLA 3PZAA 3WVUA 4YXJA 5E1UA 1IESA 4TOCA 4ZL5A 2ZA8A 3OJ5A 3PVTB 1DATA 2V2NA 1TKOA 3RE7A 2G4HA 4LPMA 1BCFA 2FG8A 3NP0X 4DYZA 5LG8A 2ZA7A 4MUDA 5I4JA 1NF6A 5ERJA 2WLUA 2QF9A 4AM4A 4Y08A 2F7NA 3C1ZA 2Y44A 3F34A 4QUWA 3U90A 1IERA 4DYXA 3F39A 3QD8A 1O9IA 5D8XA 5JKLG 1QGHA 1L8IA 3C21A 3PVTA 1NNQA 5JDOB 5D8QA 1DVBA 4TOBA 1LKPA 1N1QA 3PWQC 3R2MA 2CN7A 3EZUA 3AK9A 3KWOA 4P18A 4KVRA 2VZBA 3PVRB 4YXMA 3PVYB 3ISEA 1JKVA 3F33A 3R2SA 1VELA 2Z5RA 1OTKA 3Q4RA 1Z4AA 2RBDA 2WTLA 2GS4A 5LBHA 4DASA 5GU0X 1JREA 4EVDA 1R03A 5JDOA 2FJCA 5HQOA 5CMRA 4ZJKA 2FG4A 3PVRA 2JD70 1JTSA 3PVYA 3RBCA 3TA8A 2CLBA 3AF8X 2Z5QA 4ERUA 4LQVA 1TKPA 3IQ1A 2BJYA 2PYBA 1XZ1A 3AF7X 3V3KB 4ITWA 1VJXA 3OGHA 2HR5A 3E1MA 1YV1A 4ML5A 3O7SA 4XKUA 5D8RA 1ZUJA 5K52A 4DYYA 5D8OA 1TK6A 3VV9A 1AEWA 3M6JA 2UX1A 4W4LB 3E1JA 3C23A 2CIHA 2FZFA 4Z3BA 3FI6A 5ERKA 1VEIA 5D8YA 1LKOA 1RCEA 2ZG7X 2V2IA 1XZ3A 2GYQA 5J93A 2G38B 4RC8A 3QB9A 3R2RA 4EVBA 5FFBA 2X170 5D8PA 1YUZA 4ZTTA 3AJOA 3A68A 3BVKA 4AM5A 2CF7A 2YJJA 4A25A 3NOZX 4TW3A 2ZG8X 4CVRA 1NFVA 4E40A 4CY9A 5FFCA 2FHAA 4ZKWA 4TODA 2VXXA 3QHCA 5LG2A 3PW8A 4KVSA 3R2OA 4CVPA 3AF9X 4MN9A 3JZ9A 3O7RA 3F35A 3AK8A 1LKMA 1JGCA 3RGDA 2C2UA 3LKDA 1MFRA 3KA9A 2XJOA 1RCGA 2IY4A 2CHIA 1QYBA 5HJHA 5E2DA 1S3QA 3FSEA 2OC5A 4KVQA 3PW1B 3BVFA 3BVLA 2JD60 1JIGA 2XGWA 2ITBA 4ZKXA 2YJKA 4W4KB 4DZ0A 1ZS3A 3KX9A 4XGSA 2C2JA 1FHAA 3PWFA 1O9RA 1SOFA 5C6FA 1VEQA 2C41A 5IX6A 4DI0A 4IWKA 4MJYA 1JI4A 5FEJA 4PG1A 1F33A 2OKCA 2YW7A 1S2ZA 4X0JA 5FFDA 4XKSA 3UNOA 3H7GA 2WWXB 3PW1A 4LYXA 3SIDA 3SHXA 1JI5A 4LPJA 4ZMCA 3WVWA 4ISPA 4TO9A 4IWJA 1B71A 3KA6A 4CMYV 1RCDA 1L8HA 3IS8A 4PGKA 4M32A 2YW6A 2FKZA 4RC6B 4ZL6A 2OH3A 2Z90A 3E2CA 4YVZA 3N6OA 4MKUA 5GU1X 2V2OA 3R2HA 4YKHA 3HIUA 4R42A 3F36A 2CHPA 3GGYA 3FRRA 2ZG9X 3KA3A 2V15A 4PGIA 3T9JA 2CEIA 4ZKHA 1H96A 4II4B 3BVEA 1S30A 4RC6A 1NF4A 3GVYA 2MGYA 2VXIA 4M34A 5LS9A 4Z5SA 4M33A 3AJPA 1SQ3A 1RCCA 4TOEA 4LQHA 3A9QA 3E1OA 4DE6A 2XKQA 4CMYA 3F37A 4XKTA 3JZAB 2XJMA 3BKNA 2WLAA 2IU2A 3QHBA 2CWLA 4EVEA 4II4A 4WJG4 3E6SA 2ZA6A 4MY7A 2BKCA 3FRSA 3GGZA 2N02A 2V2PA 3Q4NA 1UVHA 2Z6MA 2CLUA 5GN8B 3GE4A 5JKMA 1Z6OM 2V2JA 5GU2X 2GYDA 3ERZA 2C2FA 3R2KA 5GOUA 2FL0A 5HJFA 5J8WA 3ISFA 5FFEA 4LYUA 3RD0A 3QVDA 4CYBA 5J9VA 2V2RA 2FFXJ 1JKUA 4LPNA 4ITTA 1RCIA 3Q4QA 5AXSA 1MOJA 4RC7B 3MPSA 3D19A 5CMQA 1Z6OA 5GN8A 1J30A
chains in the Genus database with same CATH topology
4U3GA 3WVVA 4OYNA 5FFAA 2Y3QA 5HU6D 5JKMG 4IXKA 3EZ0A 3PW8C 4M35A 1BFRA 3RAVA 3E6RA 1RYTA 3NP2X 3ES3A 4LQNA 3HL1A 3KA8A 1LB3A 3F32A 4LQJA 2ZURX 3DBYA 4RC7A 1TJOA 3E1LA 5JACA 2BK6A 3KA4A 2V2SA 3E1QA 4AM2A 3VNXA 2V2MA 5D8SA 2AR0A 3BT5A 3Q4OA 4CVTA 5J8SA 4MXPA 2V8TA 3KDQA 4TOHA 4REUA 1GWGA 2D5KA 2BW1A 2Z5PA 4DYUA 3R2LA 4CVSA 4TOFA 1EUMA 4PG0A 3KXUA 5GU3X 2XJNA 2W0OA 5CZUA 2V8UA 2JD80 1F30A 3AJQA 3SH6A 1KRQA 2C6RA 2V2LA 4ISMA 3SE1A 3W54A 3IS7A 2HTNA 4EVCA 3E1NA 4RC5B 1JYBA 1DPSA 4E6KA 4CYAA 3GHQA 3EGMA 1BG7A 4TOGA 1VLGA 3UOFA 3L0MA 5K53A 3PWQA 3QZ3A 3UOIA 1UMNA 3F38A 3FVBA 2QQYA 3C1YA 4TOAA 3BVIA 3KHKA 3VVAA 4ETRA 1HRSA 4KXRB 3UFBA 2IB0A 1YUXA 4ZLWA 2CN6A 3E1PA 3WNWA 4RC5A 5JKLA 3PZAA 3WVUA 4YXJA 5E1UA 1IESA 4TOCA 4ZL5A 2ZA8A 3OJ5A 3PVTB 1DATA 2V2NA 1TKOA 3RE7A 2G4HA 4LPMA 1BCFA 2FG8A 3NP0X 4DYZA 5LG8A 2ZA7A 4MUDA 5I4JA 1NF6A 5ERJA 2WLUA 2QF9A 4AM4A 4Y08A 2F7NA 3C1ZA 2Y44A 3F34A 4QUWA 3U90A 1IERA 4DYXA 3F39A 3QD8A 1O9IA 5D8XA 5JKLG 1QGHA 1L8IA 3C21A 3PVTA 1NNQA 5JDOB 5D8QA 1DVBA 4TOBA 1LKPA 1N1QA 3PWQC 3R2MA 2CN7A 3EZUA 3AK9A 3KWOA 4P18A 4KVRA 2VZBA 3PVRB 4YXMA 3PVYB 3ISEA 1JKVA 3F33A 3R2SA 1VELA 2Z5RA 1OTKA 3Q4RA 1Z4AA 2RBDA 2WTLA 2GS4A 5LBHA 4DASA 5GU0X 1JREA 4EVDA 1R03A 5JDOA 2FJCA 5HQOA 5CMRA 4ZJKA 2FG4A 3PVRA 2JD70 1JTSA 3PVYA 3RBCA 3TA8A 2CLBA 3AF8X 2Z5QA 4ERUA 4LQVA 1TKPA 3IQ1A 2BJYA 2PYBA 1XZ1A 3AF7X 3V3KB 4ITWA 1VJXA 3OGHA 2HR5A 3E1MA 1YV1A 4ML5A 3O7SA 4XKUA 5D8RA 1ZUJA 5K52A 4DYYA 5D8OA 1TK6A 3VV9A 1AEWA 3M6JA 2UX1A 4W4LB 3E1JA 3C23A 2CIHA 2FZFA 4Z3BA 3FI6A 5ERKA 1VEIA 5D8YA 1LKOA 1RCEA 2ZG7X 2V2IA 1XZ3A 2GYQA 5J93A 2G38B 4RC8A 3QB9A 3R2RA 4EVBA 5FFBA 2X170 5D8PA 1YUZA 4ZTTA 3AJOA 3A68A 3BVKA 4AM5A 2CF7A 2YJJA 4A25A 3NOZX 4TW3A 2ZG8X 4CVRA 1NFVA 4E40A 4CY9A 5FFCA 2FHAA 4ZKWA 4TODA 2VXXA 3QHCA 5LG2A 3PW8A 4KVSA 3R2OA 4CVPA 3AF9X 4MN9A 3JZ9A 3O7RA 3F35A 3AK8A 1LKMA 1JGCA 3RGDA 2C2UA 3LKDA 1MFRA 3KA9A 2XJOA 1RCGA 2IY4A 2CHIA 1QYBA 5HJHA 5E2DA 1S3QA 3FSEA 2OC5A 4KVQA 3PW1B 3BVFA 3BVLA 2JD60 1JIGA 2XGWA 2ITBA 4ZKXA 2YJKA 4W4KB 4DZ0A 1ZS3A 3KX9A 4XGSA 2C2JA 1FHAA 3PWFA 1O9RA 1SOFA 5C6FA 1VEQA 2C41A 5IX6A 4DI0A 4IWKA 4MJYA 1JI4A 5FEJA 4PG1A 1F33A 2OKCA 2YW7A 1S2ZA 4X0JA 5FFDA 4XKSA 3UNOA 3H7GA 2WWXB 3PW1A 4LYXA 3SIDA 3SHXA 1JI5A 4LPJA 4ZMCA 3WVWA 4ISPA 4TO9A 4IWJA 1B71A 3KA6A 4CMYV 1RCDA 1L8HA 3IS8A 4PGKA 4M32A 2YW6A 2FKZA 4RC6B 4ZL6A 2OH3A 2Z90A 3E2CA 4YVZA 3N6OA 4MKUA 5GU1X 2V2OA 3R2HA 4YKHA 3HIUA 4R42A 3F36A 2CHPA 3GGYA 3FRRA 2ZG9X 3KA3A 2V15A 4PGIA 3T9JA 2CEIA 4ZKHA 1H96A 4II4B 3BVEA 1S30A 4RC6A 1NF4A 3GVYA 2MGYA 2VXIA 4M34A 5LS9A 4Z5SA 4M33A 3AJPA 1SQ3A 1RCCA 4TOEA 4LQHA 3A9QA 3E1OA 4DE6A 2XKQA 4CMYA 3F37A 4XKTA 3JZAB 2XJMA 3BKNA 2WLAA 2IU2A 3QHBA 2CWLA 4EVEA 4II4A 4WJG4 3E6SA 2ZA6A 4MY7A 2BKCA 3FRSA 3GGZA 2N02A 2V2PA 3Q4NA 1UVHA 2Z6MA 2CLUA 5GN8B 3GE4A 5JKMA 1Z6OM 2V2JA 5GU2X 2GYDA 3ERZA 2C2FA 3R2KA 5GOUA 2FL0A 5HJFA 5J8WA 3ISFA 5FFEA 4LYUA 3RD0A 3QVDA 4CYBA 5J9VA 2V2RA 2FFXJ 1JKUA 4LPNA 4ITTA 1RCIA 3Q4QA 5AXSA 1MOJA 4RC7B 3MPSA 3D19A 5CMQA 1Z6OA 5GN8A 1J30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3G A;  3WVV A;  4OYN A;  5FFA A;  2Y3Q A;  5JKM G;  4IXK A;  3EZ0 A;  3PW8 C;  4M35 A;  1BFR A;  3RAV A;  3E6R A;  1RYT A;  3NP2 X;  3ES3 A;  4LQN A;  3HL1 A;  3KA8 A;  1LB3 A;  3F32 A;  4LQJ A;  2ZUR X;  4RC7 A;  1TJO A;  3E1L A;  5JAC A;  2BK6 A;  3KA4 A;  2V2S A;  3E1Q A;  4AM2 A;  3VNX A;  2V2M A;  5D8S A;  4CVT A;  3BT5 A;  3Q4O A;  5J8S A;  4TOH A;  4REU A;  1GWG A;  2D5K A;  2BW1 A;  2Z5P A;  4DYU A;  3R2L A;  4CVS A;  4TOF A;  1EUM A;  4PG0 A;  3KXU A;  5GU3 X;  2XJN A;  2W0O A;  5CZU A;  2JD8 0;  1F30 A;  3AJQ A;  3SH6 A;  1KRQ A;  2C6R A;  2V2L A;  4ISM A;  3SE1 A;  3IS7 A;  2HTN A;  4EVC A;  3E1N A;  4RC5 B;  1JYB A;  1DPS A;  4E6K A;  4CYA A;  3GHQ A;  3EGM A;  1BG7 A;  4TOG A;  1VLG A;  3UOF A;  5K53 A;  3PWQ A;  3QZ3 A;  3UOI A;  1UMN A;  3F38 A;  3FVB A;  2QQY A;  4TOA A;  3BVI A;  4ETR A;  1HRS A;  2IB0 A;  1YUX A;  4ZLW A;  2CN6 A;  3E1P A;  3WNW A;  4RC5 A;  5JKL A;  3PZA A;  3WVU A;  5E1U A;  1IES A;  4TOC A;  4ZL5 A;  2ZA8 A;  3OJ5 A;  3PVT B;  1DAT A;  2V2N A;  1TKO A;  3RE7 A;  2G4H A;  4LPM A;  1BCF A;  2FG8 A;  3NP0 X;  4DYZ A;  5LG8 A;  2ZA7 A;  4MUD A;  5I4J A;  1NF6 A;  5ERJ A;  2WLU A;  2QF9 A;  4AM4 A;  4Y08 A;  2F7N A;  3U90 A;  3F34 A;  4QUW A;  1IER A;  4DYX A;  3F39 A;  3QD8 A;  1O9I A;  5D8X A;  5JKL G;  1QGH A;  1L8I A;  3PVT A;  1NNQ A;  5D8Q A;  1DVB A;  4TOB A;  1LKP A;  1N1Q A;  3PWQ C;  3R2M A;  2CN7 A;  3EZU A;  3AK9 A;  3KWO A;  4P18 A;  4KVR A;  2VZB A;  3PVR B;  3PVY B;  3ISE A;  1JKV A;  3F33 A;  3R2S A;  1VEL A;  2Z5R A;  1OTK A;  3Q4R A;  1Z4A A;  2RBD A;  2WTL A;  2GS4 A;  5LBH A;  4DAS A;  5GU0 X;  1JRE A;  4EVD A;  1R03 A;  2FJC A;  5HQO A;  5CMR A;  4ZJK A;  2FG4 A;  3PVR A;  2JD7 0;  1JTS A;  3PVY A;  3RBC A;  3TA8 A;  2CLB A;  3AF8 X;  2Z5Q A;  4ERU A;  4LQV A;  1TKP A;  3IQ1 A;  2BJY A;  2PYB A;  1XZ1 A;  3AF7 X;  4ITW A;  1VJX A;  3OGH A;  2HR5 A;  3E1M A;  1YV1 A;  4ML5 A;  3O7S A;  4XKU A;  5D8R A;  1ZUJ A;  5K52 A;  4DYY A;  5D8O A;  1TK6 A;  1AEW A;  2UX1 A;  3E1J A;  2CIH A;  2FZF A;  4Z3B A;  3FI6 A;  5ERK A;  1VEI A;  5D8Y A;  1LKO A;  1RCE A;  2ZG7 X;  2V2I A;  1XZ3 A;  2GYQ A;  5J93 A;  4RC8 A;  3QB9 A;  3R2R A;  4EVB A;  5FFB A;  2X17 0;  5D8P A;  1YUZ A;  4ZTT A;  3AJO A;  3A68 A;  3BVK A;  4AM5 A;  2CF7 A;  2YJJ A;  4A25 A;  3NOZ X;  4TW3 A;  2ZG8 X;  4CVR A;  1NFV A;  4CY9 A;  5FFC A;  2FHA A;  4ZKW A;  4TOD A;  2VXX A;  3QHC A;  5LG2 A;  3PW8 A;  4KVS A;  3R2O A;  4CVP A;  3AF9 X;  4MN9 A;  3O7R A;  3F35 A;  3AK8 A;  1LKM A;  1JGC A;  3RGD A;  2C2U A;  1MFR A;  3KA9 A;  2XJO A;  1RCG A;  2IY4 A;  2CHI A;  1QYB A;  5HJH A;  5E2D A;  1S3Q A;  3FSE A;  2OC5 A;  4KVQ A;  3PW1 B;  3BVF A;  3BVL A;  2JD6 0;  1JIG A;  2XGW A;  2ITB A;  4ZKX A;  2YJK A;  4DZ0 A;  1ZS3 A;  3KX9 A;  4XGS A;  2C2J A;  1FHA A;  3PWF A;  1O9R A;  1SOF A;  5C6F A;  1VEQ A;  2C41 A;  5IX6 A;  4DI0 A;  4IWK A;  4MJY A;  1JI4 A;  5FEJ A;  4PG1 A;  1F33 A;  2YW7 A;  1S2Z A;  5FFD A;  4XKS A;  3UNO A;  3H7G A;  3PW1 A;  4LYX A;  3SID A;  3SHX A;  1JI5 A;  4LPJ A;  4ZMC A;  3WVW A;  4ISP A;  4TO9 A;  4IWJ A;  1B71 A;  3KA6 A;  4CMY V;  1RCD A;  1L8H A;  3IS8 A;  4PGK A;  4M32 A;  2YW6 A;  2FKZ A;  4RC6 B;  4ZL6 A;  2OH3 A;  2Z90 A;  3E2C A;  4MKU A;  5GU1 X;  2V2O A;  3R2H A;  4YKH A;  3HIU A;  4R42 A;  3F36 A;  2CHP A;  2ZG9 X;  3KA3 A;  2V15 A;  4PGI A;  3T9J A;  2CEI A;  4ZKH A;  1H96 A;  4II4 B;  3BVE A;  1S30 A;  4RC6 A;  1NF4 A;  3GVY A;  2VXI A;  4M34 A;  5LS9 A;  4Z5S A;  4M33 A;  3AJP A;  1SQ3 A;  1RCC A;  4TOE A;  4LQH A;  3A9Q A;  3E1O A;  4DE6 A;  2XKQ A;  4CMY A;  3F37 A;  4XKT A;  2XJM A;  3BKN A;  2WLA A;  2IU2 A;  3QHB A;  4EVE A;  4II4 A;  3E6S A;  2ZA6 A;  4MY7 A;  2BKC A;  2V2P A;  3Q4N A;  1UVH A;  2Z6M A;  2CLU A;  5GN8 B;  3GE4 A;  5JKM A;  1Z6O M;  2V2J A;  5GU2 X;  2GYD A;  3ERZ A;  2C2F A;  3R2K A;  5GOU A;  2FL0 A;  5HJF A;  5J8W A;  3ISF A;  5FFE A;  4LYU A;  3RD0 A;  3QVD A;  4CYB A;  5J9V A;  2V2R A;  2FFX J;  1JKU A;  4LPN A;  4ITT A;  1RCI A;  3Q4Q A;  5AXS A;  1MOJ A;  4RC7 B;  3MPS A;  5CMQ A;  1Z6O A;  5GN8 A;  1J30 A; 
#chains in the Genus database with same CATH topology
 4U3G A;  3WVV A;  4OYN A;  5FFA A;  2Y3Q A;  5HU6 D;  5JKM G;  4IXK A;  3EZ0 A;  3PW8 C;  4M35 A;  1BFR A;  3RAV A;  3E6R A;  1RYT A;  3NP2 X;  3ES3 A;  4LQN A;  3HL1 A;  3KA8 A;  1LB3 A;  3F32 A;  4LQJ A;  2ZUR X;  3DBY A;  4RC7 A;  1TJO A;  3E1L A;  5JAC A;  2BK6 A;  3KA4 A;  2V2S A;  3E1Q A;  4AM2 A;  3VNX A;  2V2M A;  5D8S A;  2AR0 A;  3BT5 A;  3Q4O A;  4CVT A;  5J8S A;  4MXP A;  2V8T A;  3KDQ A;  4TOH A;  4REU A;  1GWG A;  2D5K A;  2BW1 A;  2Z5P A;  4DYU A;  3R2L A;  4CVS A;  4TOF A;  1EUM A;  4PG0 A;  3KXU A;  5GU3 X;  2XJN A;  2W0O A;  5CZU A;  2V8U A;  2JD8 0;  1F30 A;  3AJQ A;  3SH6 A;  1KRQ A;  2C6R A;  2V2L A;  4ISM A;  3SE1 A;  3W54 A;  3IS7 A;  2HTN A;  4EVC A;  3E1N A;  4RC5 B;  1JYB A;  1DPS A;  4E6K A;  4CYA A;  3GHQ A;  3EGM A;  1BG7 A;  4TOG A;  1VLG A;  3UOF A;  3L0M A;  5K53 A;  3PWQ A;  3QZ3 A;  3UOI A;  1UMN A;  3F38 A;  3FVB A;  2QQY A;  3C1Y A;  4TOA A;  3BVI A;  3KHK A;  3VVA A;  4ETR A;  1HRS A;  4KXR B;  3UFB A;  2IB0 A;  1YUX A;  4ZLW A;  2CN6 A;  3E1P A;  3WNW A;  4RC5 A;  5JKL A;  3PZA A;  3WVU A;  4YXJ A;  5E1U A;  1IES A;  4TOC A;  4ZL5 A;  2ZA8 A;  3OJ5 A;  3PVT B;  1DAT A;  2V2N A;  1TKO A;  3RE7 A;  2G4H A;  4LPM A;  1BCF A;  2FG8 A;  3NP0 X;  4DYZ A;  5LG8 A;  2ZA7 A;  4MUD A;  5I4J A;  1NF6 A;  5ERJ A;  2WLU A;  2QF9 A;  4AM4 A;  4Y08 A;  2F7N A;  3C1Z A;  2Y44 A;  3F34 A;  4QUW A;  3U90 A;  1IER A;  4DYX A;  3F39 A;  3QD8 A;  1O9I A;  5D8X A;  5JKL G;  1QGH A;  1L8I A;  3C21 A;  3PVT A;  1NNQ A;  5JDO B;  5D8Q A;  1DVB A;  4TOB A;  1LKP A;  1N1Q A;  3PWQ C;  3R2M A;  2CN7 A;  3EZU A;  3AK9 A;  3KWO A;  4P18 A;  4KVR A;  2VZB A;  3PVR B;  4YXM A;  3PVY B;  3ISE A;  1JKV A;  3F33 A;  3R2S A;  1VEL A;  2Z5R A;  1OTK A;  3Q4R A;  1Z4A A;  2RBD A;  2WTL A;  2GS4 A;  5LBH A;  4DAS A;  5GU0 X;  1JRE A;  4EVD A;  1R03 A;  5JDO A;  2FJC A;  5HQO A;  5CMR A;  4ZJK A;  2FG4 A;  3PVR A;  2JD7 0;  1JTS A;  3PVY A;  3RBC A;  3TA8 A;  2CLB A;  3AF8 X;  2Z5Q A;  4ERU A;  4LQV A;  1TKP A;  3IQ1 A;  2BJY A;  2PYB A;  1XZ1 A;  3AF7 X;  3V3K B;  4ITW A;  1VJX A;  3OGH A;  2HR5 A;  3E1M A;  1YV1 A;  4ML5 A;  3O7S A;  4XKU A;  5D8R A;  1ZUJ A;  5K52 A;  4DYY A;  5D8O A;  1TK6 A;  3VV9 A;  1AEW A;  3M6J A;  2UX1 A;  4W4L B;  3E1J A;  3C23 A;  2CIH A;  2FZF A;  4Z3B A;  3FI6 A;  5ERK A;  1VEI A;  5D8Y A;  1LKO A;  1RCE A;  2ZG7 X;  2V2I A;  1XZ3 A;  2GYQ A;  5J93 A;  2G38 B;  4RC8 A;  3QB9 A;  3R2R A;  4EVB A;  5FFB A;  2X17 0;  5D8P A;  1YUZ A;  4ZTT A;  3AJO A;  3A68 A;  3BVK A;  4AM5 A;  2CF7 A;  2YJJ A;  4A25 A;  3NOZ X;  4TW3 A;  2ZG8 X;  4CVR A;  1NFV A;  4E40 A;  4CY9 A;  5FFC A;  2FHA A;  4ZKW A;  4TOD A;  2VXX A;  3QHC A;  5LG2 A;  3PW8 A;  4KVS A;  3R2O A;  4CVP A;  3AF9 X;  4MN9 A;  3JZ9 A;  3O7R A;  3F35 A;  3AK8 A;  1LKM A;  1JGC A;  3RGD A;  2C2U A;  3LKD A;  1MFR A;  3KA9 A;  2XJO A;  1RCG A;  2IY4 A;  2CHI A;  1QYB A;  5HJH A;  5E2D A;  1S3Q A;  3FSE A;  2OC5 A;  4KVQ A;  3PW1 B;  3BVF A;  3BVL A;  2JD6 0;  1JIG A;  2XGW A;  2ITB A;  4ZKX A;  2YJK A;  4W4K B;  4DZ0 A;  1ZS3 A;  3KX9 A;  4XGS A;  2C2J A;  1FHA A;  3PWF A;  1O9R A;  1SOF A;  5C6F A;  1VEQ A;  2C41 A;  5IX6 A;  4DI0 A;  4IWK A;  4MJY A;  1JI4 A;  5FEJ A;  4PG1 A;  1F33 A;  2OKC A;  2YW7 A;  1S2Z A;  4X0J A;  5FFD A;  4XKS A;  3UNO A;  3H7G A;  2WWX B;  3PW1 A;  4LYX A;  3SID A;  3SHX A;  1JI5 A;  4LPJ A;  4ZMC A;  3WVW A;  4ISP A;  4TO9 A;  4IWJ A;  1B71 A;  3KA6 A;  4CMY V;  1RCD A;  1L8H A;  3IS8 A;  4PGK A;  4M32 A;  2YW6 A;  2FKZ A;  4RC6 B;  4ZL6 A;  2OH3 A;  2Z90 A;  3E2C A;  4YVZ A;  3N6O A;  4MKU A;  5GU1 X;  2V2O A;  3R2H A;  4YKH A;  3HIU A;  4R42 A;  3F36 A;  2CHP A;  3GGY A;  3FRR A;  2ZG9 X;  3KA3 A;  2V15 A;  4PGI A;  3T9J A;  2CEI A;  4ZKH A;  1H96 A;  4II4 B;  3BVE A;  1S30 A;  4RC6 A;  1NF4 A;  3GVY A;  2MGY A;  2VXI A;  4M34 A;  5LS9 A;  4Z5S A;  4M33 A;  3AJP A;  1SQ3 A;  1RCC A;  4TOE A;  4LQH A;  3A9Q A;  3E1O A;  4DE6 A;  2XKQ A;  4CMY A;  3F37 A;  4XKT A;  3JZA B;  2XJM A;  3BKN A;  2WLA A;  2IU2 A;  3QHB A;  2CWL A;  4EVE A;  4II4 A;  4WJG 4;  3E6S A;  2ZA6 A;  4MY7 A;  2BKC A;  3FRS A;  3GGZ A;  2N02 A;  2V2P A;  3Q4N A;  1UVH A;  2Z6M A;  2CLU A;  5GN8 B;  3GE4 A;  5JKM A;  1Z6O M;  2V2J A;  5GU2 X;  2GYD A;  3ERZ A;  2C2F A;  3R2K A;  5GOU A;  2FL0 A;  5HJF A;  5J8W A;  3ISF A;  5FFE A;  4LYU A;  3RD0 A;  3QVD A;  4CYB A;  5J9V A;  2V2R A;  2FFX J;  1JKU A;  4LPN A;  4ITT A;  1RCI A;  3Q4Q A;  5AXS A;  1MOJ A;  4RC7 B;  3MPS A;  3D19 A;  5CMQ A;  1Z6O A;  5GN8 A;  1J30 A; 
#chains in the Genus database with same CATH homology
 4U3G A;  3WVV A;  4OYN A;  5FFA A;  2Y3Q A;  5HU6 D;  5JKM G;  4IXK A;  3EZ0 A;  3PW8 C;  4M35 A;  1BFR A;  3RAV A;  3E6R A;  1RYT A;  3NP2 X;  3ES3 A;  4LQN A;  3HL1 A;  3KA8 A;  1LB3 A;  3F32 A;  4LQJ A;  2ZUR X;  3DBY A;  4RC7 A;  1TJO A;  3E1L A;  5JAC A;  2BK6 A;  3KA4 A;  2V2S A;  3E1Q A;  4AM2 A;  3VNX A;  2V2M A;  5D8S A;  2AR0 A;  3BT5 A;  3Q4O A;  4CVT A;  5J8S A;  4MXP A;  2V8T A;  3KDQ A;  4TOH A;  4REU A;  1GWG A;  2D5K A;  2BW1 A;  2Z5P A;  4DYU A;  3R2L A;  4CVS A;  4TOF A;  1EUM A;  4PG0 A;  3KXU A;  5GU3 X;  2XJN A;  2W0O A;  5CZU A;  2V8U A;  2JD8 0;  1F30 A;  3AJQ A;  3SH6 A;  1KRQ A;  2C6R A;  2V2L A;  4ISM A;  3SE1 A;  3W54 A;  3IS7 A;  2HTN A;  4EVC A;  3E1N A;  4RC5 B;  1JYB A;  1DPS A;  4E6K A;  4CYA A;  3GHQ A;  3EGM A;  1BG7 A;  4TOG A;  1VLG A;  3UOF A;  3L0M A;  5K53 A;  3PWQ A;  3QZ3 A;  3UOI A;  1UMN A;  3F38 A;  3FVB A;  2QQY A;  3C1Y A;  4TOA A;  3BVI A;  3KHK A;  3VVA A;  4ETR A;  1HRS A;  4KXR B;  3UFB A;  2IB0 A;  1YUX A;  4ZLW A;  2CN6 A;  3E1P A;  3WNW A;  4RC5 A;  5JKL A;  3PZA A;  3WVU A;  4YXJ A;  5E1U A;  1IES A;  4TOC A;  4ZL5 A;  2ZA8 A;  3OJ5 A;  3PVT B;  1DAT A;  2V2N A;  1TKO A;  3RE7 A;  2G4H A;  4LPM A;  1BCF A;  2FG8 A;  3NP0 X;  4DYZ A;  5LG8 A;  2ZA7 A;  4MUD A;  5I4J A;  1NF6 A;  5ERJ A;  2WLU A;  2QF9 A;  4AM4 A;  4Y08 A;  2F7N A;  3C1Z A;  2Y44 A;  3F34 A;  4QUW A;  3U90 A;  1IER A;  4DYX A;  3F39 A;  3QD8 A;  1O9I A;  5D8X A;  5JKL G;  1QGH A;  1L8I A;  3C21 A;  3PVT A;  1NNQ A;  5JDO B;  5D8Q A;  1DVB A;  4TOB A;  1LKP A;  1N1Q A;  3PWQ C;  3R2M A;  2CN7 A;  3EZU A;  3AK9 A;  3KWO A;  4P18 A;  4KVR A;  2VZB A;  3PVR B;  4YXM A;  3PVY B;  3ISE A;  1JKV A;  3F33 A;  3R2S A;  1VEL A;  2Z5R A;  1OTK A;  3Q4R A;  1Z4A A;  2RBD A;  2WTL A;  2GS4 A;  5LBH A;  4DAS A;  5GU0 X;  1JRE A;  4EVD A;  1R03 A;  5JDO A;  2FJC A;  5HQO A;  5CMR A;  4ZJK A;  2FG4 A;  3PVR A;  2JD7 0;  1JTS A;  3PVY A;  3RBC A;  3TA8 A;  2CLB A;  3AF8 X;  2Z5Q A;  4ERU A;  4LQV A;  1TKP A;  3IQ1 A;  2BJY A;  2PYB A;  1XZ1 A;  3AF7 X;  3V3K B;  4ITW A;  1VJX A;  3OGH A;  2HR5 A;  3E1M A;  1YV1 A;  4ML5 A;  3O7S A;  4XKU A;  5D8R A;  1ZUJ A;  5K52 A;  4DYY A;  5D8O A;  1TK6 A;  3VV9 A;  1AEW A;  3M6J A;  2UX1 A;  4W4L B;  3E1J A;  3C23 A;  2CIH A;  2FZF A;  4Z3B A;  3FI6 A;  5ERK A;  1VEI A;  5D8Y A;  1LKO A;  1RCE A;  2ZG7 X;  2V2I A;  1XZ3 A;  2GYQ A;  5J93 A;  2G38 B;  4RC8 A;  3QB9 A;  3R2R A;  4EVB A;  5FFB A;  2X17 0;  5D8P A;  1YUZ A;  4ZTT A;  3AJO A;  3A68 A;  3BVK A;  4AM5 A;  2CF7 A;  2YJJ A;  4A25 A;  3NOZ X;  4TW3 A;  2ZG8 X;  4CVR A;  1NFV A;  4E40 A;  4CY9 A;  5FFC A;  2FHA A;  4ZKW A;  4TOD A;  2VXX A;  3QHC A;  5LG2 A;  3PW8 A;  4KVS A;  3R2O A;  4CVP A;  3AF9 X;  4MN9 A;  3JZ9 A;  3O7R A;  3F35 A;  3AK8 A;  1LKM A;  1JGC A;  3RGD A;  2C2U A;  3LKD A;  1MFR A;  3KA9 A;  2XJO A;  1RCG A;  2IY4 A;  2CHI A;  1QYB A;  5HJH A;  5E2D A;  1S3Q A;  3FSE A;  2OC5 A;  4KVQ A;  3PW1 B;  3BVF A;  3BVL A;  2JD6 0;  1JIG A;  2XGW A;  2ITB A;  4ZKX A;  2YJK A;  4W4K B;  4DZ0 A;  1ZS3 A;  3KX9 A;  4XGS A;  2C2J A;  1FHA A;  3PWF A;  1O9R A;  1SOF A;  5C6F A;  1VEQ A;  2C41 A;  5IX6 A;  4DI0 A;  4IWK A;  4MJY A;  1JI4 A;  5FEJ A;  4PG1 A;  1F33 A;  2OKC A;  2YW7 A;  1S2Z A;  4X0J A;  5FFD A;  4XKS A;  3UNO A;  3H7G A;  2WWX B;  3PW1 A;  4LYX A;  3SID A;  3SHX A;  1JI5 A;  4LPJ A;  4ZMC A;  3WVW A;  4ISP A;  4TO9 A;  4IWJ A;  1B71 A;  3KA6 A;  4CMY V;  1RCD A;  1L8H A;  3IS8 A;  4PGK A;  4M32 A;  2YW6 A;  2FKZ A;  4RC6 B;  4ZL6 A;  2OH3 A;  2Z90 A;  3E2C A;  4YVZ A;  3N6O A;  4MKU A;  5GU1 X;  2V2O A;  3R2H A;  4YKH A;  3HIU A;  4R42 A;  3F36 A;  2CHP A;  3GGY A;  3FRR A;  2ZG9 X;  3KA3 A;  2V15 A;  4PGI A;  3T9J A;  2CEI A;  4ZKH A;  1H96 A;  4II4 B;  3BVE A;  1S30 A;  4RC6 A;  1NF4 A;  3GVY A;  2MGY A;  2VXI A;  4M34 A;  5LS9 A;  4Z5S A;  4M33 A;  3AJP A;  1SQ3 A;  1RCC A;  4TOE A;  4LQH A;  3A9Q A;  3E1O A;  4DE6 A;  2XKQ A;  4CMY A;  3F37 A;  4XKT A;  3JZA B;  2XJM A;  3BKN A;  2WLA A;  2IU2 A;  3QHB A;  2CWL A;  4EVE A;  4II4 A;  4WJG 4;  3E6S A;  2ZA6 A;  4MY7 A;  2BKC A;  3FRS A;  3GGZ A;  2N02 A;  2V2P A;  3Q4N A;  1UVH A;  2Z6M A;  2CLU A;  5GN8 B;  3GE4 A;  5JKM A;  1Z6O M;  2V2J A;  5GU2 X;  2GYD A;  3ERZ A;  2C2F A;  3R2K A;  5GOU A;  2FL0 A;  5HJF A;  5J8W A;  3ISF A;  5FFE A;  4LYU A;  3RD0 A;  3QVD A;  4CYB A;  5J9V A;  2V2R A;  2FFX J;  1JKU A;  4LPN A;  4ITT A;  1RCI A;  3Q4Q A;  5AXS A;  1MOJ A;  4RC7 B;  3MPS A;  3D19 A;  5CMQ A;  1Z6O A;  5GN8 A;  1J30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...