5GOUA

Structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
168
structure length
141
Chain Sequence
EAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin heavy chain
publication title Conversion of the Native 24-mer Ferritin Nanocage into Its Non-Native 16-mer Analogue by Insertion of Extra Amino Acid Residues.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 141
sequence length 168
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2016-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5gouA00
5ERKA 4EVEA 2JD80 5FFCA 1RCEA 4OYNA 1XZ1A 5GU3X 3KA6A 4LQVA 1LKPA 3QVDA 2XJNA 5J8SA 3O7SA 1O9RA 4ZKWA 4REUA 4LQNA 2CLBA 4MN9A 1JGCA 1ZUJA 3A9QA 3UNOA 3GVYA 1L8IA 3GHQA 3PZAA 4LYUA 5FFAA 4II4A 5E2DA 1EUMA 4ML5A 5K53A 3E1NA 4PG0A 4CYBA 4MKUA 2ZA7A 4CMYA 3AF8X 2FG4A 5LG8A 4RC6B 2ZURX 1RCDA 3OGHA 5CZUA 5JKMG 5JKLG 5FFDA 3PWFA 5D8SA 3PVTB 2FHAA 3R2OA 2VXXA 4PG1A 1F30A 3U90A 4CY9A 3T9JA 2Z5PA 2BW1A 2W0OA 3IS8A 4TW3A 3F35A 2HTNA 1IESA 3R2RA 2XJMA 4TOHA 1JI4A 3GE4A 2CHPA 3E6SA 5D8XA 5AXSA 4CYAA 4TODA 3BVLA 2VZBA 4M32A 3BVKA 3WVUA 1DPSA 5I4JA 2JD70 2X170 4TOFA 1FHAA 1MOJA 4CVPA 2ITBA 3E1OA 5ERJA 1XZ3A 2V2IA 2Z90A 2D5KA 3WVVA 2G4HA 4KVSA 1BG7A 5FEJA 3ISFA 4KVQA 3PW1A 3PW8A 2QQYA 2ZG7X 1JREA 3ERZA 3PVYA 3KA9A 1VEQA 4M33A 3AJOA 4MUDA 4TOBA 1GWGA 3IS7A 5GN8A 1Z4AA 4DYYA 3F34A 4CVRA 4ZKXA 3F36A 4XGSA 2HR5A 3EZ0A 1MFRA 3KA3A 4MJYA 4Z5SA 2CLUA 2V2JA 1IERA 3Q4RA 2XJOA 1SQ3A 4IWJA 5HQOA 1NFVA 2UX1A 3PVRA 1SOFA 3E1QA 4DYZA 3R2MA 5JACA 4EVDA 2V2LA 3FSEA 3R2LA 4TOEA 1S2ZA 5FFEA 2OC5A 3RBCA 4AM5A 3KA8A 3E2CA 5E1UA 3Q4QA 5GU2X 5JKMA 3PWQA 5JKLA 3NP0X 5CMRA 3AK9A 4DE6A 4U3GA 4RC8A 3BVFA 4DYXA 2C2JA 2GYDA 4IWKA 2FJCA 3E1LA 3QHBA 2V2OA 2WLUA 2BJYA 5HJHA 3Q4NA 3PW8C 3TA8A 3KWOA 1BCFA 2RBDA 4QUWA 4RC7B 2CIHA 4ITWA 2FL0A 1R03A 4P18A 2VXIA 3RD0A 3E6RA 3HL1A 1VELA 4CMYV 3RAVA 5D8QA 3UOIA 1QYBA 3O7RA 4ITTA 3E1PA 5GU1X 1RCGA 4ZLWA 4RC6A 3WVWA 4A25A 2CF7A 3F37A 4DASA 5GOUA 1VJXA 1NF4A 3FVBA 2YW6A 1JTSA 3SIDA 5GU0X 4ISMA 1TKPA 3PVTA 4ZKHA 1ZS3A 4DZ0A 5K52A 2YW7A 4Z3BA 2Z6MA 3PW1B 4TOGA 3F39A 2FKZA 2FG8A 1JI5A 3E1MA 4ZJKA 3MPSA 1UVHA 4ISPA 3PWQC 3QZ3A 3E1JA 3KA4A 5D8RA 5GN8B 2FZFA 1YV1A 3R2HA 5J9VA 2WTLA 3R2KA 3R2SA 2ZG8X 3SH6A 3H7GA 3F32A 5D8PA 4ZMCA 1VEIA 1AEWA 2OH3A 4IXKA 3PVRB 1RCCA 2V2PA 4RC5A 3IQ1A 4TO9A 4M34A 3QHCA 2CHIA 3Q4OA 2CN6A 1TJOA 2FFXJ 3ES3A 1O9IA 1RYTA 3VNXA 5IX6A 2ZA8A 3QD8A 1RCIA 3BVIA 3EGMA 2C41A 4II4B 2Z5RA 1LB3A 2V2SA 3HIUA 3AJPA 4EVCA 1YUXA 3KX9A 2V2MA 4EVBA 1DVBA 2XKQA 4LYXA 5LG2A 4LPJA 4TOAA 1L8HA 4DYUA 1B71A 1N1QA 2V2RA 2V2NA 3SHXA 2ZA6A 3BVEA 5LS9A 5CMQA 3BKNA 5J8WA 5D8YA 2WLAA 2BKCA 5D8OA 4ZL6A 3EZUA 5FFBA 4KVRA 3RGDA 2CEIA 2V15A 1JYBA 1JKUA 4MY7A 3AF7X 2JD60 2ZG9X 2C6RA 3AJQA 1KRQA 2BK6A 2C2FA 3KXUA 4M35A 4LPMA 1BFRA 4CVTA 1H96A 2XGWA 4ZL5A 1J30A 1F33A 1QGHA 3AK8A 1S3QA 3NOZX 4AM2A 3AF9X 3SE1A 2YJJA 2CN7A 1LKMA 3UOFA 4TOCA 3RE7A 4RC7A 2F7NA 4ERUA 4PGKA 3PVYB 3OJ5A 1LKOA 2Y3QA 4R42A 4CVSA 2C2UA 1NF6A 5J93A 5LBHA 3ISEA 2IB0A 2IY4A 2YJKA 3A68A 1HRSA 3F38A 4RC5B 4ZTTA 1Z6OM 1TKOA 4DI0A 4YKHA 1JKVA 2QF9A 5C6FA 1TK6A 2PYBA 1NNQA 1DATA 2IU2A 3BT5A 3NP2X 1JIGA 4XKSA 3F33A 2Z5QA 4PGIA 1YUZA 3FI6A 4LQJA 3QB9A 2GS4A 4Y08A 1UMNA 1Z6OA 4LPNA 4XKTA 5HJFA 4AM4A 4LQHA 1OTKA 4XKUA 1S30A 2GYQA 4E6KA 4ETRA 3WNWA 1VLGA
chains in the Genus database with same CATH superfamily
5ERKA 3DBYA 4EVEA 2JD80 5FFCA 1RCEA 4OYNA 1XZ1A 5GU3X 3KA6A 4LQVA 1LKPA 3QVDA 2XJNA 5J8SA 3O7SA 1O9RA 4ZKWA 4REUA 4LQNA 2CLBA 4MN9A 1JGCA 1ZUJA 3A9QA 3UNOA 3GVYA 1L8IA 3GHQA 3PZAA 4LYUA 5FFAA 4II4A 5E2DA 1EUMA 4ML5A 5K53A 3E1NA 4PG0A 4CYBA 4MKUA 2ZA7A 4CMYA 3AF8X 2FG4A 5LG8A 4RC6B 2ZURX 1RCDA 3OGHA 5CZUA 5JKMG 5JKLG 3VV9A 5JDOA 5FFDA 3PWFA 5D8SA 4YXJA 3PVTB 3UFBA 2FHAA 3R2OA 2VXXA 4PG1A 1F30A 3U90A 4CY9A 2V8UA 3T9JA 2Z5PA 2BW1A 2W0OA 3IS8A 4TW3A 3F35A 2HTNA 1IESA 3R2RA 2XJMA 4TOHA 1JI4A 3GE4A 3C23A 2CHPA 3E6SA 5D8XA 5AXSA 4CYAA 4TODA 4YVZA 3JZ9A 2V8TA 3BVLA 2VZBA 4M32A 3BVKA 3V3KB 3WVUA 1DPSA 5I4JA 2JD70 2X170 4TOFA 1FHAA 1MOJA 4CVPA 2ITBA 3E1OA 5ERJA 1XZ3A 2V2IA 2Z90A 2D5KA 3WVVA 3LKDA 2G4HA 3FRRA 4KVSA 1BG7A 5FEJA 3ISFA 4KVQA 3PW1A 3PW8A 2QQYA 2ZG7X 1JREA 3C1ZA 3ERZA 3PVYA 3KA9A 3FRSA 4W4KB 1VEQA 4M33A 3AJOA 4MUDA 4TOBA 1GWGA 3IS7A 5GN8A 1Z4AA 4X0JA 4DYYA 3F34A 4CVRA 4ZKXA 3F36A 4XGSA 2HR5A 3EZ0A 1MFRA 3KA3A 4MJYA 4Z5SA 2CLUA 2V2JA 1IERA 3Q4RA 2XJOA 1SQ3A 4IWJA 5HQOA 1NFVA 2UX1A 3PVRA 1SOFA 3E1QA 4DYZA 3R2MA 5JACA 4EVDA 2V2LA 3FSEA 3R2LA 4TOEA 1S2ZA 5FFEA 2OC5A 3RBCA 4AM5A 3KA8A 3E2CA 5E1UA 3Q4QA 5GU2X 5JKMA 3PWQA 5JKLA 3NP0X 5CMRA 3AK9A 4DE6A 4U3GA 4RC8A 3BVFA 4DYXA 5JDOB 2C2JA 2GYDA 4IWKA 2FJCA 3E1LA 3QHBA 2V2OA 2WLUA 2BJYA 5HJHA 3Q4NA 3PW8C 3TA8A 3KWOA 1BCFA 2RBDA 4QUWA 4RC7B 2N02A 2CIHA 4ITWA 2FL0A 1R03A 4P18A 2VXIA 3RD0A 3E6RA 3HL1A 1VELA 4CMYV 3RAVA 5D8QA 3UOIA 1QYBA 3O7RA 4ITTA 3E1PA 4WJG4 5GU1X 1RCGA 4ZLWA 4RC6A 3WVWA 4A25A 2CF7A 3F37A 4DASA 5GOUA 1VJXA 1NF4A 3FVBA 2YW6A 1JTSA 3SIDA 5GU0X 3W54A 4ISMA 1TKPA 3PVTA 4ZKHA 1ZS3A 4DZ0A 5K52A 2YW7A 4Z3BA 2Z6MA 3PW1B 4TOGA 3F39A 2FKZA 2FG8A 1JI5A 2Y44A 3E1MA 4ZJKA 3MPSA 1UVHA 4ISPA 3PWQC 3QZ3A 3E1JA 3GGZA 3KHKA 3KA4A 5D8RA 5GN8B 2FZFA 1YV1A 3R2HA 5J9VA 2WTLA 2CWLA 3R2KA 3R2SA 2ZG8X 3SH6A 3H7GA 3VVAA 3F32A 5D8PA 4ZMCA 1VEIA 1AEWA 2OH3A 4IXKA 2OKCA 3PVRB 1RCCA 2V2PA 4RC5A 3IQ1A 4TO9A 4M34A 3QHCA 2CHIA 3Q4OA 2CN6A 1TJOA 2FFXJ 3ES3A 1O9IA 1RYTA 3VNXA 5IX6A 2ZA8A 3QD8A 1RCIA 3BVIA 3EGMA 2C41A 4II4B 2Z5RA 3HIUA 1LB3A 2V2SA 3AJPA 4EVCA 3N6OA 1YUXA 3KX9A 2V2MA 4EVBA 1DVBA 2XKQA 4LYXA 5LG2A 4LPJA 4TOAA 1L8HA 4DYUA 1B71A 1N1QA 2V2RA 2V2NA 3SHXA 2ZA6A 3D19A 3BVEA 5LS9A 5CMQA 3BKNA 5J8WA 5D8YA 2WLAA 2BKCA 5D8OA 4ZL6A 3EZUA 5HU6D 5FFBA 4KVRA 3RGDA 2CEIA 2V15A 1JYBA 1JKUA 2G38B 4W4LB 4MY7A 3AF7X 2JD60 2ZG9X 2C6RA 3AJQA 1KRQA 2MGYA 2AR0A 2BK6A 2C2FA 3KXUA 4M35A 4LPMA 1BFRA 4CVTA 1H96A 2XGWA 4ZL5A 1J30A 1F33A 1QGHA 3AK8A 1S3QA 3NOZX 4AM2A 3AF9X 3SE1A 2WWXB 2YJJA 2CN7A 1LKMA 3UOFA 3KDQA 4TOCA 3RE7A 4RC7A 3L0MA 2F7NA 3JZAB 4ERUA 4YXMA 4PGKA 3GGYA 3OJ5A 1LKOA 3PVYB 2Y3QA 4R42A 4CVSA 2C2UA 1NF6A 5J93A 5LBHA 3ISEA 2IB0A 2IY4A 2YJKA 3A68A 1HRSA 3F38A 4RC5B 4ZTTA 3C21A 1Z6OM 1TKOA 4DI0A 4YKHA 1JKVA 2QF9A 3C1YA 5C6FA 1TK6A 4E40A 2PYBA 1NNQA 1DATA 2IU2A 3BT5A 3NP2X 1JIGA 4XKSA 3F33A 2Z5QA 4KXRB 4PGIA 1YUZA 3FI6A 4LQJA 4MXPA 3QB9A 2GS4A 4Y08A 1UMNA 1Z6OA 4LPNA 4XKTA 5HJFA 4AM4A 4LQHA 1OTKA 4XKUA 1S30A 2GYQA 4E6KA 4ETRA 3WNWA 1VLGA 3M6JA
chains in the Genus database with same CATH topology
5ERKA 3DBYA 4EVEA 2JD80 5FFCA 1RCEA 4OYNA 1XZ1A 5GU3X 3KA6A 4LQVA 1LKPA 3QVDA 2XJNA 5J8SA 3O7SA 1O9RA 4ZKWA 4REUA 4LQNA 2CLBA 4MN9A 1JGCA 1ZUJA 3A9QA 3UNOA 3GVYA 1L8IA 3GHQA 3PZAA 4LYUA 5FFAA 4II4A 5E2DA 1EUMA 4ML5A 5K53A 3E1NA 4PG0A 4CYBA 4MKUA 2ZA7A 4CMYA 3AF8X 2FG4A 5LG8A 4RC6B 2ZURX 1RCDA 3OGHA 5CZUA 5JKMG 5JKLG 3VV9A 5JDOA 5FFDA 3PWFA 5D8SA 4YXJA 3PVTB 3UFBA 2FHAA 3R2OA 2VXXA 4PG1A 1F30A 3U90A 4CY9A 2V8UA 3T9JA 2Z5PA 2BW1A 2W0OA 3IS8A 4TW3A 3F35A 2HTNA 1IESA 3R2RA 2XJMA 4TOHA 1JI4A 3GE4A 3C23A 2CHPA 3E6SA 5D8XA 5AXSA 4CYAA 4TODA 4YVZA 3JZ9A 2V8TA 3BVLA 2VZBA 4M32A 3BVKA 3V3KB 3WVUA 1DPSA 5I4JA 2JD70 2X170 4TOFA 1FHAA 1MOJA 4CVPA 2ITBA 3E1OA 5ERJA 1XZ3A 2V2IA 2Z90A 2D5KA 3WVVA 3LKDA 2G4HA 3FRRA 4KVSA 1BG7A 5FEJA 3ISFA 4KVQA 3PW1A 3PW8A 2QQYA 2ZG7X 1JREA 3C1ZA 3ERZA 3PVYA 3KA9A 3FRSA 4W4KB 1VEQA 4M33A 3AJOA 4MUDA 4TOBA 1GWGA 3IS7A 5GN8A 1Z4AA 4X0JA 4DYYA 3F34A 4CVRA 4ZKXA 3F36A 4XGSA 2HR5A 3EZ0A 1MFRA 3KA3A 4MJYA 4Z5SA 2CLUA 2V2JA 1IERA 3Q4RA 2XJOA 1SQ3A 4IWJA 5HQOA 1NFVA 2UX1A 3PVRA 1SOFA 3E1QA 4DYZA 3R2MA 5JACA 4EVDA 2V2LA 3FSEA 3R2LA 4TOEA 1S2ZA 5FFEA 2OC5A 3RBCA 4AM5A 3KA8A 3E2CA 5E1UA 3Q4QA 5GU2X 5JKMA 3PWQA 5JKLA 3NP0X 5CMRA 3AK9A 4DE6A 4U3GA 4RC8A 3BVFA 4DYXA 5JDOB 2C2JA 2GYDA 4IWKA 2FJCA 3E1LA 3QHBA 2V2OA 2WLUA 2BJYA 5HJHA 3Q4NA 3PW8C 3TA8A 3KWOA 1BCFA 2RBDA 4QUWA 4RC7B 2N02A 2CIHA 4ITWA 2FL0A 1R03A 4P18A 2VXIA 3RD0A 3E6RA 3HL1A 1VELA 4CMYV 3RAVA 5D8QA 3UOIA 1QYBA 3O7RA 4ITTA 3E1PA 4WJG4 5GU1X 1RCGA 4ZLWA 4RC6A 3WVWA 4A25A 2CF7A 3F37A 4DASA 5GOUA 1VJXA 1NF4A 3FVBA 2YW6A 1JTSA 3SIDA 5GU0X 3W54A 4ISMA 1TKPA 3PVTA 4ZKHA 1ZS3A 4DZ0A 5K52A 2YW7A 4Z3BA 2Z6MA 3PW1B 4TOGA 3F39A 2FKZA 2FG8A 1JI5A 2Y44A 3E1MA 4ZJKA 3MPSA 1UVHA 4ISPA 3PWQC 3QZ3A 3E1JA 3GGZA 3KHKA 3KA4A 5D8RA 5GN8B 2FZFA 1YV1A 3R2HA 5J9VA 2WTLA 2CWLA 3R2KA 3R2SA 2ZG8X 3SH6A 3H7GA 3VVAA 3F32A 5D8PA 4ZMCA 1VEIA 1AEWA 2OH3A 4IXKA 2OKCA 3PVRB 1RCCA 2V2PA 4RC5A 3IQ1A 4TO9A 4M34A 3QHCA 2CHIA 3Q4OA 2CN6A 1TJOA 2FFXJ 3ES3A 1O9IA 1RYTA 3VNXA 5IX6A 2ZA8A 3QD8A 1RCIA 3BVIA 3EGMA 2C41A 4II4B 2Z5RA 3HIUA 1LB3A 2V2SA 3AJPA 4EVCA 3N6OA 1YUXA 3KX9A 2V2MA 4EVBA 1DVBA 2XKQA 4LYXA 5LG2A 4LPJA 4TOAA 1L8HA 4DYUA 1B71A 1N1QA 2V2RA 2V2NA 3SHXA 2ZA6A 3D19A 3BVEA 5LS9A 5CMQA 3BKNA 5J8WA 5D8YA 2WLAA 2BKCA 5D8OA 4ZL6A 3EZUA 5HU6D 5FFBA 4KVRA 3RGDA 2CEIA 2V15A 1JYBA 1JKUA 2G38B 4W4LB 4MY7A 3AF7X 2JD60 2ZG9X 2C6RA 3AJQA 1KRQA 2MGYA 2AR0A 2BK6A 2C2FA 3KXUA 4M35A 4LPMA 1BFRA 4CVTA 1H96A 2XGWA 4ZL5A 1J30A 1F33A 1QGHA 3AK8A 1S3QA 3NOZX 4AM2A 3AF9X 3SE1A 2WWXB 2YJJA 2CN7A 1LKMA 3UOFA 3KDQA 4TOCA 3RE7A 4RC7A 3L0MA 2F7NA 3JZAB 4ERUA 4YXMA 4PGKA 3GGYA 3OJ5A 1LKOA 3PVYB 2Y3QA 4R42A 4CVSA 2C2UA 1NF6A 5J93A 5LBHA 3ISEA 2IB0A 2IY4A 2YJKA 3A68A 1HRSA 3F38A 4RC5B 4ZTTA 3C21A 1Z6OM 1TKOA 4DI0A 4YKHA 1JKVA 2QF9A 3C1YA 5C6FA 1TK6A 4E40A 2PYBA 1NNQA 1DATA 2IU2A 3BT5A 3NP2X 1JIGA 4XKSA 3F33A 2Z5QA 4KXRB 4PGIA 1YUZA 3FI6A 4LQJA 4MXPA 3QB9A 2GS4A 4Y08A 1UMNA 1Z6OA 4LPNA 4XKTA 5HJFA 4AM4A 4LQHA 1OTKA 4XKUA 1S30A 2GYQA 4E6KA 4ETRA 3WNWA 1VLGA 3M6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ERK A;  4EVE A;  2JD8 0;  5FFC A;  1RCE A;  4OYN A;  1XZ1 A;  5GU3 X;  3KA6 A;  4LQV A;  1LKP A;  3QVD A;  2XJN A;  5J8S A;  3O7S A;  1O9R A;  4ZKW A;  4REU A;  4LQN A;  2CLB A;  4MN9 A;  1JGC A;  1ZUJ A;  3A9Q A;  3UNO A;  3GVY A;  1L8I A;  3GHQ A;  3PZA A;  4LYU A;  5FFA A;  4II4 A;  5E2D A;  1EUM A;  4ML5 A;  5K53 A;  3E1N A;  4PG0 A;  4CYB A;  4MKU A;  2ZA7 A;  4CMY A;  3AF8 X;  2FG4 A;  5LG8 A;  4RC6 B;  2ZUR X;  1RCD A;  3OGH A;  5CZU A;  5JKM G;  5JKL G;  5FFD A;  3PWF A;  5D8S A;  3PVT B;  2FHA A;  3R2O A;  2VXX A;  4PG1 A;  1F30 A;  3U90 A;  4CY9 A;  3T9J A;  2Z5P A;  2BW1 A;  2W0O A;  3IS8 A;  4TW3 A;  3F35 A;  2HTN A;  1IES A;  3R2R A;  2XJM A;  4TOH A;  1JI4 A;  3GE4 A;  2CHP A;  3E6S A;  5D8X A;  5AXS A;  4CYA A;  4TOD A;  3BVL A;  2VZB A;  4M32 A;  3BVK A;  3WVU A;  1DPS A;  5I4J A;  2JD7 0;  2X17 0;  4TOF A;  1FHA A;  1MOJ A;  4CVP A;  2ITB A;  3E1O A;  5ERJ A;  1XZ3 A;  2V2I A;  2Z90 A;  2D5K A;  3WVV A;  2G4H A;  4KVS A;  1BG7 A;  5FEJ A;  3ISF A;  4KVQ A;  3PW1 A;  3PW8 A;  2QQY A;  2ZG7 X;  1JRE A;  3ERZ A;  3PVY A;  3KA9 A;  1VEQ A;  4M33 A;  3AJO A;  4MUD A;  4TOB A;  1GWG A;  3IS7 A;  5GN8 A;  1Z4A A;  4DYY A;  3F34 A;  4CVR A;  4ZKX A;  3F36 A;  4XGS A;  2HR5 A;  3EZ0 A;  1MFR A;  3KA3 A;  4MJY A;  4Z5S A;  2CLU A;  2V2J A;  1IER A;  3Q4R A;  2XJO A;  1SQ3 A;  4IWJ A;  5HQO A;  1NFV A;  2UX1 A;  3PVR A;  1SOF A;  3E1Q A;  4DYZ A;  3R2M A;  5JAC A;  4EVD A;  2V2L A;  3FSE A;  3R2L A;  4TOE A;  1S2Z A;  5FFE A;  2OC5 A;  3RBC A;  4AM5 A;  3KA8 A;  3E2C A;  5E1U A;  3Q4Q A;  5GU2 X;  5JKM A;  3PWQ A;  5JKL A;  3NP0 X;  5CMR A;  3AK9 A;  4DE6 A;  4U3G A;  4RC8 A;  3BVF A;  4DYX A;  2C2J A;  2GYD A;  4IWK A;  2FJC A;  3E1L A;  3QHB A;  2V2O A;  2WLU A;  2BJY A;  5HJH A;  3Q4N A;  3PW8 C;  3TA8 A;  3KWO A;  1BCF A;  2RBD A;  4QUW A;  4RC7 B;  2CIH A;  4ITW A;  2FL0 A;  1R03 A;  4P18 A;  2VXI A;  3RD0 A;  3E6R A;  3HL1 A;  1VEL A;  4CMY V;  3RAV A;  5D8Q A;  3UOI A;  1QYB A;  3O7R A;  4ITT A;  3E1P A;  5GU1 X;  1RCG A;  4ZLW A;  4RC6 A;  3WVW A;  4A25 A;  2CF7 A;  3F37 A;  4DAS A;  5GOU A;  1VJX A;  1NF4 A;  3FVB A;  2YW6 A;  1JTS A;  3SID A;  5GU0 X;  4ISM A;  1TKP A;  3PVT A;  4ZKH A;  1ZS3 A;  4DZ0 A;  5K52 A;  2YW7 A;  4Z3B A;  2Z6M A;  3PW1 B;  4TOG A;  3F39 A;  2FKZ A;  2FG8 A;  1JI5 A;  3E1M A;  4ZJK A;  3MPS A;  1UVH A;  4ISP A;  3PWQ C;  3QZ3 A;  3E1J A;  3KA4 A;  5D8R A;  5GN8 B;  2FZF A;  1YV1 A;  3R2H A;  5J9V A;  2WTL A;  3R2K A;  3R2S A;  2ZG8 X;  3SH6 A;  3H7G A;  3F32 A;  5D8P A;  4ZMC A;  1VEI A;  1AEW A;  2OH3 A;  4IXK A;  3PVR B;  1RCC A;  2V2P A;  4RC5 A;  3IQ1 A;  4TO9 A;  4M34 A;  3QHC A;  2CHI A;  3Q4O A;  2CN6 A;  1TJO A;  2FFX J;  3ES3 A;  1O9I A;  1RYT A;  3VNX A;  5IX6 A;  2ZA8 A;  3QD8 A;  1RCI A;  3BVI A;  3EGM A;  2C41 A;  4II4 B;  2Z5R A;  1LB3 A;  2V2S A;  3HIU A;  3AJP A;  4EVC A;  1YUX A;  3KX9 A;  2V2M A;  4EVB A;  1DVB A;  2XKQ A;  4LYX A;  5LG2 A;  4LPJ A;  4TOA A;  1L8H A;  4DYU A;  1B71 A;  1N1Q A;  2V2R A;  2V2N A;  3SHX A;  2ZA6 A;  3BVE A;  5LS9 A;  5CMQ A;  3BKN A;  5J8W A;  5D8Y A;  2WLA A;  2BKC A;  5D8O A;  4ZL6 A;  3EZU A;  5FFB A;  4KVR A;  3RGD A;  2CEI A;  2V15 A;  1JYB A;  1JKU A;  4MY7 A;  3AF7 X;  2JD6 0;  2ZG9 X;  2C6R A;  3AJQ A;  1KRQ A;  2BK6 A;  2C2F A;  3KXU A;  4M35 A;  4LPM A;  1BFR A;  4CVT A;  1H96 A;  2XGW A;  4ZL5 A;  1J30 A;  1F33 A;  1QGH A;  3AK8 A;  1S3Q A;  3NOZ X;  4AM2 A;  3AF9 X;  3SE1 A;  2YJJ A;  2CN7 A;  1LKM A;  3UOF A;  4TOC A;  3RE7 A;  4RC7 A;  2F7N A;  4ERU A;  4PGK A;  3PVY B;  3OJ5 A;  1LKO A;  2Y3Q A;  4R42 A;  4CVS A;  2C2U A;  1NF6 A;  5J93 A;  5LBH A;  3ISE A;  2IB0 A;  2IY4 A;  2YJK A;  3A68 A;  1HRS A;  3F38 A;  4RC5 B;  4ZTT A;  1Z6O M;  1TKO A;  4DI0 A;  4YKH A;  1JKV A;  2QF9 A;  5C6F A;  1TK6 A;  2PYB A;  1NNQ A;  1DAT A;  2IU2 A;  3BT5 A;  3NP2 X;  1JIG A;  4XKS A;  3F33 A;  2Z5Q A;  4PGI A;  1YUZ A;  3FI6 A;  4LQJ A;  3QB9 A;  2GS4 A;  4Y08 A;  1UMN A;  1Z6O A;  4LPN A;  4XKT A;  5HJF A;  4AM4 A;  4LQH A;  1OTK A;  4XKU A;  1S30 A;  2GYQ A;  4E6K A;  4ETR A;  3WNW A;  1VLG A; 
#chains in the Genus database with same CATH topology
 5ERK A;  3DBY A;  4EVE A;  2JD8 0;  5FFC A;  1RCE A;  4OYN A;  1XZ1 A;  5GU3 X;  3KA6 A;  4LQV A;  1LKP A;  3QVD A;  2XJN A;  5J8S A;  3O7S A;  1O9R A;  4ZKW A;  4REU A;  4LQN A;  2CLB A;  4MN9 A;  1JGC A;  1ZUJ A;  3A9Q A;  3UNO A;  3GVY A;  1L8I A;  3GHQ A;  3PZA A;  4LYU A;  5FFA A;  4II4 A;  5E2D A;  1EUM A;  4ML5 A;  5K53 A;  3E1N A;  4PG0 A;  4CYB A;  4MKU A;  2ZA7 A;  4CMY A;  3AF8 X;  2FG4 A;  5LG8 A;  4RC6 B;  2ZUR X;  1RCD A;  3OGH A;  5CZU A;  5JKM G;  5JKL G;  3VV9 A;  5JDO A;  5FFD A;  3PWF A;  5D8S A;  4YXJ A;  3PVT B;  3UFB A;  2FHA A;  3R2O A;  2VXX A;  4PG1 A;  1F30 A;  3U90 A;  4CY9 A;  2V8U A;  3T9J A;  2Z5P A;  2BW1 A;  2W0O A;  3IS8 A;  4TW3 A;  3F35 A;  2HTN A;  1IES A;  3R2R A;  2XJM A;  4TOH A;  1JI4 A;  3GE4 A;  3C23 A;  2CHP A;  3E6S A;  5D8X A;  5AXS A;  4CYA A;  4TOD A;  4YVZ A;  3JZ9 A;  2V8T A;  3BVL A;  2VZB A;  4M32 A;  3BVK A;  3V3K B;  3WVU A;  1DPS A;  5I4J A;  2JD7 0;  2X17 0;  4TOF A;  1FHA A;  1MOJ A;  4CVP A;  2ITB A;  3E1O A;  5ERJ A;  1XZ3 A;  2V2I A;  2Z90 A;  2D5K A;  3WVV A;  3LKD A;  2G4H A;  3FRR A;  4KVS A;  1BG7 A;  5FEJ A;  3ISF A;  4KVQ A;  3PW1 A;  3PW8 A;  2QQY A;  2ZG7 X;  1JRE A;  3C1Z A;  3ERZ A;  3PVY A;  3KA9 A;  3FRS A;  4W4K B;  1VEQ A;  4M33 A;  3AJO A;  4MUD A;  4TOB A;  1GWG A;  3IS7 A;  5GN8 A;  1Z4A A;  4X0J A;  4DYY A;  3F34 A;  4CVR A;  4ZKX A;  3F36 A;  4XGS A;  2HR5 A;  3EZ0 A;  1MFR A;  3KA3 A;  4MJY A;  4Z5S A;  2CLU A;  2V2J A;  1IER A;  3Q4R A;  2XJO A;  1SQ3 A;  4IWJ A;  5HQO A;  1NFV A;  2UX1 A;  3PVR A;  1SOF A;  3E1Q A;  4DYZ A;  3R2M A;  5JAC A;  4EVD A;  2V2L A;  3FSE A;  3R2L A;  4TOE A;  1S2Z A;  5FFE A;  2OC5 A;  3RBC A;  4AM5 A;  3KA8 A;  3E2C A;  5E1U A;  3Q4Q A;  5GU2 X;  5JKM A;  3PWQ A;  5JKL A;  3NP0 X;  5CMR A;  3AK9 A;  4DE6 A;  4U3G A;  4RC8 A;  3BVF A;  4DYX A;  5JDO B;  2C2J A;  2GYD A;  4IWK A;  2FJC A;  3E1L A;  3QHB A;  2V2O A;  2WLU A;  2BJY A;  5HJH A;  3Q4N A;  3PW8 C;  3TA8 A;  3KWO A;  1BCF A;  2RBD A;  4QUW A;  4RC7 B;  2N02 A;  2CIH A;  4ITW A;  2FL0 A;  1R03 A;  4P18 A;  2VXI A;  3RD0 A;  3E6R A;  3HL1 A;  1VEL A;  4CMY V;  3RAV A;  5D8Q A;  3UOI A;  1QYB A;  3O7R A;  4ITT A;  3E1P A;  4WJG 4;  5GU1 X;  1RCG A;  4ZLW A;  4RC6 A;  3WVW A;  4A25 A;  2CF7 A;  3F37 A;  4DAS A;  5GOU A;  1VJX A;  1NF4 A;  3FVB A;  2YW6 A;  1JTS A;  3SID A;  5GU0 X;  3W54 A;  4ISM A;  1TKP A;  3PVT A;  4ZKH A;  1ZS3 A;  4DZ0 A;  5K52 A;  2YW7 A;  4Z3B A;  2Z6M A;  3PW1 B;  4TOG A;  3F39 A;  2FKZ A;  2FG8 A;  1JI5 A;  2Y44 A;  3E1M A;  4ZJK A;  3MPS A;  1UVH A;  4ISP A;  3PWQ C;  3QZ3 A;  3E1J A;  3GGZ A;  3KHK A;  3KA4 A;  5D8R A;  5GN8 B;  2FZF A;  1YV1 A;  3R2H A;  5J9V A;  2WTL A;  2CWL A;  3R2K A;  3R2S A;  2ZG8 X;  3SH6 A;  3H7G A;  3VVA A;  3F32 A;  5D8P A;  4ZMC A;  1VEI A;  1AEW A;  2OH3 A;  4IXK A;  2OKC A;  3PVR B;  1RCC A;  2V2P A;  4RC5 A;  3IQ1 A;  4TO9 A;  4M34 A;  3QHC A;  2CHI A;  3Q4O A;  2CN6 A;  1TJO A;  2FFX J;  3ES3 A;  1O9I A;  1RYT A;  3VNX A;  5IX6 A;  2ZA8 A;  3QD8 A;  1RCI A;  3BVI A;  3EGM A;  2C41 A;  4II4 B;  2Z5R A;  3HIU A;  1LB3 A;  2V2S A;  3AJP A;  4EVC A;  3N6O A;  1YUX A;  3KX9 A;  2V2M A;  4EVB A;  1DVB A;  2XKQ A;  4LYX A;  5LG2 A;  4LPJ A;  4TOA A;  1L8H A;  4DYU A;  1B71 A;  1N1Q A;  2V2R A;  2V2N A;  3SHX A;  2ZA6 A;  3D19 A;  3BVE A;  5LS9 A;  5CMQ A;  3BKN A;  5J8W A;  5D8Y A;  2WLA A;  2BKC A;  5D8O A;  4ZL6 A;  3EZU A;  5HU6 D;  5FFB A;  4KVR A;  3RGD A;  2CEI A;  2V15 A;  1JYB A;  1JKU A;  2G38 B;  4W4L B;  4MY7 A;  3AF7 X;  2JD6 0;  2ZG9 X;  2C6R A;  3AJQ A;  1KRQ A;  2MGY A;  2AR0 A;  2BK6 A;  2C2F A;  3KXU A;  4M35 A;  4LPM A;  1BFR A;  4CVT A;  1H96 A;  2XGW A;  4ZL5 A;  1J30 A;  1F33 A;  1QGH A;  3AK8 A;  1S3Q A;  3NOZ X;  4AM2 A;  3AF9 X;  3SE1 A;  2WWX B;  2YJJ A;  2CN7 A;  1LKM A;  3UOF A;  3KDQ A;  4TOC A;  3RE7 A;  4RC7 A;  3L0M A;  2F7N A;  3JZA B;  4ERU A;  4YXM A;  4PGK A;  3GGY A;  3OJ5 A;  1LKO A;  3PVY B;  2Y3Q A;  4R42 A;  4CVS A;  2C2U A;  1NF6 A;  5J93 A;  5LBH A;  3ISE A;  2IB0 A;  2IY4 A;  2YJK A;  3A68 A;  1HRS A;  3F38 A;  4RC5 B;  4ZTT A;  3C21 A;  1Z6O M;  1TKO A;  4DI0 A;  4YKH A;  1JKV A;  2QF9 A;  3C1Y A;  5C6F A;  1TK6 A;  4E40 A;  2PYB A;  1NNQ A;  1DAT A;  2IU2 A;  3BT5 A;  3NP2 X;  1JIG A;  4XKS A;  3F33 A;  2Z5Q A;  4KXR B;  4PGI A;  1YUZ A;  3FI6 A;  4LQJ A;  4MXP A;  3QB9 A;  2GS4 A;  4Y08 A;  1UMN A;  1Z6O A;  4LPN A;  4XKT A;  5HJF A;  4AM4 A;  4LQH A;  1OTK A;  4XKU A;  1S30 A;  2GYQ A;  4E6K A;  4ETR A;  3WNW A;  1VLG A;  3M6J A; 
#chains in the Genus database with same CATH homology
 5ERK A;  3DBY A;  4EVE A;  2JD8 0;  5FFC A;  1RCE A;  4OYN A;  1XZ1 A;  5GU3 X;  3KA6 A;  4LQV A;  1LKP A;  3QVD A;  2XJN A;  5J8S A;  3O7S A;  1O9R A;  4ZKW A;  4REU A;  4LQN A;  2CLB A;  4MN9 A;  1JGC A;  1ZUJ A;  3A9Q A;  3UNO A;  3GVY A;  1L8I A;  3GHQ A;  3PZA A;  4LYU A;  5FFA A;  4II4 A;  5E2D A;  1EUM A;  4ML5 A;  5K53 A;  3E1N A;  4PG0 A;  4CYB A;  4MKU A;  2ZA7 A;  4CMY A;  3AF8 X;  2FG4 A;  5LG8 A;  4RC6 B;  2ZUR X;  1RCD A;  3OGH A;  5CZU A;  5JKM G;  5JKL G;  3VV9 A;  5JDO A;  5FFD A;  3PWF A;  5D8S A;  4YXJ A;  3PVT B;  3UFB A;  2FHA A;  3R2O A;  2VXX A;  4PG1 A;  1F30 A;  3U90 A;  4CY9 A;  2V8U A;  3T9J A;  2Z5P A;  2BW1 A;  2W0O A;  3IS8 A;  4TW3 A;  3F35 A;  2HTN A;  1IES A;  3R2R A;  2XJM A;  4TOH A;  1JI4 A;  3GE4 A;  3C23 A;  2CHP A;  3E6S A;  5D8X A;  5AXS A;  4CYA A;  4TOD A;  4YVZ A;  3JZ9 A;  2V8T A;  3BVL A;  2VZB A;  4M32 A;  3BVK A;  3V3K B;  3WVU A;  1DPS A;  5I4J A;  2JD7 0;  2X17 0;  4TOF A;  1FHA A;  1MOJ A;  4CVP A;  2ITB A;  3E1O A;  5ERJ A;  1XZ3 A;  2V2I A;  2Z90 A;  2D5K A;  3WVV A;  3LKD A;  2G4H A;  3FRR A;  4KVS A;  1BG7 A;  5FEJ A;  3ISF A;  4KVQ A;  3PW1 A;  3PW8 A;  2QQY A;  2ZG7 X;  1JRE A;  3C1Z A;  3ERZ A;  3PVY A;  3KA9 A;  3FRS A;  4W4K B;  1VEQ A;  4M33 A;  3AJO A;  4MUD A;  4TOB A;  1GWG A;  3IS7 A;  5GN8 A;  1Z4A A;  4X0J A;  4DYY A;  3F34 A;  4CVR A;  4ZKX A;  3F36 A;  4XGS A;  2HR5 A;  3EZ0 A;  1MFR A;  3KA3 A;  4MJY A;  4Z5S A;  2CLU A;  2V2J A;  1IER A;  3Q4R A;  2XJO A;  1SQ3 A;  4IWJ A;  5HQO A;  1NFV A;  2UX1 A;  3PVR A;  1SOF A;  3E1Q A;  4DYZ A;  3R2M A;  5JAC A;  4EVD A;  2V2L A;  3FSE A;  3R2L A;  4TOE A;  1S2Z A;  5FFE A;  2OC5 A;  3RBC A;  4AM5 A;  3KA8 A;  3E2C A;  5E1U A;  3Q4Q A;  5GU2 X;  5JKM A;  3PWQ A;  5JKL A;  3NP0 X;  5CMR A;  3AK9 A;  4DE6 A;  4U3G A;  4RC8 A;  3BVF A;  4DYX A;  5JDO B;  2C2J A;  2GYD A;  4IWK A;  2FJC A;  3E1L A;  3QHB A;  2V2O A;  2WLU A;  2BJY A;  5HJH A;  3Q4N A;  3PW8 C;  3TA8 A;  3KWO A;  1BCF A;  2RBD A;  4QUW A;  4RC7 B;  2N02 A;  2CIH A;  4ITW A;  2FL0 A;  1R03 A;  4P18 A;  2VXI A;  3RD0 A;  3E6R A;  3HL1 A;  1VEL A;  4CMY V;  3RAV A;  5D8Q A;  3UOI A;  1QYB A;  3O7R A;  4ITT A;  3E1P A;  4WJG 4;  5GU1 X;  1RCG A;  4ZLW A;  4RC6 A;  3WVW A;  4A25 A;  2CF7 A;  3F37 A;  4DAS A;  5GOU A;  1VJX A;  1NF4 A;  3FVB A;  2YW6 A;  1JTS A;  3SID A;  5GU0 X;  3W54 A;  4ISM A;  1TKP A;  3PVT A;  4ZKH A;  1ZS3 A;  4DZ0 A;  5K52 A;  2YW7 A;  4Z3B A;  2Z6M A;  3PW1 B;  4TOG A;  3F39 A;  2FKZ A;  2FG8 A;  1JI5 A;  2Y44 A;  3E1M A;  4ZJK A;  3MPS A;  1UVH A;  4ISP A;  3PWQ C;  3QZ3 A;  3E1J A;  3GGZ A;  3KHK A;  3KA4 A;  5D8R A;  5GN8 B;  2FZF A;  1YV1 A;  3R2H A;  5J9V A;  2WTL A;  2CWL A;  3R2K A;  3R2S A;  2ZG8 X;  3SH6 A;  3H7G A;  3VVA A;  3F32 A;  5D8P A;  4ZMC A;  1VEI A;  1AEW A;  2OH3 A;  4IXK A;  2OKC A;  3PVR B;  1RCC A;  2V2P A;  4RC5 A;  3IQ1 A;  4TO9 A;  4M34 A;  3QHC A;  2CHI A;  3Q4O A;  2CN6 A;  1TJO A;  2FFX J;  3ES3 A;  1O9I A;  1RYT A;  3VNX A;  5IX6 A;  2ZA8 A;  3QD8 A;  1RCI A;  3BVI A;  3EGM A;  2C41 A;  4II4 B;  2Z5R A;  3HIU A;  1LB3 A;  2V2S A;  3AJP A;  4EVC A;  3N6O A;  1YUX A;  3KX9 A;  2V2M A;  4EVB A;  1DVB A;  2XKQ A;  4LYX A;  5LG2 A;  4LPJ A;  4TOA A;  1L8H A;  4DYU A;  1B71 A;  1N1Q A;  2V2R A;  2V2N A;  3SHX A;  2ZA6 A;  3D19 A;  3BVE A;  5LS9 A;  5CMQ A;  3BKN A;  5J8W A;  5D8Y A;  2WLA A;  2BKC A;  5D8O A;  4ZL6 A;  3EZU A;  5HU6 D;  5FFB A;  4KVR A;  3RGD A;  2CEI A;  2V15 A;  1JYB A;  1JKU A;  2G38 B;  4W4L B;  4MY7 A;  3AF7 X;  2JD6 0;  2ZG9 X;  2C6R A;  3AJQ A;  1KRQ A;  2MGY A;  2AR0 A;  2BK6 A;  2C2F A;  3KXU A;  4M35 A;  4LPM A;  1BFR A;  4CVT A;  1H96 A;  2XGW A;  4ZL5 A;  1J30 A;  1F33 A;  1QGH A;  3AK8 A;  1S3Q A;  3NOZ X;  4AM2 A;  3AF9 X;  3SE1 A;  2WWX B;  2YJJ A;  2CN7 A;  1LKM A;  3UOF A;  3KDQ A;  4TOC A;  3RE7 A;  4RC7 A;  3L0M A;  2F7N A;  3JZA B;  4ERU A;  4YXM A;  4PGK A;  3GGY A;  3OJ5 A;  1LKO A;  3PVY B;  2Y3Q A;  4R42 A;  4CVS A;  2C2U A;  1NF6 A;  5J93 A;  5LBH A;  3ISE A;  2IB0 A;  2IY4 A;  2YJK A;  3A68 A;  1HRS A;  3F38 A;  4RC5 B;  4ZTT A;  3C21 A;  1Z6O M;  1TKO A;  4DI0 A;  4YKH A;  1JKV A;  2QF9 A;  3C1Y A;  5C6F A;  1TK6 A;  4E40 A;  2PYB A;  1NNQ A;  1DAT A;  2IU2 A;  3BT5 A;  3NP2 X;  1JIG A;  4XKS A;  3F33 A;  2Z5Q A;  4KXR B;  4PGI A;  1YUZ A;  3FI6 A;  4LQJ A;  4MXP A;  3QB9 A;  2GS4 A;  4Y08 A;  1UMN A;  1Z6O A;  4LPN A;  4XKT A;  5HJF A;  4AM4 A;  4LQH A;  1OTK A;  4XKU A;  1S30 A;  2GYQ A;  4E6K A;  4ETR A;  3WNW A;  1VLG A;  3M6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...