4EVDA

Crystal structure hp-nap from strain ys29 cadmium loaded (cocrystallization 50mm)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
143
structure length
143
Chain Sequence
KTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKHLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Neutrophil-activating protein
publication title Crystal structure of Helicobacter pylori neutrophil-activating protein with a di-nuclear ferroxidase center in a zinc or cadmium-bound form
pubmed doi rcsb
source organism Helicobacter pylori
total genus 64
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4evdA00
2IU2A 2Z5RA 2D5KA 1TKPA 1XZ3A 1VLGA 4DZ0A 3E1PA 2HR5A 3IS7A 3R2OA 1J30A 1RCGA 3F33A 4DYZA 2CHPA 2HTNA 3E2CA 3QZ3A 5HJHA 4EVBA 1N1QA 4RC7A 3E6RA 1LB3A 1L8HA 2BK6A 5GU3X 3QD8A 4AM5A 1JTSA 1DATA 3F36A 2VXXA 3FVBA 3NOZX 4KVSA 3Q4NA 2V2SA 2F7NA 4IXKA 3H7GA 3GVYA 5J9VA 4M32A 3AK9A 4II4B 3PWQA 5K53A 3WVVA 5D8SA 3IS8A 4REUA 4RC6B 5IX6A 1VEIA 3R2RA 4ITTA 4DYYA 3E1JA 5D8QA 2V2PA 5JACA 2FG8A 3KXUA 4ML5A 3BVEA 1KRQA 1JYBA 3GE4A 5GN8B 5GU2X 3PVYB 2ZA7A 3RE7A 4CY9A 2PYBA 1RYTA 2ZG7X 3E6SA 3ES3A 2IB0A 3R2HA 4IWJA 2JD60 3KA3A 4ERUA 4DASA 4AM2A 4DE6A 3BVKA 4RC5A 1VJXA 2QQYA 2V2LA 1BFRA 4LQJA 4LYUA 3U90A 2XJNA 3PW1B 3UOFA 4ISMA 2Y3QA 2C2UA 3ISFA 4RC7B 2XKQA 5JKLA 3Q4RA 4MN9A 4RC8A 1DPSA 3QVDA 3BKNA 3O7SA 3AJOA 4ZL6A 4TOEA 3PVTB 3F37A 1UVHA 1JIGA 2OH3A 2BJYA 2QF9A 3A9QA 3R2MA 4PG0A 5GOUA 3KX9A 4MJYA 2YJKA 3KA4A 1EUMA 3IQ1A 5HJFA 4M35A 5D8RA 2XJMA 1JKVA 4Z3BA 2V15A 4LPMA 3SHXA 3UNOA 3VNXA 4EVCA 4EVEA 1NNQA 3PWFA 1YUZA 5ERJA 5JKMA 3E1MA 1O9RA 3F38A 3TA8A 2BKCA 3QHCA 4KVQA 3SIDA 1NFVA 2CF7A 1AEWA 2XGWA 1NF4A 3ISEA 5LS9A 3PVRB 4RC5B 3BVLA 5FFEA 3SE1A 4E6KA 3PW8A 1SOFA 2FFXJ 4TODA 4LPNA 3PZAA 3RGDA 3EZ0A 3WNWA 1TK6A 2VZBA 4R42A 2CLBA 3T9JA 2WLAA 4TOBA 1XZ1A 2V2MA 2JD80 5D8OA 2X170 4TOGA 4TOHA 5K52A 1H96A 5ERKA 4P18A 1LKOA 1DVBA 2Z90A 1UMNA 2FHAA 5JKLG 1BG7A 2Z6MA 2BW1A 5J93A 4PGIA 2CN7A 3Q4QA 1QGHA 1B71A 2UX1A 3KA6A 1YV1A 4TW3A 1NF6A 2OC5A 4CVRA 2C2FA 2WLUA 4TO9A 5CZUA 4M34A 3E1LA 1L8IA 5AXSA 4CVTA 4LPJA 4TOCA 2Z5QA 2W0OA 5FFDA 4ZKWA 2Z5PA 1Z4AA 2CHIA 4U3GA 3FSEA 3OGHA 3AJQA 3F34A 1JKUA 5FFAA 5I4JA 1S30A 2V2OA 2ZURX 4PGKA 5JKMG 4LYXA 3SH6A 1FHAA 5J8WA 3HIUA 4Z5SA 4Y08A 3E1NA 3O7RA 4XKSA 1VELA 3KA8A 2GS4A 3QB9A 4KVRA 4CVSA 1RCDA 4ZMCA 4XKTA 3PWQC 1S3QA 2JD70 4ITWA 4MY7A 4II4A 4CYBA 4AM4A 3MPSA 4CYAA 4ETRA 4ZJKA 3AF7X 4ZKHA 4LQHA 4DI0A 5E2DA 3KA9A 2FZFA 3RAVA 4CVPA 3ERZA 5LBHA 5FFBA 1JREA 3F39A 2XJOA 3UOIA 3Q4OA 2YJJA 3F35A 4LQNA 4OYNA 3AF8X 3R2LA 2FKZA 4XGSA 2IY4A 1OTKA 2FG4A 1Z6OA 5D8XA 3AJPA 2G4HA 3PW1A 3NP2X 4XKUA 3RD0A 5J8SA 2CEIA 1ZS3A 5E1UA 1VEQA 3BVIA 4ZLWA 4QUWA 1SQ3A 4YKHA 3EGMA 1O9IA 3R2SA 4ZKXA 1F30A 5GU1X 4CMYV 4PG1A 4M33A 3HL1A 3PVTA 3AK8A 4IWKA 3F32A 1YUXA 4MUDA 4ISPA 3BT5A 4CMYA 1LKMA 2C2JA 2CN6A 2GYQA 1RCEA 4EVDA 4DYXA 2ZA8A 1TKOA 1Z6OM 3QHBA 1RCIA 1R03A 2FL0A 3A68A 1ZUJA 5GU0X 2ZA6A 2WTLA 2C41A 4TOFA 1JI5A 1TJOA 3OJ5A 2V2IA 3R2KA 3WVWA 1MFRA 3E1OA 2ZG8X 3FI6A 5D8PA 1IESA 3KWOA 4ZTTA 5C6FA 1HRSA 3PVRA 2VXIA 1F33A 2ITBA 3PW8C 1JI4A 2ZG9X 5LG8A 4DYUA 5FFCA 5D8YA 1JGCA 1GWGA 2V2JA 5CMQA 3RBCA 2V2NA 5FEJA 2C6RA 1RCCA 4A25A 2RBDA 2GYDA 3AF9X 4RC6A 3BVFA 2FJCA 5CMRA 1QYBA 2CLUA 2YW7A 1BCFA 1IERA 4MKUA 3NP0X 4LQVA 1LKPA 4ZL5A 5GN8A 3GHQA 3E1QA 3PVYA 3WVUA 5HQOA 3EZUA 4TOAA 2V2RA 2YW6A 5LG2A 2CIHA 1MOJA 1S2ZA
chains in the Genus database with same CATH superfamily
2IU2A 2Z5RA 3GGZA 2D5KA 1TKPA 1XZ3A 1VLGA 4DZ0A 3E1PA 2HR5A 3IS7A 3R2OA 1J30A 1RCGA 3KHKA 3F33A 4DYZA 2CHPA 2HTNA 3E2CA 3QZ3A 5HJHA 4EVBA 1N1QA 4RC7A 3E6RA 1LB3A 1L8HA 4YVZA 2BK6A 5GU3X 3QD8A 4AM5A 1JTSA 1DATA 3F36A 3GGYA 2VXXA 3FVBA 3NOZX 4KVSA 3Q4NA 2V2SA 2F7NA 4IXKA 3H7GA 3GVYA 5J9VA 4M32A 3AK9A 4II4B 3PWQA 5K53A 3V3KB 3WVVA 5D8SA 3IS8A 4REUA 4RC6B 5IX6A 1VEIA 3R2RA 4ITTA 4DYYA 3E1JA 5D8QA 2V2PA 5JACA 2FG8A 3KXUA 4ML5A 3BVEA 1KRQA 1JYBA 3GE4A 5GN8B 3VV9A 5GU2X 3PVYB 2ZA7A 3RE7A 4CY9A 2PYBA 1RYTA 2ZG7X 3E6SA 3ES3A 2IB0A 3R2HA 4IWJA 2JD60 3KA3A 3LKDA 4ERUA 4DASA 4AM2A 4DE6A 3BVKA 4RC5A 1VJXA 2QQYA 2V2LA 1BFRA 4LQJA 4LYUA 3U90A 2XJNA 3PW1B 3UOFA 4ISMA 3FRRA 2Y3QA 2C2UA 3ISFA 4RC7B 4YXMA 2XKQA 5JKLA 3Q4RA 3DBYA 4MN9A 4RC8A 1DPSA 3QVDA 3BKNA 3O7SA 3AJOA 4ZL6A 5JDOB 4TOEA 3PVTB 3F37A 1UVHA 1JIGA 2OH3A 2BJYA 2QF9A 3A9QA 3R2MA 4PG0A 5GOUA 3KX9A 4MJYA 2YJKA 3KA4A 3C21A 1EUMA 2V8TA 3IQ1A 5HJFA 4M35A 5D8RA 2XJMA 1JKVA 4Z3BA 2V15A 4LPMA 3SHXA 3UNOA 3VNXA 4EVCA 4EVEA 1NNQA 3PWFA 1YUZA 5ERJA 5JKMA 3E1MA 1O9RA 3F38A 2WWXB 3TA8A 3FRSA 2BKCA 3QHCA 4KVQA 3SIDA 1NFVA 2CF7A 1AEWA 2XGWA 1NF4A 3ISEA 4E40A 5LS9A 3PVRB 4RC5B 3BVLA 5FFEA 3SE1A 4E6KA 3PW8A 1SOFA 2FFXJ 4TODA 4LPNA 3PZAA 3RGDA 3EZ0A 2Y44A 3WNWA 3N6OA 1TK6A 2VZBA 4R42A 2CLBA 3T9JA 2WLAA 4TOBA 1XZ1A 3KDQA 2V2MA 2JD80 5D8OA 2AR0A 2X170 4TOGA 4TOHA 5K52A 1H96A 5ERKA 4P18A 1LKOA 1DVBA 2Z90A 1UMNA 3VVAA 2FHAA 5JKLG 1BG7A 2Z6MA 2BW1A 5J93A 4PGIA 2CN7A 3Q4QA 4WJG4 1QGHA 1B71A 2UX1A 3KA6A 1YV1A 4TW3A 1NF6A 2OC5A 4CVRA 2C2FA 2WLUA 2V8UA 4KXRB 4TO9A 5CZUA 4M34A 3E1LA 3W54A 1L8IA 5AXSA 4CVTA 4LPJA 4TOCA 2Z5QA 2W0OA 5FFDA 4ZKWA 2Z5PA 1Z4AA 2CHIA 4U3GA 3FSEA 3OGHA 3AJQA 3F34A 1JKUA 5FFAA 5I4JA 1S30A 2V2OA 2ZURX 4PGKA 3JZAB 4LYXA 5JKMG 3SH6A 1FHAA 5J8WA 3HIUA 4Z5SA 4Y08A 3E1NA 3O7RA 4XKSA 1VELA 3KA8A 2GS4A 3QB9A 4KVRA 4CVSA 1RCDA 4ZMCA 4XKTA 3C1ZA 3PWQC 1S3QA 2JD70 4ITWA 4MY7A 4II4A 4CYBA 5HU6D 4AM4A 3MPSA 4X0JA 4CYAA 4ETRA 3C23A 4ZJKA 3AF7X 4ZKHA 4LQHA 4DI0A 5E2DA 3KA9A 2FZFA 3RAVA 4CVPA 3ERZA 5LBHA 5FFBA 1JREA 3F39A 2XJOA 3UOIA 2MGYA 3Q4OA 2YJJA 3F35A 4LQNA 4OYNA 3AF8X 3R2LA 2FKZA 4XGSA 2IY4A 1OTKA 2FG4A 1Z6OA 5D8XA 3AJPA 2G4HA 3PW1A 3NP2X 4XKUA 3RD0A 5J8SA 2CEIA 1ZS3A 5E1UA 1VEQA 3BVIA 4ZLWA 4QUWA 2CWLA 1SQ3A 2G38B 4YKHA 3EGMA 1O9IA 3R2SA 4ZKXA 1F30A 5GU1X 4CMYV 4PG1A 4M33A 3HL1A 5JDOA 3PVTA 3AK8A 4IWKA 3F32A 1YUXA 4MUDA 4ISPA 3BT5A 4CMYA 1LKMA 2C2JA 2CN6A 2GYQA 1RCEA 4EVDA 4DYXA 2ZA8A 1TKOA 1Z6OM 3QHBA 1RCIA 1R03A 2FL0A 2OKCA 3A68A 1ZUJA 5GU0X 2ZA6A 2WTLA 2C41A 3JZ9A 4TOFA 1JI5A 1TJOA 3OJ5A 2V2IA 3R2KA 3UFBA 3WVWA 1MFRA 3E1OA 2ZG8X 3FI6A 5D8PA 1IESA 3KWOA 4ZTTA 4YXJA 5C6FA 1HRSA 3PVRA 2VXIA 1F33A 2ITBA 3PW8C 1JI4A 2ZG9X 5LG8A 4DYUA 3C1YA 5FFCA 5D8YA 1JGCA 1GWGA 2V2JA 5CMQA 3RBCA 4W4KB 2V2NA 5FEJA 2C6RA 1RCCA 4A25A 2RBDA 2GYDA 3AF9X 4MXPA 4RC6A 3BVFA 3M6JA 2FJCA 5CMRA 1QYBA 3D19A 2CLUA 2N02A 2YW7A 1BCFA 1IERA 3L0MA 4MKUA 3NP0X 4LQVA 1LKPA 4ZL5A 5GN8A 3GHQA 3E1QA 3PVYA 3WVUA 4W4LB 5HQOA 3EZUA 4TOAA 2V2RA 2YW6A 5LG2A 2CIHA 1MOJA 1S2ZA
chains in the Genus database with same CATH topology
2IU2A 2Z5RA 3GGZA 2D5KA 1TKPA 1XZ3A 1VLGA 4DZ0A 3E1PA 2HR5A 3IS7A 3R2OA 1J30A 1RCGA 3KHKA 3F33A 4DYZA 2CHPA 2HTNA 3E2CA 3QZ3A 5HJHA 4EVBA 1N1QA 4RC7A 3E6RA 1LB3A 1L8HA 4YVZA 2BK6A 5GU3X 3QD8A 4AM5A 1JTSA 1DATA 3F36A 3GGYA 2VXXA 3FVBA 3NOZX 4KVSA 3Q4NA 2V2SA 2F7NA 4IXKA 3H7GA 3GVYA 5J9VA 4M32A 3AK9A 4II4B 3PWQA 5K53A 3V3KB 3WVVA 5D8SA 3IS8A 4REUA 4RC6B 5IX6A 1VEIA 3R2RA 4ITTA 4DYYA 3E1JA 5D8QA 2V2PA 5JACA 2FG8A 3KXUA 4ML5A 3BVEA 1KRQA 1JYBA 3GE4A 5GN8B 3VV9A 5GU2X 3PVYB 2ZA7A 3RE7A 4CY9A 2PYBA 1RYTA 2ZG7X 3E6SA 3ES3A 2IB0A 3R2HA 4IWJA 2JD60 3KA3A 3LKDA 4ERUA 4DASA 4AM2A 4DE6A 3BVKA 4RC5A 1VJXA 2QQYA 2V2LA 1BFRA 4LQJA 4LYUA 3U90A 2XJNA 3PW1B 3UOFA 4ISMA 3FRRA 2Y3QA 2C2UA 3ISFA 4RC7B 4YXMA 2XKQA 5JKLA 3Q4RA 3DBYA 4MN9A 4RC8A 1DPSA 3QVDA 3BKNA 3O7SA 3AJOA 4ZL6A 5JDOB 4TOEA 3PVTB 3F37A 1UVHA 1JIGA 2OH3A 2BJYA 2QF9A 3A9QA 3R2MA 4PG0A 5GOUA 3KX9A 4MJYA 2YJKA 3KA4A 3C21A 1EUMA 2V8TA 3IQ1A 5HJFA 4M35A 5D8RA 2XJMA 1JKVA 4Z3BA 2V15A 4LPMA 3SHXA 3UNOA 3VNXA 4EVCA 4EVEA 1NNQA 3PWFA 1YUZA 5ERJA 5JKMA 3E1MA 1O9RA 3F38A 2WWXB 3TA8A 3FRSA 2BKCA 3QHCA 4KVQA 3SIDA 1NFVA 2CF7A 1AEWA 2XGWA 1NF4A 3ISEA 4E40A 5LS9A 3PVRB 4RC5B 3BVLA 5FFEA 3SE1A 4E6KA 3PW8A 1SOFA 2FFXJ 4TODA 4LPNA 3PZAA 3RGDA 3EZ0A 2Y44A 3WNWA 3N6OA 1TK6A 2VZBA 4R42A 2CLBA 3T9JA 2WLAA 4TOBA 1XZ1A 3KDQA 2V2MA 2JD80 5D8OA 2AR0A 2X170 4TOGA 4TOHA 5K52A 1H96A 5ERKA 4P18A 1LKOA 1DVBA 2Z90A 1UMNA 3VVAA 2FHAA 5JKLG 1BG7A 2Z6MA 2BW1A 5J93A 4PGIA 2CN7A 3Q4QA 4WJG4 1QGHA 1B71A 2UX1A 3KA6A 1YV1A 4TW3A 1NF6A 2OC5A 4CVRA 2C2FA 2WLUA 2V8UA 4KXRB 4TO9A 5CZUA 4M34A 3E1LA 3W54A 1L8IA 5AXSA 4CVTA 4LPJA 4TOCA 2Z5QA 2W0OA 5FFDA 4ZKWA 2Z5PA 1Z4AA 2CHIA 4U3GA 3FSEA 3OGHA 3AJQA 3F34A 1JKUA 5FFAA 5I4JA 1S30A 2V2OA 2ZURX 4PGKA 3JZAB 4LYXA 5JKMG 3SH6A 1FHAA 5J8WA 3HIUA 4Z5SA 4Y08A 3E1NA 3O7RA 4XKSA 1VELA 3KA8A 2GS4A 3QB9A 4KVRA 4CVSA 1RCDA 4ZMCA 4XKTA 3C1ZA 3PWQC 1S3QA 2JD70 4ITWA 4MY7A 4II4A 4CYBA 5HU6D 4AM4A 3MPSA 4X0JA 4CYAA 4ETRA 3C23A 4ZJKA 3AF7X 4ZKHA 4LQHA 4DI0A 5E2DA 3KA9A 2FZFA 3RAVA 4CVPA 3ERZA 5LBHA 5FFBA 1JREA 3F39A 2XJOA 3UOIA 2MGYA 3Q4OA 2YJJA 3F35A 4LQNA 4OYNA 3AF8X 3R2LA 2FKZA 4XGSA 2IY4A 1OTKA 2FG4A 1Z6OA 5D8XA 3AJPA 2G4HA 3PW1A 3NP2X 4XKUA 3RD0A 5J8SA 2CEIA 1ZS3A 5E1UA 1VEQA 3BVIA 4ZLWA 4QUWA 2CWLA 1SQ3A 2G38B 4YKHA 3EGMA 1O9IA 3R2SA 4ZKXA 1F30A 5GU1X 4CMYV 4PG1A 4M33A 3HL1A 5JDOA 3PVTA 3AK8A 4IWKA 3F32A 1YUXA 4MUDA 4ISPA 3BT5A 4CMYA 1LKMA 2C2JA 2CN6A 2GYQA 1RCEA 4EVDA 4DYXA 2ZA8A 1TKOA 1Z6OM 3QHBA 1RCIA 1R03A 2FL0A 2OKCA 3A68A 1ZUJA 5GU0X 2ZA6A 2WTLA 2C41A 3JZ9A 4TOFA 1JI5A 1TJOA 3OJ5A 2V2IA 3R2KA 3UFBA 3WVWA 1MFRA 3E1OA 2ZG8X 3FI6A 5D8PA 1IESA 3KWOA 4ZTTA 4YXJA 5C6FA 1HRSA 3PVRA 2VXIA 1F33A 2ITBA 3PW8C 1JI4A 2ZG9X 5LG8A 4DYUA 3C1YA 5FFCA 5D8YA 1JGCA 1GWGA 2V2JA 5CMQA 3RBCA 4W4KB 2V2NA 5FEJA 2C6RA 1RCCA 4A25A 2RBDA 2GYDA 3AF9X 4MXPA 4RC6A 3BVFA 3M6JA 2FJCA 5CMRA 1QYBA 3D19A 2CLUA 2N02A 2YW7A 1BCFA 1IERA 3L0MA 4MKUA 3NP0X 4LQVA 1LKPA 4ZL5A 5GN8A 3GHQA 3E1QA 3PVYA 3WVUA 4W4LB 5HQOA 3EZUA 4TOAA 2V2RA 2YW6A 5LG2A 2CIHA 1MOJA 1S2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IU2 A;  2Z5R A;  2D5K A;  1TKP A;  1XZ3 A;  1VLG A;  4DZ0 A;  3E1P A;  2HR5 A;  3IS7 A;  3R2O A;  1J30 A;  1RCG A;  3F33 A;  4DYZ A;  2CHP A;  2HTN A;  3E2C A;  3QZ3 A;  5HJH A;  4EVB A;  1N1Q A;  4RC7 A;  3E6R A;  1LB3 A;  1L8H A;  2BK6 A;  5GU3 X;  3QD8 A;  4AM5 A;  1JTS A;  1DAT A;  3F36 A;  2VXX A;  3FVB A;  3NOZ X;  4KVS A;  3Q4N A;  2V2S A;  2F7N A;  4IXK A;  3H7G A;  3GVY A;  5J9V A;  4M32 A;  3AK9 A;  4II4 B;  3PWQ A;  5K53 A;  3WVV A;  5D8S A;  3IS8 A;  4REU A;  4RC6 B;  5IX6 A;  1VEI A;  3R2R A;  4ITT A;  4DYY A;  3E1J A;  5D8Q A;  2V2P A;  5JAC A;  2FG8 A;  3KXU A;  4ML5 A;  3BVE A;  1KRQ A;  1JYB A;  3GE4 A;  5GN8 B;  5GU2 X;  3PVY B;  2ZA7 A;  3RE7 A;  4CY9 A;  2PYB A;  1RYT A;  2ZG7 X;  3E6S A;  3ES3 A;  2IB0 A;  3R2H A;  4IWJ A;  2JD6 0;  3KA3 A;  4ERU A;  4DAS A;  4AM2 A;  4DE6 A;  3BVK A;  4RC5 A;  1VJX A;  2QQY A;  2V2L A;  1BFR A;  4LQJ A;  4LYU A;  3U90 A;  2XJN A;  3PW1 B;  3UOF A;  4ISM A;  2Y3Q A;  2C2U A;  3ISF A;  4RC7 B;  2XKQ A;  5JKL A;  3Q4R A;  4MN9 A;  4RC8 A;  1DPS A;  3QVD A;  3BKN A;  3O7S A;  3AJO A;  4ZL6 A;  4TOE A;  3PVT B;  3F37 A;  1UVH A;  1JIG A;  2OH3 A;  2BJY A;  2QF9 A;  3A9Q A;  3R2M A;  4PG0 A;  5GOU A;  3KX9 A;  4MJY A;  2YJK A;  3KA4 A;  1EUM A;  3IQ1 A;  5HJF A;  4M35 A;  5D8R A;  2XJM A;  1JKV A;  4Z3B A;  2V15 A;  4LPM A;  3SHX A;  3UNO A;  3VNX A;  4EVC A;  4EVE A;  1NNQ A;  3PWF A;  1YUZ A;  5ERJ A;  5JKM A;  3E1M A;  1O9R A;  3F38 A;  3TA8 A;  2BKC A;  3QHC A;  4KVQ A;  3SID A;  1NFV A;  2CF7 A;  1AEW A;  2XGW A;  1NF4 A;  3ISE A;  5LS9 A;  3PVR B;  4RC5 B;  3BVL A;  5FFE A;  3SE1 A;  4E6K A;  3PW8 A;  1SOF A;  2FFX J;  4TOD A;  4LPN A;  3PZA A;  3RGD A;  3EZ0 A;  3WNW A;  1TK6 A;  2VZB A;  4R42 A;  2CLB A;  3T9J A;  2WLA A;  4TOB A;  1XZ1 A;  2V2M A;  2JD8 0;  5D8O A;  2X17 0;  4TOG A;  4TOH A;  5K52 A;  1H96 A;  5ERK A;  4P18 A;  1LKO A;  1DVB A;  2Z90 A;  1UMN A;  2FHA A;  5JKL G;  1BG7 A;  2Z6M A;  2BW1 A;  5J93 A;  4PGI A;  2CN7 A;  3Q4Q A;  1QGH A;  1B71 A;  2UX1 A;  3KA6 A;  1YV1 A;  4TW3 A;  1NF6 A;  2OC5 A;  4CVR A;  2C2F A;  2WLU A;  4TO9 A;  5CZU A;  4M34 A;  3E1L A;  1L8I A;  5AXS A;  4CVT A;  4LPJ A;  4TOC A;  2Z5Q A;  2W0O A;  5FFD A;  4ZKW A;  2Z5P A;  1Z4A A;  2CHI A;  4U3G A;  3FSE A;  3OGH A;  3AJQ A;  3F34 A;  1JKU A;  5FFA A;  5I4J A;  1S30 A;  2V2O A;  2ZUR X;  4PGK A;  5JKM G;  4LYX A;  3SH6 A;  1FHA A;  5J8W A;  3HIU A;  4Z5S A;  4Y08 A;  3E1N A;  3O7R A;  4XKS A;  1VEL A;  3KA8 A;  2GS4 A;  3QB9 A;  4KVR A;  4CVS A;  1RCD A;  4ZMC A;  4XKT A;  3PWQ C;  1S3Q A;  2JD7 0;  4ITW A;  4MY7 A;  4II4 A;  4CYB A;  4AM4 A;  3MPS A;  4CYA A;  4ETR A;  4ZJK A;  3AF7 X;  4ZKH A;  4LQH A;  4DI0 A;  5E2D A;  3KA9 A;  2FZF A;  3RAV A;  4CVP A;  3ERZ A;  5LBH A;  5FFB A;  1JRE A;  3F39 A;  2XJO A;  3UOI A;  3Q4O A;  2YJJ A;  3F35 A;  4LQN A;  4OYN A;  3AF8 X;  3R2L A;  2FKZ A;  4XGS A;  2IY4 A;  1OTK A;  2FG4 A;  1Z6O A;  5D8X A;  3AJP A;  2G4H A;  3PW1 A;  3NP2 X;  4XKU A;  3RD0 A;  5J8S A;  2CEI A;  1ZS3 A;  5E1U A;  1VEQ A;  3BVI A;  4ZLW A;  4QUW A;  1SQ3 A;  4YKH A;  3EGM A;  1O9I A;  3R2S A;  4ZKX A;  1F30 A;  5GU1 X;  4CMY V;  4PG1 A;  4M33 A;  3HL1 A;  3PVT A;  3AK8 A;  4IWK A;  3F32 A;  1YUX A;  4MUD A;  4ISP A;  3BT5 A;  4CMY A;  1LKM A;  2C2J A;  2CN6 A;  2GYQ A;  1RCE A;  4EVD A;  4DYX A;  2ZA8 A;  1TKO A;  1Z6O M;  3QHB A;  1RCI A;  1R03 A;  2FL0 A;  3A68 A;  1ZUJ A;  5GU0 X;  2ZA6 A;  2WTL A;  2C41 A;  4TOF A;  1JI5 A;  1TJO A;  3OJ5 A;  2V2I A;  3R2K A;  3WVW A;  1MFR A;  3E1O A;  2ZG8 X;  3FI6 A;  5D8P A;  1IES A;  3KWO A;  4ZTT A;  5C6F A;  1HRS A;  3PVR A;  2VXI A;  1F33 A;  2ITB A;  3PW8 C;  1JI4 A;  2ZG9 X;  5LG8 A;  4DYU A;  5FFC A;  5D8Y A;  1JGC A;  1GWG A;  2V2J A;  5CMQ A;  3RBC A;  2V2N A;  5FEJ A;  2C6R A;  1RCC A;  4A25 A;  2RBD A;  2GYD A;  3AF9 X;  4RC6 A;  3BVF A;  2FJC A;  5CMR A;  1QYB A;  2CLU A;  2YW7 A;  1BCF A;  1IER A;  4MKU A;  3NP0 X;  4LQV A;  1LKP A;  4ZL5 A;  5GN8 A;  3GHQ A;  3E1Q A;  3PVY A;  3WVU A;  5HQO A;  3EZU A;  4TOA A;  2V2R A;  2YW6 A;  5LG2 A;  2CIH A;  1MOJ A;  1S2Z A; 
#chains in the Genus database with same CATH topology
 2IU2 A;  2Z5R A;  3GGZ A;  2D5K A;  1TKP A;  1XZ3 A;  1VLG A;  4DZ0 A;  3E1P A;  2HR5 A;  3IS7 A;  3R2O A;  1J30 A;  1RCG A;  3KHK A;  3F33 A;  4DYZ A;  2CHP A;  2HTN A;  3E2C A;  3QZ3 A;  5HJH A;  4EVB A;  1N1Q A;  4RC7 A;  3E6R A;  1LB3 A;  1L8H A;  4YVZ A;  2BK6 A;  5GU3 X;  3QD8 A;  4AM5 A;  1JTS A;  1DAT A;  3F36 A;  3GGY A;  2VXX A;  3FVB A;  3NOZ X;  4KVS A;  3Q4N A;  2V2S A;  2F7N A;  4IXK A;  3H7G A;  3GVY A;  5J9V A;  4M32 A;  3AK9 A;  4II4 B;  3PWQ A;  5K53 A;  3V3K B;  3WVV A;  5D8S A;  3IS8 A;  4REU A;  4RC6 B;  5IX6 A;  1VEI A;  3R2R A;  4ITT A;  4DYY A;  3E1J A;  5D8Q A;  2V2P A;  5JAC A;  2FG8 A;  3KXU A;  4ML5 A;  3BVE A;  1KRQ A;  1JYB A;  3GE4 A;  5GN8 B;  3VV9 A;  5GU2 X;  3PVY B;  2ZA7 A;  3RE7 A;  4CY9 A;  2PYB A;  1RYT A;  2ZG7 X;  3E6S A;  3ES3 A;  2IB0 A;  3R2H A;  4IWJ A;  2JD6 0;  3KA3 A;  3LKD A;  4ERU A;  4DAS A;  4AM2 A;  4DE6 A;  3BVK A;  4RC5 A;  1VJX A;  2QQY A;  2V2L A;  1BFR A;  4LQJ A;  4LYU A;  3U90 A;  2XJN A;  3PW1 B;  3UOF A;  4ISM A;  3FRR A;  2Y3Q A;  2C2U A;  3ISF A;  4RC7 B;  4YXM A;  2XKQ A;  5JKL A;  3Q4R A;  3DBY A;  4MN9 A;  4RC8 A;  1DPS A;  3QVD A;  3BKN A;  3O7S A;  3AJO A;  4ZL6 A;  5JDO B;  4TOE A;  3PVT B;  3F37 A;  1UVH A;  1JIG A;  2OH3 A;  2BJY A;  2QF9 A;  3A9Q A;  3R2M A;  4PG0 A;  5GOU A;  3KX9 A;  4MJY A;  2YJK A;  3KA4 A;  3C21 A;  1EUM A;  2V8T A;  3IQ1 A;  5HJF A;  4M35 A;  5D8R A;  2XJM A;  1JKV A;  4Z3B A;  2V15 A;  4LPM A;  3SHX A;  3UNO A;  3VNX A;  4EVC A;  4EVE A;  1NNQ A;  3PWF A;  1YUZ A;  5ERJ A;  5JKM A;  3E1M A;  1O9R A;  3F38 A;  2WWX B;  3TA8 A;  3FRS A;  2BKC A;  3QHC A;  4KVQ A;  3SID A;  1NFV A;  2CF7 A;  1AEW A;  2XGW A;  1NF4 A;  3ISE A;  4E40 A;  5LS9 A;  3PVR B;  4RC5 B;  3BVL A;  5FFE A;  3SE1 A;  4E6K A;  3PW8 A;  1SOF A;  2FFX J;  4TOD A;  4LPN A;  3PZA A;  3RGD A;  3EZ0 A;  2Y44 A;  3WNW A;  3N6O A;  1TK6 A;  2VZB A;  4R42 A;  2CLB A;  3T9J A;  2WLA A;  4TOB A;  1XZ1 A;  3KDQ A;  2V2M A;  2JD8 0;  5D8O A;  2AR0 A;  2X17 0;  4TOG A;  4TOH A;  5K52 A;  1H96 A;  5ERK A;  4P18 A;  1LKO A;  1DVB A;  2Z90 A;  1UMN A;  3VVA A;  2FHA A;  5JKL G;  1BG7 A;  2Z6M A;  2BW1 A;  5J93 A;  4PGI A;  2CN7 A;  3Q4Q A;  4WJG 4;  1QGH A;  1B71 A;  2UX1 A;  3KA6 A;  1YV1 A;  4TW3 A;  1NF6 A;  2OC5 A;  4CVR A;  2C2F A;  2WLU A;  2V8U A;  4KXR B;  4TO9 A;  5CZU A;  4M34 A;  3E1L A;  3W54 A;  1L8I A;  5AXS A;  4CVT A;  4LPJ A;  4TOC A;  2Z5Q A;  2W0O A;  5FFD A;  4ZKW A;  2Z5P A;  1Z4A A;  2CHI A;  4U3G A;  3FSE A;  3OGH A;  3AJQ A;  3F34 A;  1JKU A;  5FFA A;  5I4J A;  1S30 A;  2V2O A;  2ZUR X;  4PGK A;  3JZA B;  4LYX A;  5JKM G;  3SH6 A;  1FHA A;  5J8W A;  3HIU A;  4Z5S A;  4Y08 A;  3E1N A;  3O7R A;  4XKS A;  1VEL A;  3KA8 A;  2GS4 A;  3QB9 A;  4KVR A;  4CVS A;  1RCD A;  4ZMC A;  4XKT A;  3C1Z A;  3PWQ C;  1S3Q A;  2JD7 0;  4ITW A;  4MY7 A;  4II4 A;  4CYB A;  5HU6 D;  4AM4 A;  3MPS A;  4X0J A;  4CYA A;  4ETR A;  3C23 A;  4ZJK A;  3AF7 X;  4ZKH A;  4LQH A;  4DI0 A;  5E2D A;  3KA9 A;  2FZF A;  3RAV A;  4CVP A;  3ERZ A;  5LBH A;  5FFB A;  1JRE A;  3F39 A;  2XJO A;  3UOI A;  2MGY A;  3Q4O A;  2YJJ A;  3F35 A;  4LQN A;  4OYN A;  3AF8 X;  3R2L A;  2FKZ A;  4XGS A;  2IY4 A;  1OTK A;  2FG4 A;  1Z6O A;  5D8X A;  3AJP A;  2G4H A;  3PW1 A;  3NP2 X;  4XKU A;  3RD0 A;  5J8S A;  2CEI A;  1ZS3 A;  5E1U A;  1VEQ A;  3BVI A;  4ZLW A;  4QUW A;  2CWL A;  1SQ3 A;  2G38 B;  4YKH A;  3EGM A;  1O9I A;  3R2S A;  4ZKX A;  1F30 A;  5GU1 X;  4CMY V;  4PG1 A;  4M33 A;  3HL1 A;  5JDO A;  3PVT A;  3AK8 A;  4IWK A;  3F32 A;  1YUX A;  4MUD A;  4ISP A;  3BT5 A;  4CMY A;  1LKM A;  2C2J A;  2CN6 A;  2GYQ A;  1RCE A;  4EVD A;  4DYX A;  2ZA8 A;  1TKO A;  1Z6O M;  3QHB A;  1RCI A;  1R03 A;  2FL0 A;  2OKC A;  3A68 A;  1ZUJ A;  5GU0 X;  2ZA6 A;  2WTL A;  2C41 A;  3JZ9 A;  4TOF A;  1JI5 A;  1TJO A;  3OJ5 A;  2V2I A;  3R2K A;  3UFB A;  3WVW A;  1MFR A;  3E1O A;  2ZG8 X;  3FI6 A;  5D8P A;  1IES A;  3KWO A;  4ZTT A;  4YXJ A;  5C6F A;  1HRS A;  3PVR A;  2VXI A;  1F33 A;  2ITB A;  3PW8 C;  1JI4 A;  2ZG9 X;  5LG8 A;  4DYU A;  3C1Y A;  5FFC A;  5D8Y A;  1JGC A;  1GWG A;  2V2J A;  5CMQ A;  3RBC A;  4W4K B;  2V2N A;  5FEJ A;  2C6R A;  1RCC A;  4A25 A;  2RBD A;  2GYD A;  3AF9 X;  4MXP A;  4RC6 A;  3BVF A;  3M6J A;  2FJC A;  5CMR A;  1QYB A;  3D19 A;  2CLU A;  2N02 A;  2YW7 A;  1BCF A;  1IER A;  3L0M A;  4MKU A;  3NP0 X;  4LQV A;  1LKP A;  4ZL5 A;  5GN8 A;  3GHQ A;  3E1Q A;  3PVY A;  3WVU A;  4W4L B;  5HQO A;  3EZU A;  4TOA A;  2V2R A;  2YW6 A;  5LG2 A;  2CIH A;  1MOJ A;  1S2Z A; 
#chains in the Genus database with same CATH homology
 2IU2 A;  2Z5R A;  3GGZ A;  2D5K A;  1TKP A;  1XZ3 A;  1VLG A;  4DZ0 A;  3E1P A;  2HR5 A;  3IS7 A;  3R2O A;  1J30 A;  1RCG A;  3KHK A;  3F33 A;  4DYZ A;  2CHP A;  2HTN A;  3E2C A;  3QZ3 A;  5HJH A;  4EVB A;  1N1Q A;  4RC7 A;  3E6R A;  1LB3 A;  1L8H A;  4YVZ A;  2BK6 A;  5GU3 X;  3QD8 A;  4AM5 A;  1JTS A;  1DAT A;  3F36 A;  3GGY A;  2VXX A;  3FVB A;  3NOZ X;  4KVS A;  3Q4N A;  2V2S A;  2F7N A;  4IXK A;  3H7G A;  3GVY A;  5J9V A;  4M32 A;  3AK9 A;  4II4 B;  3PWQ A;  5K53 A;  3V3K B;  3WVV A;  5D8S A;  3IS8 A;  4REU A;  4RC6 B;  5IX6 A;  1VEI A;  3R2R A;  4ITT A;  4DYY A;  3E1J A;  5D8Q A;  2V2P A;  5JAC A;  2FG8 A;  3KXU A;  4ML5 A;  3BVE A;  1KRQ A;  1JYB A;  3GE4 A;  5GN8 B;  3VV9 A;  5GU2 X;  3PVY B;  2ZA7 A;  3RE7 A;  4CY9 A;  2PYB A;  1RYT A;  2ZG7 X;  3E6S A;  3ES3 A;  2IB0 A;  3R2H A;  4IWJ A;  2JD6 0;  3KA3 A;  3LKD A;  4ERU A;  4DAS A;  4AM2 A;  4DE6 A;  3BVK A;  4RC5 A;  1VJX A;  2QQY A;  2V2L A;  1BFR A;  4LQJ A;  4LYU A;  3U90 A;  2XJN A;  3PW1 B;  3UOF A;  4ISM A;  3FRR A;  2Y3Q A;  2C2U A;  3ISF A;  4RC7 B;  4YXM A;  2XKQ A;  5JKL A;  3Q4R A;  3DBY A;  4MN9 A;  4RC8 A;  1DPS A;  3QVD A;  3BKN A;  3O7S A;  3AJO A;  4ZL6 A;  5JDO B;  4TOE A;  3PVT B;  3F37 A;  1UVH A;  1JIG A;  2OH3 A;  2BJY A;  2QF9 A;  3A9Q A;  3R2M A;  4PG0 A;  5GOU A;  3KX9 A;  4MJY A;  2YJK A;  3KA4 A;  3C21 A;  1EUM A;  2V8T A;  3IQ1 A;  5HJF A;  4M35 A;  5D8R A;  2XJM A;  1JKV A;  4Z3B A;  2V15 A;  4LPM A;  3SHX A;  3UNO A;  3VNX A;  4EVC A;  4EVE A;  1NNQ A;  3PWF A;  1YUZ A;  5ERJ A;  5JKM A;  3E1M A;  1O9R A;  3F38 A;  2WWX B;  3TA8 A;  3FRS A;  2BKC A;  3QHC A;  4KVQ A;  3SID A;  1NFV A;  2CF7 A;  1AEW A;  2XGW A;  1NF4 A;  3ISE A;  4E40 A;  5LS9 A;  3PVR B;  4RC5 B;  3BVL A;  5FFE A;  3SE1 A;  4E6K A;  3PW8 A;  1SOF A;  2FFX J;  4TOD A;  4LPN A;  3PZA A;  3RGD A;  3EZ0 A;  2Y44 A;  3WNW A;  3N6O A;  1TK6 A;  2VZB A;  4R42 A;  2CLB A;  3T9J A;  2WLA A;  4TOB A;  1XZ1 A;  3KDQ A;  2V2M A;  2JD8 0;  5D8O A;  2AR0 A;  2X17 0;  4TOG A;  4TOH A;  5K52 A;  1H96 A;  5ERK A;  4P18 A;  1LKO A;  1DVB A;  2Z90 A;  1UMN A;  3VVA A;  2FHA A;  5JKL G;  1BG7 A;  2Z6M A;  2BW1 A;  5J93 A;  4PGI A;  2CN7 A;  3Q4Q A;  4WJG 4;  1QGH A;  1B71 A;  2UX1 A;  3KA6 A;  1YV1 A;  4TW3 A;  1NF6 A;  2OC5 A;  4CVR A;  2C2F A;  2WLU A;  2V8U A;  4KXR B;  4TO9 A;  5CZU A;  4M34 A;  3E1L A;  3W54 A;  1L8I A;  5AXS A;  4CVT A;  4LPJ A;  4TOC A;  2Z5Q A;  2W0O A;  5FFD A;  4ZKW A;  2Z5P A;  1Z4A A;  2CHI A;  4U3G A;  3FSE A;  3OGH A;  3AJQ A;  3F34 A;  1JKU A;  5FFA A;  5I4J A;  1S30 A;  2V2O A;  2ZUR X;  4PGK A;  3JZA B;  4LYX A;  5JKM G;  3SH6 A;  1FHA A;  5J8W A;  3HIU A;  4Z5S A;  4Y08 A;  3E1N A;  3O7R A;  4XKS A;  1VEL A;  3KA8 A;  2GS4 A;  3QB9 A;  4KVR A;  4CVS A;  1RCD A;  4ZMC A;  4XKT A;  3C1Z A;  3PWQ C;  1S3Q A;  2JD7 0;  4ITW A;  4MY7 A;  4II4 A;  4CYB A;  5HU6 D;  4AM4 A;  3MPS A;  4X0J A;  4CYA A;  4ETR A;  3C23 A;  4ZJK A;  3AF7 X;  4ZKH A;  4LQH A;  4DI0 A;  5E2D A;  3KA9 A;  2FZF A;  3RAV A;  4CVP A;  3ERZ A;  5LBH A;  5FFB A;  1JRE A;  3F39 A;  2XJO A;  3UOI A;  2MGY A;  3Q4O A;  2YJJ A;  3F35 A;  4LQN A;  4OYN A;  3AF8 X;  3R2L A;  2FKZ A;  4XGS A;  2IY4 A;  1OTK A;  2FG4 A;  1Z6O A;  5D8X A;  3AJP A;  2G4H A;  3PW1 A;  3NP2 X;  4XKU A;  3RD0 A;  5J8S A;  2CEI A;  1ZS3 A;  5E1U A;  1VEQ A;  3BVI A;  4ZLW A;  4QUW A;  2CWL A;  1SQ3 A;  2G38 B;  4YKH A;  3EGM A;  1O9I A;  3R2S A;  4ZKX A;  1F30 A;  5GU1 X;  4CMY V;  4PG1 A;  4M33 A;  3HL1 A;  5JDO A;  3PVT A;  3AK8 A;  4IWK A;  3F32 A;  1YUX A;  4MUD A;  4ISP A;  3BT5 A;  4CMY A;  1LKM A;  2C2J A;  2CN6 A;  2GYQ A;  1RCE A;  4EVD A;  4DYX A;  2ZA8 A;  1TKO A;  1Z6O M;  3QHB A;  1RCI A;  1R03 A;  2FL0 A;  2OKC A;  3A68 A;  1ZUJ A;  5GU0 X;  2ZA6 A;  2WTL A;  2C41 A;  3JZ9 A;  4TOF A;  1JI5 A;  1TJO A;  3OJ5 A;  2V2I A;  3R2K A;  3UFB A;  3WVW A;  1MFR A;  3E1O A;  2ZG8 X;  3FI6 A;  5D8P A;  1IES A;  3KWO A;  4ZTT A;  4YXJ A;  5C6F A;  1HRS A;  3PVR A;  2VXI A;  1F33 A;  2ITB A;  3PW8 C;  1JI4 A;  2ZG9 X;  5LG8 A;  4DYU A;  3C1Y A;  5FFC A;  5D8Y A;  1JGC A;  1GWG A;  2V2J A;  5CMQ A;  3RBC A;  4W4K B;  2V2N A;  5FEJ A;  2C6R A;  1RCC A;  4A25 A;  2RBD A;  2GYD A;  3AF9 X;  4MXP A;  4RC6 A;  3BVF A;  3M6J A;  2FJC A;  5CMR A;  1QYB A;  3D19 A;  2CLU A;  2N02 A;  2YW7 A;  1BCF A;  1IER A;  3L0M A;  4MKU A;  3NP0 X;  4LQV A;  1LKP A;  4ZL5 A;  5GN8 A;  3GHQ A;  3E1Q A;  3PVY A;  3WVU A;  4W4L B;  5HQO A;  3EZU A;  4TOA A;  2V2R A;  2YW6 A;  5LG2 A;  2CIH A;  1MOJ A;  1S2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...