4EVDA

Crystal structure hp-nap from strain ys29 cadmium loaded (cocrystallization 50mm)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
143
structure length
143
Chain Sequence
KTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKHLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil-activating protein
publication title Crystal structure of Helicobacter pylori neutrophil-activating protein with a di-nuclear ferroxidase center in a zinc or cadmium-bound form
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal transport
total genus 64
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4evdA00
4Z3BA 2XKQA 4IXKA 4EVDA 4RC5B 3WVWA 4TW3A 1VJXA 2ZA6A 1ZS3A 3PW8A 4EVCA 2GS4A 3AK8A 3SHXA 1XZ3A 2CN6A 2C41A 4U3GA 5JACA 2FL0A 3Q4OA 2IU2A 3PVTB 5GOUA 1KRQA 1NF4A 5GU1X 3R2RA 2CN7A 1O9IA 3A68A 4EVBA 2W0OA 1JGCA 4M32A 2Z5PA 4TODA 4LQNA 3NP0X 4DI0A 3PW1A 4DYYA 3T9JA 5LBHA 3KXUA 4DYUA 3Q4QA 2V2IA 3FSEA 2ZG8X 3RBCA 3AF8X 4E6KA 4XGSA 2WLAA 2YW6A 4PG0A 1RCIA 2C2JA 2OH3A 4Y08A 3BVLA 4TOCA 1NF6A 3RE7A 4CMYA 4ETRA 1RCGA 1Z4AA 1R03A 1F33A 3PWQA 3R2SA 2C6RA 4LPMA 4CYAA 3E1OA 2Z5QA 2VXXA 1VEQA 1QGHA 1JIGA 5HQOA 1YV1A 3OGHA 1YUXA 2FFXJ 3IQ1A 1L8IA 2BW1A 2BKCA 2V2RA 3UOIA 4P18A 2V2JA 4TOFA 3BKNA 5GU0X 3AK9A 3F35A 1S3QA 3GE4A 3R2OA 4ZL5A 3PVTA 3BVKA 3AJQA 1TJOA 4ITWA 5GN8A 4PGIA 1RYTA 4RC6B 2BK6A 4IWKA 3PW8C 1JI5A 5D8SA 4ERUA 4TOBA 2ZG9X 3KA3A 3RAVA 1NFVA 4ML5A 2CLUA 3E6SA 4LPJA 5K52A 5JKMG 4QUWA 3WNWA 3O7RA 3E1LA 3KA4A 1GWGA 1TKPA 3E1QA 3QHBA 3FVBA 2BJYA 2RBDA 3SIDA 4ZJKA 1DPSA 3TA8A 2V2NA 4CY9A 2FG8A 5D8XA 2YJJA 2GYQA 3R2KA 5CMQA 5HJHA 3GHQA 5JKLG 1LB3A 1XZ1A 3F36A 5D8QA 1F30A 3PWQC 4II4B 4XKTA 1SQ3A 2OC5A 2CEIA 3AF9X 3PVRB 1H96A 3KA9A 2PYBA 4XKSA 2WTLA 4Z5SA 4RC7A 2QF9A 1JTSA 4DASA 2C2UA 3BVEA 5GU2X 1EUMA 4M34A 4PGKA 4MJYA 1JKVA 3F33A 3MPSA 1DATA 4AM2A 4ITTA 3Q4NA 4AM4A 4ZMCA 5C6FA 3E1MA 1IESA 2ZG7X 5E2DA 2IB0A 2ZURX 3HL1A 2CHPA 3QD8A 4MUDA 1OTKA 5HJFA 5FFDA 1LKOA 2V2PA 5GU3X 1VELA 4CYBA 1L8HA 3AJPA 5LS9A 3PVYB 4MN9A 3F37A 1RCCA 5FFCA 4RC5A 2FZFA 4A25A 1DVBA 5J93A 2CIHA 1SOFA 3AF7X 3ES3A 5K53A 1QYBA 4LYXA 2YW7A 2V2OA 3OJ5A 4TO9A 2JD80 2Z6MA 1B71A 2FJCA 4LQHA 1O9RA 5I4JA 2CF7A 4LPNA 3H7GA 2HR5A 1UVHA 4M35A 1VEIA 3F38A 1Z6OA 3R2MA 2Z5RA 3Q4RA 3KA8A 5FEJA 5D8RA 1FHAA 3E1NA 2ZA7A 3UNOA 4KVRA 2XJMA 3PW1B 4TOHA 5JKMA 2XJOA 4CVRA 3KX9A 2G4HA 5E1UA 1RCDA 3E1PA 5LG8A 1LKPA 4ZL6A 4TOAA 2CLBA 1JYBA 2GYDA 3F34A 3BT5A 3PWFA 1LKMA 4MKUA 2V2MA 2V15A 1BG7A 4ZKXA 3BVIA 5JKLA 1TK6A 5D8PA 3QZ3A 4LYUA 3KA6A 1BCFA 4PG1A 1Z6OM 2JD60 4TOGA 1BFRA 3PZAA 4CVSA 4MY7A 2WLUA 4ZKWA 2V2SA 3R2HA 4TOEA 3UOFA 4LQJA 2UX1A 4KVQA 3F32A 1JKUA 4LQVA 4RC6A 1YUZA 3ISEA 1JI4A 1MOJA 4DYZA 1J30A 5GN8B 2ITBA 3AJOA 5CMRA 4REUA 5ERJA 3EGMA 4CVTA 4ISPA 1RCEA 1JREA 2HTNA 3EZUA 3KWOA 5AXSA 5IX6A 1UMNA 3QVDA 2CHIA 1TKOA 1VLGA 2FG4A 3NOZX 1N1QA 3VNXA 1ZUJA 3R2LA 2ZA8A 3ISFA 2C2FA 2VZBA 2F7NA 2VXIA 4DZ0A 4EVEA 4CMYV 3RD0A 3BVFA 3E2CA 5FFAA 3EZ0A 4KVSA 4ZTTA 4AM5A 3SH6A 5FFEA 4OYNA 3QHCA 4YKHA 5ERKA 5LG2A 2IY4A 3ERZA 4ISMA 5FFBA 4XKUA 4II4A 3RGDA 2D5KA 1NNQA 3IS7A 3WVVA 4DE6A 3SE1A 3QB9A 3FI6A 3PVRA 3F39A 2Z90A 2FKZA 3U90A 4CVPA 5D8YA 4ZLWA 3E1JA 4ZKHA 3A9QA 3WVUA 2XJNA 2YJKA 4M33A 4RC7B 1S2ZA 4RC8A 4DYXA 1AEWA 2JD70 5CZUA 2Y3QA 3IS8A 2QQYA 1HRSA 3NP2X 5J8WA 5J9VA 1IERA 2XGWA 3GVYA 3HIUA 1MFRA 3E6RA 4R42A 5J8SA 2V2LA 3PVYA 5D8OA 2X170 3O7SA 2FHAA 4IWJA 1S30A
chains in the Genus database with same CATH superfamily
4Z3BA 2XKQA 4IXKA 4EVDA 4RC5B 3WVWA 4TW3A 1VJXA 2ZA6A 4E40A 1ZS3A 3PW8A 4EVCA 2GS4A 3AK8A 3SHXA 1XZ3A 2CN6A 2C41A 4U3GA 4X0JA 5JACA 2FL0A 3Q4OA 2IU2A 3PVTB 5GOUA 1KRQA 1NF4A 5GU1X 3R2RA 2CN7A 1O9IA 3A68A 4EVBA 5JDOB 2W0OA 1JGCA 4M32A 2Z5PA 4TODA 4LQNA 3NP0X 4DI0A 3D19A 3PW1A 4DYYA 3T9JA 5LBHA 3KXUA 3W54A 3Q4QA 4DYUA 2V2IA 3FSEA 2ZG8X 3RBCA 3AF8X 4E6KA 4XGSA 2WLAA 2YW6A 4PG0A 1RCIA 2C2JA 2OH3A 4Y08A 3GGYA 3BVLA 4TOCA 1NF6A 3RE7A 4CMYA 4ETRA 4YXJA 1RCGA 2OKCA 1Z4AA 1R03A 1F33A 3PWQA 3R2SA 2C6RA 4LPMA 4CYAA 3E1OA 3DBYA 2Z5QA 2VXXA 1VEQA 1QGHA 1JIGA 4W4LB 5HQOA 1YV1A 3OGHA 1YUXA 2FFXJ 3IQ1A 1L8IA 2BW1A 2BKCA 2V2RA 3UOIA 4P18A 2V2JA 4TOFA 3BKNA 5GU0X 3AK9A 3F35A 5HU6D 1S3QA 3GE4A 3R2OA 4ZL5A 3PVTA 3BVKA 3AJQA 1TJOA 4ITWA 5GN8A 4PGIA 1RYTA 4RC6B 4W4KB 2BK6A 4IWKA 3PW8C 1JI5A 4WJG4 5D8SA 4ERUA 4TOBA 2N02A 2ZG9X 3KA3A 3RAVA 1NFVA 4ML5A 2CLUA 3E6SA 4LPJA 5K52A 5JKMG 2WWXB 2AR0A 4QUWA 3KHKA 3WNWA 4YXMA 3O7RA 3E1LA 3KA4A 1GWGA 1TKPA 3E1QA 3QHBA 3FVBA 2BJYA 2RBDA 3SIDA 4ZJKA 1DPSA 3TA8A 3FRRA 2V2NA 4CY9A 2FG8A 3C1YA 5D8XA 3C21A 2YJJA 2GYQA 3R2KA 5CMQA 5HJHA 3GHQA 5JKLG 1LB3A 1XZ1A 3F36A 5D8QA 1F30A 3PWQC 4II4B 4XKTA 1SQ3A 2CWLA 2OC5A 2CEIA 3AF9X 3PVRB 1H96A 3KA9A 4KXRB 2PYBA 4XKSA 2WTLA 4Z5SA 4RC7A 2QF9A 1JTSA 4DASA 2C2UA 3BVEA 5GU2X 1EUMA 4M34A 2G38B 4PGKA 4MJYA 1JKVA 3F33A 3C23A 3MPSA 1DATA 2V8UA 4AM2A 4ITTA 3Q4NA 3C1ZA 4AM4A 5C6FA 4ZMCA 3E1MA 1IESA 2ZG7X 5E2DA 2IB0A 2ZURX 3HL1A 2CHPA 3QD8A 4MUDA 3VV9A 1OTKA 5HJFA 3L0MA 5FFDA 1LKOA 2V2PA 5GU3X 1VELA 4CYBA 1L8HA 3AJPA 5LS9A 3PVYB 4MN9A 3F37A 1RCCA 5FFCA 4RC5A 2FZFA 4A25A 1DVBA 5J93A 2CIHA 1SOFA 3AF7X 3ES3A 5K53A 1QYBA 4LYXA 2YW7A 2V2OA 3OJ5A 4TO9A 2JD80 2Z6MA 1B71A 2FJCA 4LQHA 1O9RA 5I4JA 2CF7A 4LPNA 3H7GA 2HR5A 1UVHA 5JDOA 4M35A 1VEIA 3F38A 1Z6OA 3R2MA 2Z5RA 3Q4RA 3KA8A 5FEJA 2V8TA 5D8RA 1FHAA 3E1NA 2ZA7A 3UNOA 4KVRA 2XJMA 3PW1B 4TOHA 5JKMA 2XJOA 4CVRA 3KX9A 2G4HA 5E1UA 1RCDA 3E1PA 5LG8A 2Y44A 1LKPA 4ZL6A 4TOAA 2CLBA 1JYBA 2GYDA 3F34A 3BT5A 3PWFA 1LKMA 4MKUA 2V2MA 2V15A 1BG7A 4ZKXA 3BVIA 5JKLA 1TK6A 5D8PA 3QZ3A 2MGYA 4LYUA 3GGZA 3KA6A 1BCFA 4PG1A 1Z6OM 2JD60 4TOGA 1BFRA 3PZAA 4CVSA 4MY7A 2WLUA 4ZKWA 2V2SA 3R2HA 4TOEA 3UOFA 4LQJA 2UX1A 4KVQA 3F32A 1JKUA 4LQVA 4RC6A 1YUZA 3ISEA 1JI4A 1MOJA 4DYZA 1J30A 5GN8B 2ITBA 3UFBA 3AJOA 5CMRA 4REUA 4MXPA 5ERJA 3KDQA 3EGMA 4CVTA 4ISPA 1RCEA 1JREA 2HTNA 3EZUA 3KWOA 5AXSA 5IX6A 1UMNA 3QVDA 2CHIA 1TKOA 1VLGA 2FG4A 3NOZX 1N1QA 3VNXA 1ZUJA 3R2LA 2ZA8A 3ISFA 2C2FA 2VZBA 2F7NA 2VXIA 4DZ0A 4EVEA 3VVAA 4CMYV 3RD0A 3BVFA 3E2CA 5FFAA 3EZ0A 4KVSA 3M6JA 4ZTTA 4AM5A 3SH6A 5FFEA 4OYNA 3QHCA 4YKHA 5ERKA 5LG2A 2IY4A 3ERZA 4ISMA 5FFBA 4XKUA 4II4A 3RGDA 2D5KA 1NNQA 3JZ9A 3IS7A 3WVVA 4DE6A 3SE1A 3QB9A 3FI6A 3PVRA 3F39A 2Z90A 2FKZA 3U90A 4CVPA 5D8YA 4ZLWA 3E1JA 4ZKHA 3N6OA 3A9QA 3WVUA 2XJNA 3JZAB 2YJKA 4M33A 4RC7B 1S2ZA 4RC8A 4DYXA 1AEWA 2JD70 5CZUA 2Y3QA 3IS8A 3V3KB 2QQYA 1HRSA 3NP2X 5J8WA 5J9VA 1IERA 2XGWA 3GVYA 3HIUA 1MFRA 4YVZA 3E6RA 4R42A 5J8SA 2V2LA 3PVYA 5D8OA 2X170 3FRSA 3O7SA 2FHAA 4IWJA 3LKDA 1S30A
chains in the Genus database with same CATH topology
4Z3BA 2XKQA 4IXKA 4EVDA 4RC5B 3WVWA 4TW3A 1VJXA 2ZA6A 4E40A 1ZS3A 3PW8A 4EVCA 2GS4A 3AK8A 3SHXA 1XZ3A 2CN6A 2C41A 4U3GA 4X0JA 5JACA 2FL0A 3Q4OA 2IU2A 3PVTB 5GOUA 1KRQA 1NF4A 5GU1X 3R2RA 2CN7A 1O9IA 3A68A 4EVBA 5JDOB 2W0OA 1JGCA 4M32A 2Z5PA 4TODA 4LQNA 3NP0X 4DI0A 3D19A 3PW1A 4DYYA 3T9JA 5LBHA 3KXUA 3W54A 3Q4QA 4DYUA 2V2IA 3FSEA 2ZG8X 3RBCA 3AF8X 4E6KA 4XGSA 2WLAA 2YW6A 4PG0A 1RCIA 2C2JA 2OH3A 4Y08A 3GGYA 3BVLA 4TOCA 1NF6A 3RE7A 4CMYA 4ETRA 4YXJA 1RCGA 2OKCA 1Z4AA 1R03A 1F33A 3PWQA 3R2SA 2C6RA 4LPMA 4CYAA 3E1OA 3DBYA 2Z5QA 2VXXA 1VEQA 1QGHA 1JIGA 4W4LB 5HQOA 1YV1A 3OGHA 1YUXA 2FFXJ 3IQ1A 1L8IA 2BW1A 2BKCA 2V2RA 3UOIA 4P18A 2V2JA 4TOFA 3BKNA 5GU0X 3AK9A 3F35A 5HU6D 1S3QA 3GE4A 3R2OA 4ZL5A 3PVTA 3BVKA 3AJQA 1TJOA 4ITWA 5GN8A 4PGIA 1RYTA 4RC6B 4W4KB 2BK6A 4IWKA 3PW8C 1JI5A 4WJG4 5D8SA 4ERUA 4TOBA 2N02A 2ZG9X 3KA3A 3RAVA 1NFVA 4ML5A 2CLUA 3E6SA 4LPJA 5K52A 5JKMG 2WWXB 2AR0A 4QUWA 3KHKA 3WNWA 4YXMA 3O7RA 3E1LA 3KA4A 1GWGA 1TKPA 3E1QA 3QHBA 3FVBA 2BJYA 2RBDA 3SIDA 4ZJKA 1DPSA 3TA8A 3FRRA 2V2NA 4CY9A 2FG8A 3C1YA 5D8XA 3C21A 2YJJA 2GYQA 3R2KA 5CMQA 5HJHA 3GHQA 5JKLG 1LB3A 1XZ1A 3F36A 5D8QA 1F30A 3PWQC 4II4B 4XKTA 1SQ3A 2CWLA 2OC5A 2CEIA 3AF9X 3PVRB 1H96A 3KA9A 4KXRB 2PYBA 4XKSA 2WTLA 4Z5SA 4RC7A 2QF9A 1JTSA 4DASA 2C2UA 3BVEA 5GU2X 1EUMA 4M34A 2G38B 4PGKA 4MJYA 1JKVA 3F33A 3C23A 3MPSA 1DATA 2V8UA 4AM2A 4ITTA 3Q4NA 3C1ZA 4AM4A 5C6FA 4ZMCA 3E1MA 1IESA 2ZG7X 5E2DA 2IB0A 2ZURX 3HL1A 2CHPA 3QD8A 4MUDA 3VV9A 1OTKA 5HJFA 3L0MA 5FFDA 1LKOA 2V2PA 5GU3X 1VELA 4CYBA 1L8HA 3AJPA 5LS9A 3PVYB 4MN9A 3F37A 1RCCA 5FFCA 4RC5A 2FZFA 4A25A 1DVBA 5J93A 2CIHA 1SOFA 3AF7X 3ES3A 5K53A 1QYBA 4LYXA 2YW7A 2V2OA 3OJ5A 4TO9A 2JD80 2Z6MA 1B71A 2FJCA 4LQHA 1O9RA 5I4JA 2CF7A 4LPNA 3H7GA 2HR5A 1UVHA 5JDOA 4M35A 1VEIA 3F38A 1Z6OA 3R2MA 2Z5RA 3Q4RA 3KA8A 5FEJA 2V8TA 5D8RA 1FHAA 3E1NA 2ZA7A 3UNOA 4KVRA 2XJMA 3PW1B 4TOHA 5JKMA 2XJOA 4CVRA 3KX9A 2G4HA 5E1UA 1RCDA 3E1PA 5LG8A 2Y44A 1LKPA 4ZL6A 4TOAA 2CLBA 1JYBA 2GYDA 3F34A 3BT5A 3PWFA 1LKMA 4MKUA 2V2MA 2V15A 1BG7A 4ZKXA 3BVIA 5JKLA 1TK6A 5D8PA 3QZ3A 2MGYA 4LYUA 3GGZA 3KA6A 1BCFA 4PG1A 1Z6OM 2JD60 4TOGA 1BFRA 3PZAA 4CVSA 4MY7A 2WLUA 4ZKWA 2V2SA 3R2HA 4TOEA 3UOFA 4LQJA 2UX1A 4KVQA 3F32A 1JKUA 4LQVA 4RC6A 1YUZA 3ISEA 1JI4A 1MOJA 4DYZA 1J30A 5GN8B 2ITBA 3UFBA 3AJOA 5CMRA 4REUA 4MXPA 5ERJA 3KDQA 3EGMA 4CVTA 4ISPA 1RCEA 1JREA 2HTNA 3EZUA 3KWOA 5AXSA 5IX6A 1UMNA 3QVDA 2CHIA 1TKOA 1VLGA 2FG4A 3NOZX 1N1QA 3VNXA 1ZUJA 3R2LA 2ZA8A 3ISFA 2C2FA 2VZBA 2F7NA 2VXIA 4DZ0A 4EVEA 3VVAA 4CMYV 3RD0A 3BVFA 3E2CA 5FFAA 3EZ0A 4KVSA 3M6JA 4ZTTA 4AM5A 3SH6A 5FFEA 4OYNA 3QHCA 4YKHA 5ERKA 5LG2A 2IY4A 3ERZA 4ISMA 5FFBA 4XKUA 4II4A 3RGDA 2D5KA 1NNQA 3JZ9A 3IS7A 3WVVA 4DE6A 3SE1A 3QB9A 3FI6A 3PVRA 3F39A 2Z90A 2FKZA 3U90A 4CVPA 5D8YA 4ZLWA 3E1JA 4ZKHA 3N6OA 3A9QA 3WVUA 2XJNA 3JZAB 2YJKA 4M33A 4RC7B 1S2ZA 4RC8A 4DYXA 1AEWA 2JD70 5CZUA 2Y3QA 3IS8A 3V3KB 2QQYA 1HRSA 3NP2X 5J8WA 5J9VA 1IERA 2XGWA 3GVYA 3HIUA 1MFRA 4YVZA 3E6RA 4R42A 5J8SA 2V2LA 3PVYA 5D8OA 2X170 3FRSA 3O7SA 2FHAA 4IWJA 3LKDA 1S30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z3B A;  2XKQ A;  4IXK A;  4EVD A;  4RC5 B;  3WVW A;  4TW3 A;  1VJX A;  2ZA6 A;  1ZS3 A;  3PW8 A;  4EVC A;  2GS4 A;  3AK8 A;  3SHX A;  1XZ3 A;  2CN6 A;  2C41 A;  4U3G A;  5JAC A;  2FL0 A;  3Q4O A;  2IU2 A;  3PVT B;  5GOU A;  1KRQ A;  1NF4 A;  5GU1 X;  3R2R A;  2CN7 A;  1O9I A;  3A68 A;  4EVB A;  2W0O A;  1JGC A;  4M32 A;  2Z5P A;  4TOD A;  4LQN A;  3NP0 X;  4DI0 A;  3PW1 A;  4DYY A;  3T9J A;  5LBH A;  3KXU A;  4DYU A;  3Q4Q A;  2V2I A;  3FSE A;  2ZG8 X;  3RBC A;  3AF8 X;  4E6K A;  4XGS A;  2WLA A;  2YW6 A;  4PG0 A;  1RCI A;  2C2J A;  2OH3 A;  4Y08 A;  3BVL A;  4TOC A;  1NF6 A;  3RE7 A;  4CMY A;  4ETR A;  1RCG A;  1Z4A A;  1R03 A;  1F33 A;  3PWQ A;  3R2S A;  2C6R A;  4LPM A;  4CYA A;  3E1O A;  2Z5Q A;  2VXX A;  1VEQ A;  1QGH A;  1JIG A;  5HQO A;  1YV1 A;  3OGH A;  1YUX A;  2FFX J;  3IQ1 A;  1L8I A;  2BW1 A;  2BKC A;  2V2R A;  3UOI A;  4P18 A;  2V2J A;  4TOF A;  3BKN A;  5GU0 X;  3AK9 A;  3F35 A;  1S3Q A;  3GE4 A;  3R2O A;  4ZL5 A;  3PVT A;  3BVK A;  3AJQ A;  1TJO A;  4ITW A;  5GN8 A;  4PGI A;  1RYT A;  4RC6 B;  2BK6 A;  4IWK A;  3PW8 C;  1JI5 A;  5D8S A;  4ERU A;  4TOB A;  2ZG9 X;  3KA3 A;  3RAV A;  1NFV A;  4ML5 A;  2CLU A;  3E6S A;  4LPJ A;  5K52 A;  5JKM G;  4QUW A;  3WNW A;  3O7R A;  3E1L A;  3KA4 A;  1GWG A;  1TKP A;  3E1Q A;  3QHB A;  3FVB A;  2BJY A;  2RBD A;  3SID A;  4ZJK A;  1DPS A;  3TA8 A;  2V2N A;  4CY9 A;  2FG8 A;  5D8X A;  2YJJ A;  2GYQ A;  3R2K A;  5CMQ A;  5HJH A;  3GHQ A;  5JKL G;  1LB3 A;  1XZ1 A;  3F36 A;  5D8Q A;  1F30 A;  3PWQ C;  4II4 B;  4XKT A;  1SQ3 A;  2OC5 A;  2CEI A;  3AF9 X;  3PVR B;  1H96 A;  3KA9 A;  2PYB A;  4XKS A;  2WTL A;  4Z5S A;  4RC7 A;  2QF9 A;  1JTS A;  4DAS A;  2C2U A;  3BVE A;  5GU2 X;  1EUM A;  4M34 A;  4PGK A;  4MJY A;  1JKV A;  3F33 A;  3MPS A;  1DAT A;  4AM2 A;  4ITT A;  3Q4N A;  4AM4 A;  4ZMC A;  5C6F A;  3E1M A;  1IES A;  2ZG7 X;  5E2D A;  2IB0 A;  2ZUR X;  3HL1 A;  2CHP A;  3QD8 A;  4MUD A;  1OTK A;  5HJF A;  5FFD A;  1LKO A;  2V2P A;  5GU3 X;  1VEL A;  4CYB A;  1L8H A;  3AJP A;  5LS9 A;  3PVY B;  4MN9 A;  3F37 A;  1RCC A;  5FFC A;  4RC5 A;  2FZF A;  4A25 A;  1DVB A;  5J93 A;  2CIH A;  1SOF A;  3AF7 X;  3ES3 A;  5K53 A;  1QYB A;  4LYX A;  2YW7 A;  2V2O A;  3OJ5 A;  4TO9 A;  2JD8 0;  2Z6M A;  1B71 A;  2FJC A;  4LQH A;  1O9R A;  5I4J A;  2CF7 A;  4LPN A;  3H7G A;  2HR5 A;  1UVH A;  4M35 A;  1VEI A;  3F38 A;  1Z6O A;  3R2M A;  2Z5R A;  3Q4R A;  3KA8 A;  5FEJ A;  5D8R A;  1FHA A;  3E1N A;  2ZA7 A;  3UNO A;  4KVR A;  2XJM A;  3PW1 B;  4TOH A;  5JKM A;  2XJO A;  4CVR A;  3KX9 A;  2G4H A;  5E1U A;  1RCD A;  3E1P A;  5LG8 A;  1LKP A;  4ZL6 A;  4TOA A;  2CLB A;  1JYB A;  2GYD A;  3F34 A;  3BT5 A;  3PWF A;  1LKM A;  4MKU A;  2V2M A;  2V15 A;  1BG7 A;  4ZKX A;  3BVI A;  5JKL A;  1TK6 A;  5D8P A;  3QZ3 A;  4LYU A;  3KA6 A;  1BCF A;  4PG1 A;  1Z6O M;  2JD6 0;  4TOG A;  1BFR A;  3PZA A;  4CVS A;  4MY7 A;  2WLU A;  4ZKW A;  2V2S A;  3R2H A;  4TOE A;  3UOF A;  4LQJ A;  2UX1 A;  4KVQ A;  3F32 A;  1JKU A;  4LQV A;  4RC6 A;  1YUZ A;  3ISE A;  1JI4 A;  1MOJ A;  4DYZ A;  1J30 A;  5GN8 B;  2ITB A;  3AJO A;  5CMR A;  4REU A;  5ERJ A;  3EGM A;  4CVT A;  4ISP A;  1RCE A;  1JRE A;  2HTN A;  3EZU A;  3KWO A;  5AXS A;  5IX6 A;  1UMN A;  3QVD A;  2CHI A;  1TKO A;  1VLG A;  2FG4 A;  3NOZ X;  1N1Q A;  3VNX A;  1ZUJ A;  3R2L A;  2ZA8 A;  3ISF A;  2C2F A;  2VZB A;  2F7N A;  2VXI A;  4DZ0 A;  4EVE A;  4CMY V;  3RD0 A;  3BVF A;  3E2C A;  5FFA A;  3EZ0 A;  4KVS A;  4ZTT A;  4AM5 A;  3SH6 A;  5FFE A;  4OYN A;  3QHC A;  4YKH A;  5ERK A;  5LG2 A;  2IY4 A;  3ERZ A;  4ISM A;  5FFB A;  4XKU A;  4II4 A;  3RGD A;  2D5K A;  1NNQ A;  3IS7 A;  3WVV A;  4DE6 A;  3SE1 A;  3QB9 A;  3FI6 A;  3PVR A;  3F39 A;  2Z90 A;  2FKZ A;  3U90 A;  4CVP A;  5D8Y A;  4ZLW A;  3E1J A;  4ZKH A;  3A9Q A;  3WVU A;  2XJN A;  2YJK A;  4M33 A;  4RC7 B;  1S2Z A;  4RC8 A;  4DYX A;  1AEW A;  2JD7 0;  5CZU A;  2Y3Q A;  3IS8 A;  2QQY A;  1HRS A;  3NP2 X;  5J8W A;  5J9V A;  1IER A;  2XGW A;  3GVY A;  3HIU A;  1MFR A;  3E6R A;  4R42 A;  5J8S A;  2V2L A;  3PVY A;  5D8O A;  2X17 0;  3O7S A;  2FHA A;  4IWJ A;  1S30 A; 
#chains in the Genus database with same CATH topology
 4Z3B A;  2XKQ A;  4IXK A;  4EVD A;  4RC5 B;  3WVW A;  4TW3 A;  1VJX A;  2ZA6 A;  4E40 A;  1ZS3 A;  3PW8 A;  4EVC A;  2GS4 A;  3AK8 A;  3SHX A;  1XZ3 A;  2CN6 A;  2C41 A;  4U3G A;  4X0J A;  5JAC A;  2FL0 A;  3Q4O A;  2IU2 A;  3PVT B;  5GOU A;  1KRQ A;  1NF4 A;  5GU1 X;  3R2R A;  2CN7 A;  1O9I A;  3A68 A;  4EVB A;  5JDO B;  2W0O A;  1JGC A;  4M32 A;  2Z5P A;  4TOD A;  4LQN A;  3NP0 X;  4DI0 A;  3D19 A;  3PW1 A;  4DYY A;  3T9J A;  5LBH A;  3KXU A;  3W54 A;  3Q4Q A;  4DYU A;  2V2I A;  3FSE A;  2ZG8 X;  3RBC A;  3AF8 X;  4E6K A;  4XGS A;  2WLA A;  2YW6 A;  4PG0 A;  1RCI A;  2C2J A;  2OH3 A;  4Y08 A;  3GGY A;  3BVL A;  4TOC A;  1NF6 A;  3RE7 A;  4CMY A;  4ETR A;  4YXJ A;  1RCG A;  2OKC A;  1Z4A A;  1R03 A;  1F33 A;  3PWQ A;  3R2S A;  2C6R A;  4LPM A;  4CYA A;  3E1O A;  3DBY A;  2Z5Q A;  2VXX A;  1VEQ A;  1QGH A;  1JIG A;  4W4L B;  5HQO A;  1YV1 A;  3OGH A;  1YUX A;  2FFX J;  3IQ1 A;  1L8I A;  2BW1 A;  2BKC A;  2V2R A;  3UOI A;  4P18 A;  2V2J A;  4TOF A;  3BKN A;  5GU0 X;  3AK9 A;  3F35 A;  5HU6 D;  1S3Q A;  3GE4 A;  3R2O A;  4ZL5 A;  3PVT A;  3BVK A;  3AJQ A;  1TJO A;  4ITW A;  5GN8 A;  4PGI A;  1RYT A;  4RC6 B;  4W4K B;  2BK6 A;  4IWK A;  3PW8 C;  1JI5 A;  4WJG 4;  5D8S A;  4ERU A;  4TOB A;  2N02 A;  2ZG9 X;  3KA3 A;  3RAV A;  1NFV A;  4ML5 A;  2CLU A;  3E6S A;  4LPJ A;  5K52 A;  5JKM G;  2WWX B;  2AR0 A;  4QUW A;  3KHK A;  3WNW A;  4YXM A;  3O7R A;  3E1L A;  3KA4 A;  1GWG A;  1TKP A;  3E1Q A;  3QHB A;  3FVB A;  2BJY A;  2RBD A;  3SID A;  4ZJK A;  1DPS A;  3TA8 A;  3FRR A;  2V2N A;  4CY9 A;  2FG8 A;  3C1Y A;  5D8X A;  3C21 A;  2YJJ A;  2GYQ A;  3R2K A;  5CMQ A;  5HJH A;  3GHQ A;  5JKL G;  1LB3 A;  1XZ1 A;  3F36 A;  5D8Q A;  1F30 A;  3PWQ C;  4II4 B;  4XKT A;  1SQ3 A;  2CWL A;  2OC5 A;  2CEI A;  3AF9 X;  3PVR B;  1H96 A;  3KA9 A;  4KXR B;  2PYB A;  4XKS A;  2WTL A;  4Z5S A;  4RC7 A;  2QF9 A;  1JTS A;  4DAS A;  2C2U A;  3BVE A;  5GU2 X;  1EUM A;  4M34 A;  2G38 B;  4PGK A;  4MJY A;  1JKV A;  3F33 A;  3C23 A;  3MPS A;  1DAT A;  2V8U A;  4AM2 A;  4ITT A;  3Q4N A;  3C1Z A;  4AM4 A;  5C6F A;  4ZMC A;  3E1M A;  1IES A;  2ZG7 X;  5E2D A;  2IB0 A;  2ZUR X;  3HL1 A;  2CHP A;  3QD8 A;  4MUD A;  3VV9 A;  1OTK A;  5HJF A;  3L0M A;  5FFD A;  1LKO A;  2V2P A;  5GU3 X;  1VEL A;  4CYB A;  1L8H A;  3AJP A;  5LS9 A;  3PVY B;  4MN9 A;  3F37 A;  1RCC A;  5FFC A;  4RC5 A;  2FZF A;  4A25 A;  1DVB A;  5J93 A;  2CIH A;  1SOF A;  3AF7 X;  3ES3 A;  5K53 A;  1QYB A;  4LYX A;  2YW7 A;  2V2O A;  3OJ5 A;  4TO9 A;  2JD8 0;  2Z6M A;  1B71 A;  2FJC A;  4LQH A;  1O9R A;  5I4J A;  2CF7 A;  4LPN A;  3H7G A;  2HR5 A;  1UVH A;  5JDO A;  4M35 A;  1VEI A;  3F38 A;  1Z6O A;  3R2M A;  2Z5R A;  3Q4R A;  3KA8 A;  5FEJ A;  2V8T A;  5D8R A;  1FHA A;  3E1N A;  2ZA7 A;  3UNO A;  4KVR A;  2XJM A;  3PW1 B;  4TOH A;  5JKM A;  2XJO A;  4CVR A;  3KX9 A;  2G4H A;  5E1U A;  1RCD A;  3E1P A;  5LG8 A;  2Y44 A;  1LKP A;  4ZL6 A;  4TOA A;  2CLB A;  1JYB A;  2GYD A;  3F34 A;  3BT5 A;  3PWF A;  1LKM A;  4MKU A;  2V2M A;  2V15 A;  1BG7 A;  4ZKX A;  3BVI A;  5JKL A;  1TK6 A;  5D8P A;  3QZ3 A;  2MGY A;  4LYU A;  3GGZ A;  3KA6 A;  1BCF A;  4PG1 A;  1Z6O M;  2JD6 0;  4TOG A;  1BFR A;  3PZA A;  4CVS A;  4MY7 A;  2WLU A;  4ZKW A;  2V2S A;  3R2H A;  4TOE A;  3UOF A;  4LQJ A;  2UX1 A;  4KVQ A;  3F32 A;  1JKU A;  4LQV A;  4RC6 A;  1YUZ A;  3ISE A;  1JI4 A;  1MOJ A;  4DYZ A;  1J30 A;  5GN8 B;  2ITB A;  3UFB A;  3AJO A;  5CMR A;  4REU A;  4MXP A;  5ERJ A;  3KDQ A;  3EGM A;  4CVT A;  4ISP A;  1RCE A;  1JRE A;  2HTN A;  3EZU A;  3KWO A;  5AXS A;  5IX6 A;  1UMN A;  3QVD A;  2CHI A;  1TKO A;  1VLG A;  2FG4 A;  3NOZ X;  1N1Q A;  3VNX A;  1ZUJ A;  3R2L A;  2ZA8 A;  3ISF A;  2C2F A;  2VZB A;  2F7N A;  2VXI A;  4DZ0 A;  4EVE A;  3VVA A;  4CMY V;  3RD0 A;  3BVF A;  3E2C A;  5FFA A;  3EZ0 A;  4KVS A;  3M6J A;  4ZTT A;  4AM5 A;  3SH6 A;  5FFE A;  4OYN A;  3QHC A;  4YKH A;  5ERK A;  5LG2 A;  2IY4 A;  3ERZ A;  4ISM A;  5FFB A;  4XKU A;  4II4 A;  3RGD A;  2D5K A;  1NNQ A;  3JZ9 A;  3IS7 A;  3WVV A;  4DE6 A;  3SE1 A;  3QB9 A;  3FI6 A;  3PVR A;  3F39 A;  2Z90 A;  2FKZ A;  3U90 A;  4CVP A;  5D8Y A;  4ZLW A;  3E1J A;  4ZKH A;  3N6O A;  3A9Q A;  3WVU A;  2XJN A;  3JZA B;  2YJK A;  4M33 A;  4RC7 B;  1S2Z A;  4RC8 A;  4DYX A;  1AEW A;  2JD7 0;  5CZU A;  2Y3Q A;  3IS8 A;  3V3K B;  2QQY A;  1HRS A;  3NP2 X;  5J8W A;  5J9V A;  1IER A;  2XGW A;  3GVY A;  3HIU A;  1MFR A;  4YVZ A;  3E6R A;  4R42 A;  5J8S A;  2V2L A;  3PVY A;  5D8O A;  2X17 0;  3FRS A;  3O7S A;  2FHA A;  4IWJ A;  3LKD A;  1S30 A; 
#chains in the Genus database with same CATH homology
 4Z3B A;  2XKQ A;  4IXK A;  4EVD A;  4RC5 B;  3WVW A;  4TW3 A;  1VJX A;  2ZA6 A;  4E40 A;  1ZS3 A;  3PW8 A;  4EVC A;  2GS4 A;  3AK8 A;  3SHX A;  1XZ3 A;  2CN6 A;  2C41 A;  4U3G A;  4X0J A;  5JAC A;  2FL0 A;  3Q4O A;  2IU2 A;  3PVT B;  5GOU A;  1KRQ A;  1NF4 A;  5GU1 X;  3R2R A;  2CN7 A;  1O9I A;  3A68 A;  4EVB A;  5JDO B;  2W0O A;  1JGC A;  4M32 A;  2Z5P A;  4TOD A;  4LQN A;  3NP0 X;  4DI0 A;  3D19 A;  3PW1 A;  4DYY A;  3T9J A;  5LBH A;  3KXU A;  3W54 A;  3Q4Q A;  4DYU A;  2V2I A;  3FSE A;  2ZG8 X;  3RBC A;  3AF8 X;  4E6K A;  4XGS A;  2WLA A;  2YW6 A;  4PG0 A;  1RCI A;  2C2J A;  2OH3 A;  4Y08 A;  3GGY A;  3BVL A;  4TOC A;  1NF6 A;  3RE7 A;  4CMY A;  4ETR A;  4YXJ A;  1RCG A;  2OKC A;  1Z4A A;  1R03 A;  1F33 A;  3PWQ A;  3R2S A;  2C6R A;  4LPM A;  4CYA A;  3E1O A;  3DBY A;  2Z5Q A;  2VXX A;  1VEQ A;  1QGH A;  1JIG A;  4W4L B;  5HQO A;  1YV1 A;  3OGH A;  1YUX A;  2FFX J;  3IQ1 A;  1L8I A;  2BW1 A;  2BKC A;  2V2R A;  3UOI A;  4P18 A;  2V2J A;  4TOF A;  3BKN A;  5GU0 X;  3AK9 A;  3F35 A;  5HU6 D;  1S3Q A;  3GE4 A;  3R2O A;  4ZL5 A;  3PVT A;  3BVK A;  3AJQ A;  1TJO A;  4ITW A;  5GN8 A;  4PGI A;  1RYT A;  4RC6 B;  4W4K B;  2BK6 A;  4IWK A;  3PW8 C;  1JI5 A;  4WJG 4;  5D8S A;  4ERU A;  4TOB A;  2N02 A;  2ZG9 X;  3KA3 A;  3RAV A;  1NFV A;  4ML5 A;  2CLU A;  3E6S A;  4LPJ A;  5K52 A;  5JKM G;  2WWX B;  2AR0 A;  4QUW A;  3KHK A;  3WNW A;  4YXM A;  3O7R A;  3E1L A;  3KA4 A;  1GWG A;  1TKP A;  3E1Q A;  3QHB A;  3FVB A;  2BJY A;  2RBD A;  3SID A;  4ZJK A;  1DPS A;  3TA8 A;  3FRR A;  2V2N A;  4CY9 A;  2FG8 A;  3C1Y A;  5D8X A;  3C21 A;  2YJJ A;  2GYQ A;  3R2K A;  5CMQ A;  5HJH A;  3GHQ A;  5JKL G;  1LB3 A;  1XZ1 A;  3F36 A;  5D8Q A;  1F30 A;  3PWQ C;  4II4 B;  4XKT A;  1SQ3 A;  2CWL A;  2OC5 A;  2CEI A;  3AF9 X;  3PVR B;  1H96 A;  3KA9 A;  4KXR B;  2PYB A;  4XKS A;  2WTL A;  4Z5S A;  4RC7 A;  2QF9 A;  1JTS A;  4DAS A;  2C2U A;  3BVE A;  5GU2 X;  1EUM A;  4M34 A;  2G38 B;  4PGK A;  4MJY A;  1JKV A;  3F33 A;  3C23 A;  3MPS A;  1DAT A;  2V8U A;  4AM2 A;  4ITT A;  3Q4N A;  3C1Z A;  4AM4 A;  5C6F A;  4ZMC A;  3E1M A;  1IES A;  2ZG7 X;  5E2D A;  2IB0 A;  2ZUR X;  3HL1 A;  2CHP A;  3QD8 A;  4MUD A;  3VV9 A;  1OTK A;  5HJF A;  3L0M A;  5FFD A;  1LKO A;  2V2P A;  5GU3 X;  1VEL A;  4CYB A;  1L8H A;  3AJP A;  5LS9 A;  3PVY B;  4MN9 A;  3F37 A;  1RCC A;  5FFC A;  4RC5 A;  2FZF A;  4A25 A;  1DVB A;  5J93 A;  2CIH A;  1SOF A;  3AF7 X;  3ES3 A;  5K53 A;  1QYB A;  4LYX A;  2YW7 A;  2V2O A;  3OJ5 A;  4TO9 A;  2JD8 0;  2Z6M A;  1B71 A;  2FJC A;  4LQH A;  1O9R A;  5I4J A;  2CF7 A;  4LPN A;  3H7G A;  2HR5 A;  1UVH A;  5JDO A;  4M35 A;  1VEI A;  3F38 A;  1Z6O A;  3R2M A;  2Z5R A;  3Q4R A;  3KA8 A;  5FEJ A;  2V8T A;  5D8R A;  1FHA A;  3E1N A;  2ZA7 A;  3UNO A;  4KVR A;  2XJM A;  3PW1 B;  4TOH A;  5JKM A;  2XJO A;  4CVR A;  3KX9 A;  2G4H A;  5E1U A;  1RCD A;  3E1P A;  5LG8 A;  2Y44 A;  1LKP A;  4ZL6 A;  4TOA A;  2CLB A;  1JYB A;  2GYD A;  3F34 A;  3BT5 A;  3PWF A;  1LKM A;  4MKU A;  2V2M A;  2V15 A;  1BG7 A;  4ZKX A;  3BVI A;  5JKL A;  1TK6 A;  5D8P A;  3QZ3 A;  2MGY A;  4LYU A;  3GGZ A;  3KA6 A;  1BCF A;  4PG1 A;  1Z6O M;  2JD6 0;  4TOG A;  1BFR A;  3PZA A;  4CVS A;  4MY7 A;  2WLU A;  4ZKW A;  2V2S A;  3R2H A;  4TOE A;  3UOF A;  4LQJ A;  2UX1 A;  4KVQ A;  3F32 A;  1JKU A;  4LQV A;  4RC6 A;  1YUZ A;  3ISE A;  1JI4 A;  1MOJ A;  4DYZ A;  1J30 A;  5GN8 B;  2ITB A;  3UFB A;  3AJO A;  5CMR A;  4REU A;  4MXP A;  5ERJ A;  3KDQ A;  3EGM A;  4CVT A;  4ISP A;  1RCE A;  1JRE A;  2HTN A;  3EZU A;  3KWO A;  5AXS A;  5IX6 A;  1UMN A;  3QVD A;  2CHI A;  1TKO A;  1VLG A;  2FG4 A;  3NOZ X;  1N1Q A;  3VNX A;  1ZUJ A;  3R2L A;  2ZA8 A;  3ISF A;  2C2F A;  2VZB A;  2F7N A;  2VXI A;  4DZ0 A;  4EVE A;  3VVA A;  4CMY V;  3RD0 A;  3BVF A;  3E2C A;  5FFA A;  3EZ0 A;  4KVS A;  3M6J A;  4ZTT A;  4AM5 A;  3SH6 A;  5FFE A;  4OYN A;  3QHC A;  4YKH A;  5ERK A;  5LG2 A;  2IY4 A;  3ERZ A;  4ISM A;  5FFB A;  4XKU A;  4II4 A;  3RGD A;  2D5K A;  1NNQ A;  3JZ9 A;  3IS7 A;  3WVV A;  4DE6 A;  3SE1 A;  3QB9 A;  3FI6 A;  3PVR A;  3F39 A;  2Z90 A;  2FKZ A;  3U90 A;  4CVP A;  5D8Y A;  4ZLW A;  3E1J A;  4ZKH A;  3N6O A;  3A9Q A;  3WVU A;  2XJN A;  3JZA B;  2YJK A;  4M33 A;  4RC7 B;  1S2Z A;  4RC8 A;  4DYX A;  1AEW A;  2JD7 0;  5CZU A;  2Y3Q A;  3IS8 A;  3V3K B;  2QQY A;  1HRS A;  3NP2 X;  5J8W A;  5J9V A;  1IER A;  2XGW A;  3GVY A;  3HIU A;  1MFR A;  4YVZ A;  3E6R A;  4R42 A;  5J8S A;  2V2L A;  3PVY A;  5D8O A;  2X17 0;  3FRS A;  3O7S A;  2FHA A;  4IWJ A;  3LKD A;  1S30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...