5C6FA

Crystal structures of ferritin mutants reveal side-on binding to diiron and end-on cleavage of oxygen
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
172
structure length
172
Chain Sequence
b'HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYELEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial non-heme ferritin
publication title Structural Basis of Novel Iron-Uptake Route and Reaction Intermediates in Ferritins from Gram-Negative Bacteria.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 78
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5c6fA00
2OC5A 3AK8A 3F34A 5GU0X 5FFDA 4XGSA 5ERKA 2C2JA 2YJJA 2JD80 1VJXA 3E1NA 1BCFA 3UOFA 3F38A 1VLGA 3SIDA 4DI0A 4U3GA 5LS9A 4M33A 3E1JA 2XJNA 2BK6A 4R42A 3EZ0A 1Z6OM 3PWFA 3FVBA 1NF6A 5JACA 2XKQA 3AF8X 1VELA 4TODA 3RBCA 3UNOA 3NP2X 3GVYA 2CLBA 5HQOA 3PZAA 1YV1A 5J8SA 4RC8A 1JREA 5FFAA 3ISEA 2ZA7A 4LYUA 2IY4A 4LYXA 3ISFA 3H7GA 3F32A 3IQ1A 4TOFA 2CF7A 3PVTA 4A25A 3FI6A 1LB3A 3E6SA 2XGWA 1DPSA 1JKUA 2FG8A 4DYYA 1YUZA 4KVSA 1JI4A 2ITBA 4LPJA 5J9VA 3SHXA 2Z5QA 5D8OA 5C6FA 5D8SA 4XKUA 3NP0X 3BKNA 5GU2X 2FZFA 5AXSA 3O7SA 4DASA 1JTSA 1R03A 4IXKA 2RBDA 3AJOA 1ZS3A 2Z5RA 3UOIA 4AM2A 1XZ1A 4CVTA 4PG0A 2QQYA 3QHBA 2Y3QA 3AF9X 2YW6A 3E1LA 5JKLG 4PGIA 3QB9A 3PVRB 3PVTB 1KRQA 2BKCA 3EZUA 4TOGA 3F36A 2BJYA 3AJQA 1UMNA 2FJCA 3QVDA 2JD70 2V2IA 3PW8C 4CY9A 3U90A 3R2MA 4IWKA 2FL0A 2WTLA 4MN9A 2VXIA 4ETRA 1YUXA 1HRSA 1ZUJA 4MY7A 3KXUA 5FFEA 4LQNA 2XJMA 3HIUA 5IX6A 5GN8B 4E6KA 3R2KA 4DYXA 2VXXA 5FFCA 1AEWA 4ZKHA 2GYDA 5K53A 2ZG8X 2CN7A 2PYBA 2VZBA 4DYZA 2W0OA 1EUMA 2ZG9X 4ZKXA 4DZ0A 1VEIA 3PWQC 1JKVA 1NF4A 1NFVA 3HL1A 2CEIA 1VEQA 4ZL6A 4KVRA 2X170 5E1UA 4TOBA 4LPNA 4TOHA 4CYAA 4AM5A 3QHCA 3BVIA 1RCEA 3WVWA 2V2OA 3EGMA 3R2HA 4P18A 3FSEA 5LBHA 2YW7A 3E2CA 1DVBA 1JI5A 2Z5PA 3ERZA 3PVRA 3SE1A 3Q4QA 3E1OA 1QGHA 1SOFA 1TJOA 2Z90A 4ZTTA 5GU1X 4Y08A 1S2ZA 3RGDA 2UX1A 1LKPA 4CVRA 3PWQA 4EVBA 1MFRA 2FFXJ 4LQVA 2QF9A 1DATA 4TO9A 4LQHA 5HJHA 2CLUA 2ZA8A 5FFBA 1OTKA 4M35A 3IS8A 3BVKA 2JD60 1BG7A 3E1PA 4CMYV 2V2SA 5GN8A 4II4A 3BVLA 2OH3A 4IWJA 3PW1A 4TOCA 4TOAA 1J30A 1Z6OA 1QYBA 4EVEA 5JKMA 2V15A 3WVUA 3BVFA 4MUDA 4QUWA 2IU2A 1RCCA 2Z6MA 3SH6A 4ZLWA 3ES3A 4MJYA 2FHAA 4M34A 1TK6A 2V2NA 1NNQA 2CIHA 4LQJA 1LKOA 5E2DA 4TOEA 3GE4A 3OGHA 3F37A 5GOUA 4ZMCA 4EVCA 1F30A 3KA6A 3MPSA 2C2UA 5GU3X 2F7NA 5CMRA 1S3QA 4RC5A 2ZG7X 4ISPA 2IB0A 4LPMA 3AF7X 4REUA 1S30A 4CVPA 3WVVA 4DYUA 2D5KA 3QD8A 2V2JA 1IERA 4II4B 1RCIA 3RD0A 3PW1B 1O9IA 5D8PA 3RE7A 1L8HA 1N1QA 4ITWA 4AM4A 2ZURX 3TA8A 5J8WA 3BT5A 2FKZA 3O7RA 3PVYA 2CHIA 1RYTA 1JYBA 1B71A 3WNWA 4CVSA 1L8IA 3F33A 2V2LA 3A68A 3E6RA 3PW8A 1SQ3A 4RC6A 1H96A 1IESA 5LG2A 4KVQA 2GS4A 2HTNA 1TKPA 4XKTA 2CN6A 1Z4AA 4RC5B 3KX9A 4TW3A 3KA4A 1JGCA 4Z3BA 3R2OA 3R2LA 2BW1A 1O9RA 5K52A 1FHAA 2CHPA 4ITTA 4CMYA 4RC7A 5D8YA 1GWGA 3QZ3A 4XKSA 2XJOA 4ZJKA 1BFRA 3PVYB 1JIGA 5D8QA 3F35A 4ERUA 1MOJA 4DE6A 5FEJA 2V2RA 4CYBA 1RCDA 4RC6B 1TKOA 3Q4RA 5D8RA 3T9JA 4MKUA 3KA3A 1XZ3A 4M32A 4PGKA 4ML5A 5CZUA 5JKMG 2HR5A 3KA8A 3BVEA 3GHQA 3Q4NA 3E1QA 2WLAA 1RCGA 2G4HA 1F33A 4EVDA 2WLUA 2YJKA 5J93A 5ERJA 3AJPA 2GYQA 4OYNA 4RC7B 3E1MA 3F39A 3AK9A 4YKHA 4ZKWA 5HJFA 5LG8A 3NOZX 2V2PA 5I4JA 4ISMA 5D8XA 1LKMA 3Q4OA 3OJ5A 3IS7A 4Z5SA 2C6RA 3R2RA 5JKLA 1UVHA 4ZL5A 5CMQA 4PG1A 3KA9A 3KWOA 3VNXA 2ZA6A 2C41A 3A9QA 3R2SA 2FG4A 3RAVA 2V2MA 2C2FA
chains in the Genus database with same CATH superfamily
3C1YA 2OC5A 3AK8A 3F34A 5GU0X 5FFDA 4XGSA 5ERKA 2C2JA 2YJJA 5JDOA 2JD80 1VJXA 3E1NA 3C21A 1BCFA 3UOFA 3F38A 1VLGA 3SIDA 4DI0A 4U3GA 5LS9A 4M33A 3E1JA 2XJNA 2BK6A 4R42A 4E40A 3EZ0A 1Z6OM 3PWFA 3FVBA 1NF6A 5JACA 2XKQA 3AF8X 1VELA 4TODA 3RBCA 3UNOA 3NP2X 3GVYA 2CLBA 5HQOA 3M6JA 1YV1A 3PZAA 5J8SA 4RC8A 1JREA 5FFAA 3W54A 3ISEA 3GGZA 2ZA7A 4LYUA 5JDOB 2IY4A 4LYXA 3ISFA 3H7GA 3F32A 3IQ1A 4TOFA 2CF7A 3PVTA 4A25A 3FI6A 1LB3A 3KHKA 3E6SA 2XGWA 1DPSA 1JKUA 2FG8A 4DYYA 1YUZA 4KVSA 1JI4A 2ITBA 4LPJA 5J9VA 3VVAA 3SHXA 2Z5QA 5D8OA 5C6FA 5D8SA 4XKUA 3NP0X 3BKNA 5GU2X 2FZFA 5AXSA 3O7SA 4DASA 1JTSA 1R03A 4IXKA 2RBDA 3AJOA 1ZS3A 2Z5RA 3UOIA 4AM2A 1XZ1A 4CVTA 4PG0A 2QQYA 3QHBA 2Y3QA 3AF9X 2YW6A 3E1LA 3JZAB 5JKLG 4WJG4 4PGIA 4W4LB 3QB9A 4W4KB 3PVRB 3PVTB 1KRQA 2CWLA 2BKCA 3EZUA 4TOGA 3KDQA 2WWXB 3F36A 2BJYA 3C1ZA 3AJQA 1UMNA 2FJCA 3QVDA 2JD70 2V2IA 3PW8C 4CY9A 3U90A 3R2MA 4IWKA 2FL0A 2WTLA 4MN9A 2VXIA 4ETRA 1YUXA 1HRSA 1ZUJA 4MY7A 3KXUA 5FFEA 4LQNA 2N02A 2XJMA 3HIUA 5IX6A 5GN8B 4E6KA 3R2KA 4DYXA 2VXXA 5FFCA 1AEWA 4ZKHA 2GYDA 5K53A 2ZG8X 2CN7A 2PYBA 2VZBA 4DYZA 2W0OA 1EUMA 2ZG9X 4ZKXA 4DZ0A 1VEIA 3PWQC 1JKVA 1NF4A 1NFVA 3HL1A 2CEIA 3V3KB 1VEQA 3DBYA 4ZL6A 2MGYA 4KVRA 2X170 2G38B 4TOBA 5E1UA 4LPNA 4TOHA 4CYAA 4AM5A 3QHCA 3BVIA 2V8TA 1RCEA 3WVWA 2V2OA 3EGMA 3R2HA 4P18A 3FSEA 5LBHA 2YW7A 3E2CA 1DVBA 1JI5A 2Z5PA 3ERZA 3PVRA 3SE1A 3Q4QA 3E1OA 1QGHA 1SOFA 1TJOA 2Z90A 4ZTTA 5GU1X 4Y08A 1S2ZA 3RGDA 2UX1A 1LKPA 4CVRA 3PWQA 4EVBA 2OKCA 1MFRA 2FFXJ 4LQVA 2QF9A 1DATA 4TO9A 4LQHA 5HJHA 2CLUA 2ZA8A 3C23A 5FFBA 1OTKA 4M35A 3IS8A 3BVKA 2JD60 1BG7A 3JZ9A 3E1PA 4CMYV 2V2SA 5GN8A 4II4A 3BVLA 2OH3A 4IWJA 3PW1A 4TOCA 4TOAA 1J30A 1Z6OA 1QYBA 4EVEA 3L0MA 5JKMA 2V15A 3FRSA 2Y44A 3N6OA 3WVUA 3BVFA 4MUDA 4QUWA 2IU2A 1RCCA 2Z6MA 3SH6A 4ZLWA 3ES3A 4MJYA 2FHAA 4M34A 1TK6A 2V2NA 1NNQA 2CIHA 4LQJA 4MXPA 1LKOA 5E2DA 4TOEA 3GE4A 3OGHA 3F37A 5GOUA 4ZMCA 4EVCA 1F30A 3KA6A 3MPSA 2C2UA 5GU3X 2F7NA 5CMRA 1S3QA 4RC5A 2ZG7X 4ISPA 2IB0A 4LPMA 3AF7X 4REUA 1S30A 4CVPA 3WVVA 4DYUA 2D5KA 3QD8A 4KXRB 2V2JA 1IERA 4II4B 1RCIA 3D19A 3RD0A 3PW1B 1O9IA 5D8PA 3RE7A 1L8HA 1N1QA 4ITWA 4X0JA 4AM4A 2ZURX 3TA8A 5J8WA 3BT5A 2FKZA 3O7RA 3PVYA 2CHIA 1RYTA 1JYBA 1B71A 3WNWA 4CVSA 1L8IA 3F33A 2V2LA 3VV9A 3A68A 3E6RA 3FRRA 3GGYA 3PW8A 4YXJA 1SQ3A 4RC6A 1H96A 1IESA 5LG2A 4KVQA 2GS4A 2HTNA 1TKPA 4XKTA 2CN6A 1Z4AA 3LKDA 4RC5B 3KX9A 4TW3A 3KA4A 1JGCA 4Z3BA 3R2OA 3R2LA 2BW1A 1O9RA 5K52A 1FHAA 2CHPA 4ITTA 4CMYA 4RC7A 5D8YA 1GWGA 3QZ3A 4XKSA 2XJOA 4ZJKA 1BFRA 5HU6D 3PVYB 1JIGA 5D8QA 3F35A 4ERUA 1MOJA 4DE6A 5FEJA 2V2RA 4CYBA 1RCDA 4RC6B 1TKOA 3Q4RA 5D8RA 3T9JA 4MKUA 3KA3A 1XZ3A 4M32A 4PGKA 4ML5A 5CZUA 5JKMG 2HR5A 3KA8A 3BVEA 3GHQA 3Q4NA 3E1QA 2WLAA 1RCGA 2G4HA 1F33A 4EVDA 2WLUA 2YJKA 5J93A 5ERJA 3AJPA 2GYQA 4OYNA 4RC7B 3E1MA 2V8UA 3F39A 2AR0A 3AK9A 4YKHA 4ZKWA 5HJFA 5LG8A 3NOZX 2V2PA 5I4JA 4ISMA 5D8XA 1LKMA 3Q4OA 3OJ5A 3IS7A 4Z5SA 2C6RA 3R2RA 3UFBA 5JKLA 4YXMA 1UVHA 4ZL5A 5CMQA 4YVZA 4PG1A 3KA9A 3KWOA 3VNXA 2ZA6A 2C41A 3A9QA 3R2SA 2FG4A 3RAVA 2V2MA 2C2FA
chains in the Genus database with same CATH topology
3C1YA 2OC5A 3AK8A 3F34A 5GU0X 5FFDA 4XGSA 5ERKA 2C2JA 2YJJA 5JDOA 2JD80 1VJXA 3E1NA 3C21A 1BCFA 3UOFA 3F38A 1VLGA 3SIDA 4DI0A 4U3GA 5LS9A 4M33A 3E1JA 2XJNA 2BK6A 4R42A 4E40A 3EZ0A 1Z6OM 3PWFA 3FVBA 1NF6A 5JACA 2XKQA 3AF8X 1VELA 4TODA 3RBCA 3UNOA 3NP2X 3GVYA 2CLBA 5HQOA 3M6JA 1YV1A 3PZAA 5J8SA 4RC8A 1JREA 5FFAA 3W54A 3ISEA 3GGZA 2ZA7A 4LYUA 5JDOB 2IY4A 4LYXA 3ISFA 3H7GA 3F32A 3IQ1A 4TOFA 2CF7A 3PVTA 4A25A 3FI6A 1LB3A 3KHKA 3E6SA 2XGWA 1DPSA 1JKUA 2FG8A 4DYYA 1YUZA 4KVSA 1JI4A 2ITBA 4LPJA 5J9VA 3VVAA 3SHXA 2Z5QA 5D8OA 5C6FA 5D8SA 4XKUA 3NP0X 3BKNA 5GU2X 2FZFA 5AXSA 3O7SA 4DASA 1JTSA 1R03A 4IXKA 2RBDA 3AJOA 1ZS3A 2Z5RA 3UOIA 4AM2A 1XZ1A 4CVTA 4PG0A 2QQYA 3QHBA 2Y3QA 3AF9X 2YW6A 3E1LA 3JZAB 5JKLG 4WJG4 4PGIA 4W4LB 3QB9A 4W4KB 3PVRB 3PVTB 1KRQA 2CWLA 2BKCA 3EZUA 4TOGA 3KDQA 2WWXB 3F36A 2BJYA 3C1ZA 3AJQA 1UMNA 2FJCA 3QVDA 2JD70 2V2IA 3PW8C 4CY9A 3U90A 3R2MA 4IWKA 2FL0A 2WTLA 4MN9A 2VXIA 4ETRA 1YUXA 1HRSA 1ZUJA 4MY7A 3KXUA 5FFEA 4LQNA 2N02A 2XJMA 3HIUA 5IX6A 5GN8B 4E6KA 3R2KA 4DYXA 2VXXA 5FFCA 1AEWA 4ZKHA 2GYDA 5K53A 2ZG8X 2CN7A 2PYBA 2VZBA 4DYZA 2W0OA 1EUMA 2ZG9X 4ZKXA 4DZ0A 1VEIA 3PWQC 1JKVA 1NF4A 1NFVA 3HL1A 2CEIA 3V3KB 1VEQA 3DBYA 4ZL6A 2MGYA 4KVRA 2X170 2G38B 4TOBA 5E1UA 4LPNA 4TOHA 4CYAA 4AM5A 3QHCA 3BVIA 2V8TA 1RCEA 3WVWA 2V2OA 3EGMA 3R2HA 4P18A 3FSEA 5LBHA 2YW7A 3E2CA 1DVBA 1JI5A 2Z5PA 3ERZA 3PVRA 3SE1A 3Q4QA 3E1OA 1QGHA 1SOFA 1TJOA 2Z90A 4ZTTA 5GU1X 4Y08A 1S2ZA 3RGDA 2UX1A 1LKPA 4CVRA 3PWQA 4EVBA 2OKCA 1MFRA 2FFXJ 4LQVA 2QF9A 1DATA 4TO9A 4LQHA 5HJHA 2CLUA 2ZA8A 3C23A 5FFBA 1OTKA 4M35A 3IS8A 3BVKA 2JD60 1BG7A 3JZ9A 3E1PA 4CMYV 2V2SA 5GN8A 4II4A 3BVLA 2OH3A 4IWJA 3PW1A 4TOCA 4TOAA 1J30A 1Z6OA 1QYBA 4EVEA 3L0MA 5JKMA 2V15A 3FRSA 2Y44A 3N6OA 3WVUA 3BVFA 4MUDA 4QUWA 2IU2A 1RCCA 2Z6MA 3SH6A 4ZLWA 3ES3A 4MJYA 2FHAA 4M34A 1TK6A 2V2NA 1NNQA 2CIHA 4LQJA 4MXPA 1LKOA 5E2DA 4TOEA 3GE4A 3OGHA 3F37A 5GOUA 4ZMCA 4EVCA 1F30A 3KA6A 3MPSA 2C2UA 5GU3X 2F7NA 5CMRA 1S3QA 4RC5A 2ZG7X 4ISPA 2IB0A 4LPMA 3AF7X 4REUA 1S30A 4CVPA 3WVVA 4DYUA 2D5KA 3QD8A 4KXRB 2V2JA 1IERA 4II4B 1RCIA 3D19A 3RD0A 3PW1B 1O9IA 5D8PA 3RE7A 1L8HA 1N1QA 4ITWA 4X0JA 4AM4A 2ZURX 3TA8A 5J8WA 3BT5A 2FKZA 3O7RA 3PVYA 2CHIA 1RYTA 1JYBA 1B71A 3WNWA 4CVSA 1L8IA 3F33A 2V2LA 3VV9A 3A68A 3E6RA 3FRRA 3GGYA 3PW8A 4YXJA 1SQ3A 4RC6A 1H96A 1IESA 5LG2A 4KVQA 2GS4A 2HTNA 1TKPA 4XKTA 2CN6A 1Z4AA 3LKDA 4RC5B 3KX9A 4TW3A 3KA4A 1JGCA 4Z3BA 3R2OA 3R2LA 2BW1A 1O9RA 5K52A 1FHAA 2CHPA 4ITTA 4CMYA 4RC7A 5D8YA 1GWGA 3QZ3A 4XKSA 2XJOA 4ZJKA 1BFRA 5HU6D 3PVYB 1JIGA 5D8QA 3F35A 4ERUA 1MOJA 4DE6A 5FEJA 2V2RA 4CYBA 1RCDA 4RC6B 1TKOA 3Q4RA 5D8RA 3T9JA 4MKUA 3KA3A 1XZ3A 4M32A 4PGKA 4ML5A 5CZUA 5JKMG 2HR5A 3KA8A 3BVEA 3GHQA 3Q4NA 3E1QA 2WLAA 1RCGA 2G4HA 1F33A 4EVDA 2WLUA 2YJKA 5J93A 5ERJA 3AJPA 2GYQA 4OYNA 4RC7B 3E1MA 2V8UA 3F39A 2AR0A 3AK9A 4YKHA 4ZKWA 5HJFA 5LG8A 3NOZX 2V2PA 5I4JA 4ISMA 5D8XA 1LKMA 3Q4OA 3OJ5A 3IS7A 4Z5SA 2C6RA 3R2RA 3UFBA 5JKLA 4YXMA 1UVHA 4ZL5A 5CMQA 4YVZA 4PG1A 3KA9A 3KWOA 3VNXA 2ZA6A 2C41A 3A9QA 3R2SA 2FG4A 3RAVA 2V2MA 2C2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OC5 A;  3AK8 A;  3F34 A;  5GU0 X;  5FFD A;  4XGS A;  5ERK A;  2C2J A;  2YJJ A;  2JD8 0;  1VJX A;  3E1N A;  1BCF A;  3UOF A;  3F38 A;  1VLG A;  3SID A;  4DI0 A;  4U3G A;  5LS9 A;  4M33 A;  3E1J A;  2XJN A;  2BK6 A;  4R42 A;  3EZ0 A;  1Z6O M;  3PWF A;  3FVB A;  1NF6 A;  5JAC A;  2XKQ A;  3AF8 X;  1VEL A;  4TOD A;  3RBC A;  3UNO A;  3NP2 X;  3GVY A;  2CLB A;  5HQO A;  3PZA A;  1YV1 A;  5J8S A;  4RC8 A;  1JRE A;  5FFA A;  3ISE A;  2ZA7 A;  4LYU A;  2IY4 A;  4LYX A;  3ISF A;  3H7G A;  3F32 A;  3IQ1 A;  4TOF A;  2CF7 A;  3PVT A;  4A25 A;  3FI6 A;  1LB3 A;  3E6S A;  2XGW A;  1DPS A;  1JKU A;  2FG8 A;  4DYY A;  1YUZ A;  4KVS A;  1JI4 A;  2ITB A;  4LPJ A;  5J9V A;  3SHX A;  2Z5Q A;  5D8O A;  5C6F A;  5D8S A;  4XKU A;  3NP0 X;  3BKN A;  5GU2 X;  2FZF A;  5AXS A;  3O7S A;  4DAS A;  1JTS A;  1R03 A;  4IXK A;  2RBD A;  3AJO A;  1ZS3 A;  2Z5R A;  3UOI A;  4AM2 A;  1XZ1 A;  4CVT A;  4PG0 A;  2QQY A;  3QHB A;  2Y3Q A;  3AF9 X;  2YW6 A;  3E1L A;  5JKL G;  4PGI A;  3QB9 A;  3PVR B;  3PVT B;  1KRQ A;  2BKC A;  3EZU A;  4TOG A;  3F36 A;  2BJY A;  3AJQ A;  1UMN A;  2FJC A;  3QVD A;  2JD7 0;  2V2I A;  3PW8 C;  4CY9 A;  3U90 A;  3R2M A;  4IWK A;  2FL0 A;  2WTL A;  4MN9 A;  2VXI A;  4ETR A;  1YUX A;  1HRS A;  1ZUJ A;  4MY7 A;  3KXU A;  5FFE A;  4LQN A;  2XJM A;  3HIU A;  5IX6 A;  5GN8 B;  4E6K A;  3R2K A;  4DYX A;  2VXX A;  5FFC A;  1AEW A;  4ZKH A;  2GYD A;  5K53 A;  2ZG8 X;  2CN7 A;  2PYB A;  2VZB A;  4DYZ A;  2W0O A;  1EUM A;  2ZG9 X;  4ZKX A;  4DZ0 A;  1VEI A;  3PWQ C;  1JKV A;  1NF4 A;  1NFV A;  3HL1 A;  2CEI A;  1VEQ A;  4ZL6 A;  4KVR A;  2X17 0;  5E1U A;  4TOB A;  4LPN A;  4TOH A;  4CYA A;  4AM5 A;  3QHC A;  3BVI A;  1RCE A;  3WVW A;  2V2O A;  3EGM A;  3R2H A;  4P18 A;  3FSE A;  5LBH A;  2YW7 A;  3E2C A;  1DVB A;  1JI5 A;  2Z5P A;  3ERZ A;  3PVR A;  3SE1 A;  3Q4Q A;  3E1O A;  1QGH A;  1SOF A;  1TJO A;  2Z90 A;  4ZTT A;  5GU1 X;  4Y08 A;  1S2Z A;  3RGD A;  2UX1 A;  1LKP A;  4CVR A;  3PWQ A;  4EVB A;  1MFR A;  2FFX J;  4LQV A;  2QF9 A;  1DAT A;  4TO9 A;  4LQH A;  5HJH A;  2CLU A;  2ZA8 A;  5FFB A;  1OTK A;  4M35 A;  3IS8 A;  3BVK A;  2JD6 0;  1BG7 A;  3E1P A;  4CMY V;  2V2S A;  5GN8 A;  4II4 A;  3BVL A;  2OH3 A;  4IWJ A;  3PW1 A;  4TOC A;  4TOA A;  1J30 A;  1Z6O A;  1QYB A;  4EVE A;  5JKM A;  2V15 A;  3WVU A;  3BVF A;  4MUD A;  4QUW A;  2IU2 A;  1RCC A;  2Z6M A;  3SH6 A;  4ZLW A;  3ES3 A;  4MJY A;  2FHA A;  4M34 A;  1TK6 A;  2V2N A;  1NNQ A;  2CIH A;  4LQJ A;  1LKO A;  5E2D A;  4TOE A;  3GE4 A;  3OGH A;  3F37 A;  5GOU A;  4ZMC A;  4EVC A;  1F30 A;  3KA6 A;  3MPS A;  2C2U A;  5GU3 X;  2F7N A;  5CMR A;  1S3Q A;  4RC5 A;  2ZG7 X;  4ISP A;  2IB0 A;  4LPM A;  3AF7 X;  4REU A;  1S30 A;  4CVP A;  3WVV A;  4DYU A;  2D5K A;  3QD8 A;  2V2J A;  1IER A;  4II4 B;  1RCI A;  3RD0 A;  3PW1 B;  1O9I A;  5D8P A;  3RE7 A;  1L8H A;  1N1Q A;  4ITW A;  4AM4 A;  2ZUR X;  3TA8 A;  5J8W A;  3BT5 A;  2FKZ A;  3O7R A;  3PVY A;  2CHI A;  1RYT A;  1JYB A;  1B71 A;  3WNW A;  4CVS A;  1L8I A;  3F33 A;  2V2L A;  3A68 A;  3E6R A;  3PW8 A;  1SQ3 A;  4RC6 A;  1H96 A;  1IES A;  5LG2 A;  4KVQ A;  2GS4 A;  2HTN A;  1TKP A;  4XKT A;  2CN6 A;  1Z4A A;  4RC5 B;  3KX9 A;  4TW3 A;  3KA4 A;  1JGC A;  4Z3B A;  3R2O A;  3R2L A;  2BW1 A;  1O9R A;  5K52 A;  1FHA A;  2CHP A;  4ITT A;  4CMY A;  4RC7 A;  5D8Y A;  1GWG A;  3QZ3 A;  4XKS A;  2XJO A;  4ZJK A;  1BFR A;  3PVY B;  1JIG A;  5D8Q A;  3F35 A;  4ERU A;  1MOJ A;  4DE6 A;  5FEJ A;  2V2R A;  4CYB A;  1RCD A;  4RC6 B;  1TKO A;  3Q4R A;  5D8R A;  3T9J A;  4MKU A;  3KA3 A;  1XZ3 A;  4M32 A;  4PGK A;  4ML5 A;  5CZU A;  5JKM G;  2HR5 A;  3KA8 A;  3BVE A;  3GHQ A;  3Q4N A;  3E1Q A;  2WLA A;  1RCG A;  2G4H A;  1F33 A;  4EVD A;  2WLU A;  2YJK A;  5J93 A;  5ERJ A;  3AJP A;  2GYQ A;  4OYN A;  4RC7 B;  3E1M A;  3F39 A;  3AK9 A;  4YKH A;  4ZKW A;  5HJF A;  5LG8 A;  3NOZ X;  2V2P A;  5I4J A;  4ISM A;  5D8X A;  1LKM A;  3Q4O A;  3OJ5 A;  3IS7 A;  4Z5S A;  2C6R A;  3R2R A;  5JKL A;  1UVH A;  4ZL5 A;  5CMQ A;  4PG1 A;  3KA9 A;  3KWO A;  3VNX A;  2ZA6 A;  2C41 A;  3A9Q A;  3R2S A;  2FG4 A;  3RAV A;  2V2M A;  2C2F A; 
#chains in the Genus database with same CATH topology
 3C1Y A;  2OC5 A;  3AK8 A;  3F34 A;  5GU0 X;  5FFD A;  4XGS A;  5ERK A;  2C2J A;  2YJJ A;  5JDO A;  2JD8 0;  1VJX A;  3E1N A;  3C21 A;  1BCF A;  3UOF A;  3F38 A;  1VLG A;  3SID A;  4DI0 A;  4U3G A;  5LS9 A;  4M33 A;  3E1J A;  2XJN A;  2BK6 A;  4R42 A;  4E40 A;  3EZ0 A;  1Z6O M;  3PWF A;  3FVB A;  1NF6 A;  5JAC A;  2XKQ A;  3AF8 X;  1VEL A;  4TOD A;  3RBC A;  3UNO A;  3NP2 X;  3GVY A;  2CLB A;  5HQO A;  3M6J A;  1YV1 A;  3PZA A;  5J8S A;  4RC8 A;  1JRE A;  5FFA A;  3W54 A;  3ISE A;  3GGZ A;  2ZA7 A;  4LYU A;  5JDO B;  2IY4 A;  4LYX A;  3ISF A;  3H7G A;  3F32 A;  3IQ1 A;  4TOF A;  2CF7 A;  3PVT A;  4A25 A;  3FI6 A;  1LB3 A;  3KHK A;  3E6S A;  2XGW A;  1DPS A;  1JKU A;  2FG8 A;  4DYY A;  1YUZ A;  4KVS A;  1JI4 A;  2ITB A;  4LPJ A;  5J9V A;  3VVA A;  3SHX A;  2Z5Q A;  5D8O A;  5C6F A;  5D8S A;  4XKU A;  3NP0 X;  3BKN A;  5GU2 X;  2FZF A;  5AXS A;  3O7S A;  4DAS A;  1JTS A;  1R03 A;  4IXK A;  2RBD A;  3AJO A;  1ZS3 A;  2Z5R A;  3UOI A;  4AM2 A;  1XZ1 A;  4CVT A;  4PG0 A;  2QQY A;  3QHB A;  2Y3Q A;  3AF9 X;  2YW6 A;  3E1L A;  3JZA B;  5JKL G;  4WJG 4;  4PGI A;  4W4L B;  3QB9 A;  4W4K B;  3PVR B;  3PVT B;  1KRQ A;  2CWL A;  2BKC A;  3EZU A;  4TOG A;  3KDQ A;  2WWX B;  3F36 A;  2BJY A;  3C1Z A;  3AJQ A;  1UMN A;  2FJC A;  3QVD A;  2JD7 0;  2V2I A;  3PW8 C;  4CY9 A;  3U90 A;  3R2M A;  4IWK A;  2FL0 A;  2WTL A;  4MN9 A;  2VXI A;  4ETR A;  1YUX A;  1HRS A;  1ZUJ A;  4MY7 A;  3KXU A;  5FFE A;  4LQN A;  2N02 A;  2XJM A;  3HIU A;  5IX6 A;  5GN8 B;  4E6K A;  3R2K A;  4DYX A;  2VXX A;  5FFC A;  1AEW A;  4ZKH A;  2GYD A;  5K53 A;  2ZG8 X;  2CN7 A;  2PYB A;  2VZB A;  4DYZ A;  2W0O A;  1EUM A;  2ZG9 X;  4ZKX A;  4DZ0 A;  1VEI A;  3PWQ C;  1JKV A;  1NF4 A;  1NFV A;  3HL1 A;  2CEI A;  3V3K B;  1VEQ A;  3DBY A;  4ZL6 A;  2MGY A;  4KVR A;  2X17 0;  2G38 B;  4TOB A;  5E1U A;  4LPN A;  4TOH A;  4CYA A;  4AM5 A;  3QHC A;  3BVI A;  2V8T A;  1RCE A;  3WVW A;  2V2O A;  3EGM A;  3R2H A;  4P18 A;  3FSE A;  5LBH A;  2YW7 A;  3E2C A;  1DVB A;  1JI5 A;  2Z5P A;  3ERZ A;  3PVR A;  3SE1 A;  3Q4Q A;  3E1O A;  1QGH A;  1SOF A;  1TJO A;  2Z90 A;  4ZTT A;  5GU1 X;  4Y08 A;  1S2Z A;  3RGD A;  2UX1 A;  1LKP A;  4CVR A;  3PWQ A;  4EVB A;  2OKC A;  1MFR A;  2FFX J;  4LQV A;  2QF9 A;  1DAT A;  4TO9 A;  4LQH A;  5HJH A;  2CLU A;  2ZA8 A;  3C23 A;  5FFB A;  1OTK A;  4M35 A;  3IS8 A;  3BVK A;  2JD6 0;  1BG7 A;  3JZ9 A;  3E1P A;  4CMY V;  2V2S A;  5GN8 A;  4II4 A;  3BVL A;  2OH3 A;  4IWJ A;  3PW1 A;  4TOC A;  4TOA A;  1J30 A;  1Z6O A;  1QYB A;  4EVE A;  3L0M A;  5JKM A;  2V15 A;  3FRS A;  2Y44 A;  3N6O A;  3WVU A;  3BVF A;  4MUD A;  4QUW A;  2IU2 A;  1RCC A;  2Z6M A;  3SH6 A;  4ZLW A;  3ES3 A;  4MJY A;  2FHA A;  4M34 A;  1TK6 A;  2V2N A;  1NNQ A;  2CIH A;  4LQJ A;  4MXP A;  1LKO A;  5E2D A;  4TOE A;  3GE4 A;  3OGH A;  3F37 A;  5GOU A;  4ZMC A;  4EVC A;  1F30 A;  3KA6 A;  3MPS A;  2C2U A;  5GU3 X;  2F7N A;  5CMR A;  1S3Q A;  4RC5 A;  2ZG7 X;  4ISP A;  2IB0 A;  4LPM A;  3AF7 X;  4REU A;  1S30 A;  4CVP A;  3WVV A;  4DYU A;  2D5K A;  3QD8 A;  4KXR B;  2V2J A;  1IER A;  4II4 B;  1RCI A;  3D19 A;  3RD0 A;  3PW1 B;  1O9I A;  5D8P A;  3RE7 A;  1L8H A;  1N1Q A;  4ITW A;  4X0J A;  4AM4 A;  2ZUR X;  3TA8 A;  5J8W A;  3BT5 A;  2FKZ A;  3O7R A;  3PVY A;  2CHI A;  1RYT A;  1JYB A;  1B71 A;  3WNW A;  4CVS A;  1L8I A;  3F33 A;  2V2L A;  3VV9 A;  3A68 A;  3E6R A;  3FRR A;  3GGY A;  3PW8 A;  4YXJ A;  1SQ3 A;  4RC6 A;  1H96 A;  1IES A;  5LG2 A;  4KVQ A;  2GS4 A;  2HTN A;  1TKP A;  4XKT A;  2CN6 A;  1Z4A A;  3LKD A;  4RC5 B;  3KX9 A;  4TW3 A;  3KA4 A;  1JGC A;  4Z3B A;  3R2O A;  3R2L A;  2BW1 A;  1O9R A;  5K52 A;  1FHA A;  2CHP A;  4ITT A;  4CMY A;  4RC7 A;  5D8Y A;  1GWG A;  3QZ3 A;  4XKS A;  2XJO A;  4ZJK A;  1BFR A;  5HU6 D;  3PVY B;  1JIG A;  5D8Q A;  3F35 A;  4ERU A;  1MOJ A;  4DE6 A;  5FEJ A;  2V2R A;  4CYB A;  1RCD A;  4RC6 B;  1TKO A;  3Q4R A;  5D8R A;  3T9J A;  4MKU A;  3KA3 A;  1XZ3 A;  4M32 A;  4PGK A;  4ML5 A;  5CZU A;  5JKM G;  2HR5 A;  3KA8 A;  3BVE A;  3GHQ A;  3Q4N A;  3E1Q A;  2WLA A;  1RCG A;  2G4H A;  1F33 A;  4EVD A;  2WLU A;  2YJK A;  5J93 A;  5ERJ A;  3AJP A;  2GYQ A;  4OYN A;  4RC7 B;  3E1M A;  2V8U A;  3F39 A;  2AR0 A;  3AK9 A;  4YKH A;  4ZKW A;  5HJF A;  5LG8 A;  3NOZ X;  2V2P A;  5I4J A;  4ISM A;  5D8X A;  1LKM A;  3Q4O A;  3OJ5 A;  3IS7 A;  4Z5S A;  2C6R A;  3R2R A;  3UFB A;  5JKL A;  4YXM A;  1UVH A;  4ZL5 A;  5CMQ A;  4YVZ A;  4PG1 A;  3KA9 A;  3KWO A;  3VNX A;  2ZA6 A;  2C41 A;  3A9Q A;  3R2S A;  2FG4 A;  3RAV A;  2V2M A;  2C2F A; 
#chains in the Genus database with same CATH homology
 3C1Y A;  2OC5 A;  3AK8 A;  3F34 A;  5GU0 X;  5FFD A;  4XGS A;  5ERK A;  2C2J A;  2YJJ A;  5JDO A;  2JD8 0;  1VJX A;  3E1N A;  3C21 A;  1BCF A;  3UOF A;  3F38 A;  1VLG A;  3SID A;  4DI0 A;  4U3G A;  5LS9 A;  4M33 A;  3E1J A;  2XJN A;  2BK6 A;  4R42 A;  4E40 A;  3EZ0 A;  1Z6O M;  3PWF A;  3FVB A;  1NF6 A;  5JAC A;  2XKQ A;  3AF8 X;  1VEL A;  4TOD A;  3RBC A;  3UNO A;  3NP2 X;  3GVY A;  2CLB A;  5HQO A;  3M6J A;  1YV1 A;  3PZA A;  5J8S A;  4RC8 A;  1JRE A;  5FFA A;  3W54 A;  3ISE A;  3GGZ A;  2ZA7 A;  4LYU A;  5JDO B;  2IY4 A;  4LYX A;  3ISF A;  3H7G A;  3F32 A;  3IQ1 A;  4TOF A;  2CF7 A;  3PVT A;  4A25 A;  3FI6 A;  1LB3 A;  3KHK A;  3E6S A;  2XGW A;  1DPS A;  1JKU A;  2FG8 A;  4DYY A;  1YUZ A;  4KVS A;  1JI4 A;  2ITB A;  4LPJ A;  5J9V A;  3VVA A;  3SHX A;  2Z5Q A;  5D8O A;  5C6F A;  5D8S A;  4XKU A;  3NP0 X;  3BKN A;  5GU2 X;  2FZF A;  5AXS A;  3O7S A;  4DAS A;  1JTS A;  1R03 A;  4IXK A;  2RBD A;  3AJO A;  1ZS3 A;  2Z5R A;  3UOI A;  4AM2 A;  1XZ1 A;  4CVT A;  4PG0 A;  2QQY A;  3QHB A;  2Y3Q A;  3AF9 X;  2YW6 A;  3E1L A;  3JZA B;  5JKL G;  4WJG 4;  4PGI A;  4W4L B;  3QB9 A;  4W4K B;  3PVR B;  3PVT B;  1KRQ A;  2CWL A;  2BKC A;  3EZU A;  4TOG A;  3KDQ A;  2WWX B;  3F36 A;  2BJY A;  3C1Z A;  3AJQ A;  1UMN A;  2FJC A;  3QVD A;  2JD7 0;  2V2I A;  3PW8 C;  4CY9 A;  3U90 A;  3R2M A;  4IWK A;  2FL0 A;  2WTL A;  4MN9 A;  2VXI A;  4ETR A;  1YUX A;  1HRS A;  1ZUJ A;  4MY7 A;  3KXU A;  5FFE A;  4LQN A;  2N02 A;  2XJM A;  3HIU A;  5IX6 A;  5GN8 B;  4E6K A;  3R2K A;  4DYX A;  2VXX A;  5FFC A;  1AEW A;  4ZKH A;  2GYD A;  5K53 A;  2ZG8 X;  2CN7 A;  2PYB A;  2VZB A;  4DYZ A;  2W0O A;  1EUM A;  2ZG9 X;  4ZKX A;  4DZ0 A;  1VEI A;  3PWQ C;  1JKV A;  1NF4 A;  1NFV A;  3HL1 A;  2CEI A;  3V3K B;  1VEQ A;  3DBY A;  4ZL6 A;  2MGY A;  4KVR A;  2X17 0;  2G38 B;  4TOB A;  5E1U A;  4LPN A;  4TOH A;  4CYA A;  4AM5 A;  3QHC A;  3BVI A;  2V8T A;  1RCE A;  3WVW A;  2V2O A;  3EGM A;  3R2H A;  4P18 A;  3FSE A;  5LBH A;  2YW7 A;  3E2C A;  1DVB A;  1JI5 A;  2Z5P A;  3ERZ A;  3PVR A;  3SE1 A;  3Q4Q A;  3E1O A;  1QGH A;  1SOF A;  1TJO A;  2Z90 A;  4ZTT A;  5GU1 X;  4Y08 A;  1S2Z A;  3RGD A;  2UX1 A;  1LKP A;  4CVR A;  3PWQ A;  4EVB A;  2OKC A;  1MFR A;  2FFX J;  4LQV A;  2QF9 A;  1DAT A;  4TO9 A;  4LQH A;  5HJH A;  2CLU A;  2ZA8 A;  3C23 A;  5FFB A;  1OTK A;  4M35 A;  3IS8 A;  3BVK A;  2JD6 0;  1BG7 A;  3JZ9 A;  3E1P A;  4CMY V;  2V2S A;  5GN8 A;  4II4 A;  3BVL A;  2OH3 A;  4IWJ A;  3PW1 A;  4TOC A;  4TOA A;  1J30 A;  1Z6O A;  1QYB A;  4EVE A;  3L0M A;  5JKM A;  2V15 A;  3FRS A;  2Y44 A;  3N6O A;  3WVU A;  3BVF A;  4MUD A;  4QUW A;  2IU2 A;  1RCC A;  2Z6M A;  3SH6 A;  4ZLW A;  3ES3 A;  4MJY A;  2FHA A;  4M34 A;  1TK6 A;  2V2N A;  1NNQ A;  2CIH A;  4LQJ A;  4MXP A;  1LKO A;  5E2D A;  4TOE A;  3GE4 A;  3OGH A;  3F37 A;  5GOU A;  4ZMC A;  4EVC A;  1F30 A;  3KA6 A;  3MPS A;  2C2U A;  5GU3 X;  2F7N A;  5CMR A;  1S3Q A;  4RC5 A;  2ZG7 X;  4ISP A;  2IB0 A;  4LPM A;  3AF7 X;  4REU A;  1S30 A;  4CVP A;  3WVV A;  4DYU A;  2D5K A;  3QD8 A;  4KXR B;  2V2J A;  1IER A;  4II4 B;  1RCI A;  3D19 A;  3RD0 A;  3PW1 B;  1O9I A;  5D8P A;  3RE7 A;  1L8H A;  1N1Q A;  4ITW A;  4X0J A;  4AM4 A;  2ZUR X;  3TA8 A;  5J8W A;  3BT5 A;  2FKZ A;  3O7R A;  3PVY A;  2CHI A;  1RYT A;  1JYB A;  1B71 A;  3WNW A;  4CVS A;  1L8I A;  3F33 A;  2V2L A;  3VV9 A;  3A68 A;  3E6R A;  3FRR A;  3GGY A;  3PW8 A;  4YXJ A;  1SQ3 A;  4RC6 A;  1H96 A;  1IES A;  5LG2 A;  4KVQ A;  2GS4 A;  2HTN A;  1TKP A;  4XKT A;  2CN6 A;  1Z4A A;  3LKD A;  4RC5 B;  3KX9 A;  4TW3 A;  3KA4 A;  1JGC A;  4Z3B A;  3R2O A;  3R2L A;  2BW1 A;  1O9R A;  5K52 A;  1FHA A;  2CHP A;  4ITT A;  4CMY A;  4RC7 A;  5D8Y A;  1GWG A;  3QZ3 A;  4XKS A;  2XJO A;  4ZJK A;  1BFR A;  5HU6 D;  3PVY B;  1JIG A;  5D8Q A;  3F35 A;  4ERU A;  1MOJ A;  4DE6 A;  5FEJ A;  2V2R A;  4CYB A;  1RCD A;  4RC6 B;  1TKO A;  3Q4R A;  5D8R A;  3T9J A;  4MKU A;  3KA3 A;  1XZ3 A;  4M32 A;  4PGK A;  4ML5 A;  5CZU A;  5JKM G;  2HR5 A;  3KA8 A;  3BVE A;  3GHQ A;  3Q4N A;  3E1Q A;  2WLA A;  1RCG A;  2G4H A;  1F33 A;  4EVD A;  2WLU A;  2YJK A;  5J93 A;  5ERJ A;  3AJP A;  2GYQ A;  4OYN A;  4RC7 B;  3E1M A;  2V8U A;  3F39 A;  2AR0 A;  3AK9 A;  4YKH A;  4ZKW A;  5HJF A;  5LG8 A;  3NOZ X;  2V2P A;  5I4J A;  4ISM A;  5D8X A;  1LKM A;  3Q4O A;  3OJ5 A;  3IS7 A;  4Z5S A;  2C6R A;  3R2R A;  3UFB A;  5JKL A;  4YXM A;  1UVH A;  4ZL5 A;  5CMQ A;  4YVZ A;  4PG1 A;  3KA9 A;  3KWO A;  3VNX A;  2ZA6 A;  2C41 A;  3A9Q A;  3R2S A;  2FG4 A;  3RAV A;  2V2M A;  2C2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...