5C6FA

Crystal structures of ferritin mutants reveal side-on binding to diiron and end-on cleavage of oxygen
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
172
structure length
172
Chain Sequence
HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYELEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Bacterial non-heme ferritin
publication title Structural Basis of Novel Iron-Uptake Route and Reaction Intermediates in Ferritins from Gram-Negative Bacteria.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 78
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5c6fA00
4ISMA 3E1JA 5J93A 5HJFA 1TKOA 1Z4AA 2FKZA 3F35A 2F7NA 3BVIA 1O9RA 1YV1A 3BVLA 3GHQA 3MPSA 2JD60 3E1OA 2BW1A 2V2OA 3KWOA 3A68A 2QQYA 3R2RA 3T9JA 2JD80 5D8OA 2V15A 4IWJA 2YJKA 1L8IA 4Z3BA 4ZMCA 4XKTA 3PVYB 3SH6A 4AM2A 4ZJKA 3R2SA 3FVBA 2FJCA 4TW3A 4CMYA 1JYBA 3PVYA 4RC8A 2IB0A 1YUXA 1GWGA 3OJ5A 3E6SA 3SHXA 3BVFA 2CF7A 4TOBA 1AEWA 4ITWA 4ZL5A 2W0OA 1TK6A 2CLBA 3RD0A 4TODA 2V2PA 2FG8A 1DVBA 5J8SA 4AM4A 4DYUA 5LG2A 5GN8A 5JKMA 4YKHA 3AF8X 1Z6OM 1SQ3A 2GYDA 4LQHA 1R03A 5FFEA 2CEIA 3BKNA 5GU3X 4ZKXA 3KA8A 1JI4A 1VEIA 3KA4A 4ZTTA 4AM5A 5J9VA 3E1QA 2ZA6A 5GOUA 4MN9A 5D8YA 3TA8A 2CHPA 4ERUA 4CY9A 3A9QA 2WLAA 4EVDA 1F33A 4DASA 1DPSA 3PVRB 3PWQC 1JTSA 4LQVA 1RCGA 2ZA7A 1RCCA 4IWKA 2XJOA 4ISPA 1ZUJA 4P18A 3PW8A 4QUWA 2CLUA 4MUDA 4DYZA 4M35A 3PVRA 1UVHA 2Z90A 2FFXJ 1QGHA 3Q4OA 3GVYA 4LPMA 3F38A 5FFBA 3UOFA 3R2HA 5JKLG 2ZA8A 4E6KA 5IX6A 3E1LA 3WNWA 2BKCA 1S3QA 2YW6A 1SOFA 1BG7A 1RCDA 2GYQA 3RGDA 3PWFA 1JIGA 2YW7A 3R2KA 3O7SA 5CMQA 2CN7A 5GU2X 3R2OA 3AK9A 4CVSA 3E1NA 1J30A 2WTLA 4CVTA 2HTNA 4EVBA 2BK6A 3E1PA 4DE6A 1KRQA 2V2LA 3QHBA 2FL0A 2CIHA 3BT5A 4TOHA 2XJMA 4TOCA 2V2MA 1NNQA 3IQ1A 4LYXA 2VXXA 3EZUA 3F32A 1L8HA 2FHAA 3QB9A 2GS4A 3KA6A 4TOEA 1TJOA 4R42A 1RCEA 3R2MA 1RYTA 5CMRA 1VELA 2HR5A 5D8QA 3WVWA 5D8RA 4TO9A 4OYNA 5D8XA 2UX1A 1JREA 4REUA 1LKOA 3Q4NA 3F34A 3RAVA 4XKSA 2IY4A 3E2CA 2ZURX 2Z5QA 1B71A 3Q4QA 1IERA 1OTKA 5LG8A 5E1UA 3AJQA 4ITTA 2V2RA 2OC5A 2YJJA 4TOFA 3IS8A 3OGHA 1TKPA 4ZKHA 5I4JA 1FHAA 1XZ3A 4LQJA 3FI6A 2VZBA 4M33A 3Q4RA 3QD8A 5D8PA 5LS9A 4CVPA 1EUMA 5J8WA 2WLUA 4CMYV 1LKPA 3SIDA 3AJPA 1S2ZA 2V2JA 3F37A 1VEQA 5HJHA 1LB3A 3E1MA 5JKMG 4PG0A 2ZG7X 3AF9X 2Z6MA 5K53A 3F33A 2X170 1JKUA 3F36A 5GU1X 4ETRA 3PW1B 2D5KA 4PGKA 4DYYA 5LBHA 2C41A 4RC6B 4CYAA 4CYBA 1NF6A 4ZL6A 3WVVA 3QHCA 3PW1A 1UMNA 2PYBA 1LKMA 4EVEA 4RC6A 5ERJA 1YUZA 4MY7A 4LQNA 2ZG8X 2CHIA 3U90A 4ZKWA 3KA9A 5FFCA 2ZG9X 1ZS3A 4XKUA 1Z6OA 1QYBA 4M32A 3FSEA 4RC7B 3PZAA 4TOGA 3BVKA 2C6RA 3O7RA 4ML5A 4EVCA 3RE7A 2XJNA 3PW8C 4M34A 4RC7A 2OH3A 3KA3A 5JACA 4U3GA 1MOJA 3ISEA 1N1QA 5FFDA 4LPNA 1MFRA 3PVTB 1F30A 1VJXA 1NFVA 3HIUA 2QF9A 4Y08A 1XZ1A 4KVSA 4II4B 3AK8A 1DATA 2FG4A 2C2JA 3NOZX 3PVTA 5ERKA 3HL1A 4II4A 4KVRA 4PG1A 4MJYA 5GU0X 3EZ0A 5D8SA 4RC5B 4KVQA 5CZUA 1S30A 3WVUA 1NF4A 2C2FA 3H7GA 3EGMA 5E2DA 5GN8B 5C6FA 3PWQA 4RC5A 3ES3A 3VNXA 4TOAA 4A25A 2V2IA 1BCFA 1VLGA 2IU2A 3BVEA 3UOIA 3NP0X 4DI0A 2ITBA 2G4HA 1IESA 1JI5A 1RCIA 2V2NA 2RBDA 3ERZA 3IS7A 5K52A 3UNOA 5AXSA 2V2SA 5FFAA 2Y3QA 4CVRA 3NP2X 5JKLA 3GE4A 2C2UA 1JGCA 3E6RA 2BJYA 2JD70 1HRSA 4Z5SA 4MKUA 2Z5PA 2FZFA 3AJOA 3QVDA 2CN6A 2Z5RA 4ZLWA 2XKQA 3AF7X 3ISFA 4DZ0A 3F39A 3SE1A 3KX9A 4XGSA 3KXUA 1O9IA 3QZ3A 1JKVA 2XGWA 4LYUA 3RBCA 4IXKA 2VXIA 4PGIA 3R2LA 4LPJA 4DYXA 5FEJA 5HQOA 1H96A 1BFRA
chains in the Genus database with same CATH superfamily
4ISMA 3E1JA 5J93A 5HJFA 1TKOA 1Z4AA 2FKZA 3F35A 3KDQA 3GGZA 2F7NA 3BVIA 1O9RA 1YV1A 3BVLA 3GHQA 3MPSA 2JD60 3E1OA 2BW1A 2V2OA 3KWOA 3A68A 3VV9A 2QQYA 3R2RA 3T9JA 2JD80 5D8OA 2V15A 4W4LB 4IWJA 2YJKA 1L8IA 4Z3BA 4ZMCA 4XKTA 3PVYB 3SH6A 4AM2A 4ZJKA 3R2SA 3FVBA 2FJCA 4TW3A 4CMYA 1JYBA 3PVYA 4RC8A 2IB0A 1YUXA 1GWGA 3OJ5A 3E6SA 3SHXA 3BVFA 2CF7A 4TOBA 1AEWA 4ITWA 4ZL5A 2W0OA 1TK6A 2CLBA 3RD0A 4TODA 2V2PA 2FG8A 1DVBA 5J8SA 4AM4A 4DYUA 4YVZA 5LG2A 5GN8A 5JKMA 4YXJA 4YKHA 3AF8X 1Z6OM 1SQ3A 2GYDA 4LQHA 1R03A 5FFEA 2CEIA 3BKNA 5GU3X 4ZKXA 3KA8A 1JI4A 3D19A 1VEIA 3KA4A 4ZTTA 4AM5A 5J9VA 3E1QA 2ZA6A 5GOUA 4MN9A 5D8YA 3TA8A 2CHPA 3DBYA 3JZAB 4ERUA 4CY9A 3A9QA 2WLAA 4EVDA 1F33A 4DASA 1DPSA 3PVRB 3PWQC 1JTSA 3GGYA 4LQVA 1RCGA 2ZA7A 1RCCA 4IWKA 2XJOA 4ISPA 1ZUJA 4P18A 3PW8A 4QUWA 2CLUA 4MUDA 4DYZA 4M35A 3PVRA 5JDOA 1UVHA 2Z90A 2FFXJ 1QGHA 3Q4OA 3GVYA 4LPMA 3F38A 5FFBA 3UFBA 3UOFA 3R2HA 5JKLG 2ZA8A 4E6KA 5IX6A 3E1LA 3WNWA 2BKCA 1S3QA 2YW6A 1SOFA 1BG7A 1RCDA 2GYQA 3RGDA 3PWFA 1JIGA 2YW7A 3R2KA 3O7SA 4MXPA 5CMQA 2CN7A 5GU2X 3R2OA 3AK9A 4CVSA 3E1NA 1J30A 2WTLA 4CVTA 3JZ9A 2HTNA 4EVBA 2BK6A 3E1PA 4DE6A 1KRQA 2V2LA 3QHBA 2FL0A 2CIHA 3BT5A 4TOHA 2XJMA 4TOCA 2V2MA 3C1ZA 3L0MA 1NNQA 3IQ1A 4LYXA 2VXXA 3EZUA 3F32A 1L8HA 2FHAA 3QB9A 2GS4A 3KA6A 4TOEA 1TJOA 4R42A 1RCEA 3R2MA 1RYTA 5CMRA 1VELA 3C21A 2HR5A 5D8QA 3WVWA 5D8RA 2CWLA 4TO9A 4OYNA 5D8XA 2UX1A 1JREA 4REUA 1LKOA 3Q4NA 3F34A 3RAVA 4XKSA 4X0JA 2IY4A 3E2CA 3W54A 2ZURX 2Z5QA 1B71A 3Q4QA 1IERA 1OTKA 5LG8A 3C1YA 5E1UA 3AJQA 4ITTA 2V2RA 2OC5A 2YJJA 4TOFA 3IS8A 3OGHA 1TKPA 3KHKA 4ZKHA 5I4JA 1FHAA 1XZ3A 4LQJA 3FI6A 2VZBA 4M33A 3Q4RA 3QD8A 5D8PA 5LS9A 4CVPA 1EUMA 5J8WA 2WLUA 4CMYV 1LKPA 3SIDA 3AJPA 1S2ZA 2V2JA 3F37A 1VEQA 5HJHA 1LB3A 3E1MA 5JKMG 4PG0A 2ZG7X 3AF9X 4YXMA 3C23A 2Z6MA 5K53A 3F33A 2X170 1JKUA 3F36A 5GU1X 4ETRA 3PW1B 2D5KA 4PGKA 4DYYA 5LBHA 2C41A 4RC6B 4CYAA 4CYBA 1NF6A 4ZL6A 3WVVA 3QHCA 3PW1A 3VVAA 1UMNA 2PYBA 1LKMA 2AR0A 4EVEA 4RC6A 5ERJA 1YUZA 4MY7A 4LQNA 2ZG8X 2CHIA 3U90A 4ZKWA 3KA9A 5FFCA 2ZG9X 1ZS3A 4XKUA 1Z6OA 1QYBA 3V3KB 4M32A 3FSEA 4RC7B 2G38B 3PZAA 4TOGA 3BVKA 2C6RA 3O7RA 4ML5A 4EVCA 3RE7A 2XJNA 3PW8C 2WWXB 4M34A 4RC7A 2V8UA 2OH3A 3KA3A 5JACA 4W4KB 4E40A 4U3GA 1MOJA 2MGYA 3ISEA 1N1QA 5FFDA 4LPNA 1MFRA 3PVTB 1F30A 1VJXA 1NFVA 3HIUA 2QF9A 4Y08A 1XZ1A 4KVSA 4II4B 3AK8A 1DATA 2FG4A 2C2JA 3NOZX 3PVTA 2N02A 5ERKA 3FRRA 3HL1A 4II4A 4KVRA 4PG1A 4MJYA 5GU0X 2OKCA 3EZ0A 5D8SA 4RC5B 4KVQA 5CZUA 1S30A 3WVUA 1NF4A 2C2FA 3H7GA 3EGMA 5E2DA 5GN8B 5C6FA 3PWQA 4RC5A 5HU6D 3ES3A 3VNXA 4TOAA 4A25A 2V2IA 1BCFA 3LKDA 1VLGA 2IU2A 3BVEA 3UOIA 3NP0X 4DI0A 2ITBA 2G4HA 1IESA 3M6JA 1JI5A 1RCIA 2V2NA 2RBDA 3ERZA 3IS7A 5K52A 3UNOA 5AXSA 2V2SA 5FFAA 2Y3QA 4CVRA 3NP2X 5JKLA 3GE4A 2C2UA 1JGCA 3E6RA 2BJYA 2JD70 1HRSA 4Z5SA 4MKUA 2Z5PA 2FZFA 5JDOB 3AJOA 3QVDA 2CN6A 2Z5RA 3N6OA 2Y44A 2XKQA 4ZLWA 3FRSA 3AF7X 3ISFA 4DZ0A 3F39A 3SE1A 3KX9A 4XGSA 3KXUA 2V8TA 1O9IA 3QZ3A 4WJG4 1JKVA 2XGWA 4KXRB 4LYUA 3RBCA 4IXKA 2VXIA 4PGIA 3R2LA 4LPJA 4DYXA 5FEJA 5HQOA 1H96A 1BFRA
chains in the Genus database with same CATH topology
4ISMA 3E1JA 5J93A 5HJFA 1TKOA 1Z4AA 2FKZA 3F35A 3KDQA 3GGZA 2F7NA 3BVIA 1O9RA 1YV1A 3BVLA 3GHQA 3MPSA 2JD60 3E1OA 2BW1A 2V2OA 3KWOA 3A68A 3VV9A 2QQYA 3R2RA 3T9JA 2JD80 5D8OA 2V15A 4W4LB 4IWJA 2YJKA 1L8IA 4Z3BA 4ZMCA 4XKTA 3PVYB 3SH6A 4AM2A 4ZJKA 3R2SA 3FVBA 2FJCA 4TW3A 4CMYA 1JYBA 3PVYA 4RC8A 2IB0A 1YUXA 1GWGA 3OJ5A 3E6SA 3SHXA 3BVFA 2CF7A 4TOBA 1AEWA 4ITWA 4ZL5A 2W0OA 1TK6A 2CLBA 3RD0A 4TODA 2V2PA 2FG8A 1DVBA 5J8SA 4AM4A 4DYUA 4YVZA 5LG2A 5GN8A 5JKMA 4YXJA 4YKHA 3AF8X 1Z6OM 1SQ3A 2GYDA 4LQHA 1R03A 5FFEA 2CEIA 3BKNA 5GU3X 4ZKXA 3KA8A 1JI4A 3D19A 1VEIA 3KA4A 4ZTTA 4AM5A 5J9VA 3E1QA 2ZA6A 5GOUA 4MN9A 5D8YA 3TA8A 2CHPA 3DBYA 3JZAB 4ERUA 4CY9A 3A9QA 2WLAA 4EVDA 1F33A 4DASA 1DPSA 3PVRB 3PWQC 1JTSA 3GGYA 4LQVA 1RCGA 2ZA7A 1RCCA 4IWKA 2XJOA 4ISPA 1ZUJA 4P18A 3PW8A 4QUWA 2CLUA 4MUDA 4DYZA 4M35A 3PVRA 5JDOA 1UVHA 2Z90A 2FFXJ 1QGHA 3Q4OA 3GVYA 4LPMA 3F38A 5FFBA 3UFBA 3UOFA 3R2HA 5JKLG 2ZA8A 4E6KA 5IX6A 3E1LA 3WNWA 2BKCA 1S3QA 2YW6A 1SOFA 1BG7A 1RCDA 2GYQA 3RGDA 3PWFA 1JIGA 2YW7A 3R2KA 3O7SA 4MXPA 5CMQA 2CN7A 5GU2X 3R2OA 3AK9A 4CVSA 3E1NA 1J30A 2WTLA 4CVTA 3JZ9A 2HTNA 4EVBA 2BK6A 3E1PA 4DE6A 1KRQA 2V2LA 3QHBA 2FL0A 2CIHA 3BT5A 4TOHA 2XJMA 4TOCA 2V2MA 3C1ZA 3L0MA 1NNQA 3IQ1A 4LYXA 2VXXA 3EZUA 3F32A 1L8HA 2FHAA 3QB9A 2GS4A 3KA6A 4TOEA 1TJOA 4R42A 1RCEA 3R2MA 1RYTA 5CMRA 1VELA 3C21A 2HR5A 5D8QA 3WVWA 5D8RA 2CWLA 4TO9A 4OYNA 5D8XA 2UX1A 1JREA 4REUA 1LKOA 3Q4NA 3F34A 3RAVA 4XKSA 4X0JA 2IY4A 3E2CA 3W54A 2ZURX 2Z5QA 1B71A 3Q4QA 1IERA 1OTKA 5LG8A 3C1YA 5E1UA 3AJQA 4ITTA 2V2RA 2OC5A 2YJJA 4TOFA 3IS8A 3OGHA 1TKPA 3KHKA 4ZKHA 5I4JA 1FHAA 1XZ3A 4LQJA 3FI6A 2VZBA 4M33A 3Q4RA 3QD8A 5D8PA 5LS9A 4CVPA 1EUMA 5J8WA 2WLUA 4CMYV 1LKPA 3SIDA 3AJPA 1S2ZA 2V2JA 3F37A 1VEQA 5HJHA 1LB3A 3E1MA 5JKMG 4PG0A 2ZG7X 3AF9X 4YXMA 3C23A 2Z6MA 5K53A 3F33A 2X170 1JKUA 3F36A 5GU1X 4ETRA 3PW1B 2D5KA 4PGKA 4DYYA 5LBHA 2C41A 4RC6B 4CYAA 4CYBA 1NF6A 4ZL6A 3WVVA 3QHCA 3PW1A 3VVAA 1UMNA 2PYBA 1LKMA 2AR0A 4EVEA 4RC6A 5ERJA 1YUZA 4MY7A 4LQNA 2ZG8X 2CHIA 3U90A 4ZKWA 3KA9A 5FFCA 2ZG9X 1ZS3A 4XKUA 1Z6OA 1QYBA 3V3KB 4M32A 3FSEA 4RC7B 2G38B 3PZAA 4TOGA 3BVKA 2C6RA 3O7RA 4ML5A 4EVCA 3RE7A 2XJNA 3PW8C 2WWXB 4M34A 4RC7A 2V8UA 2OH3A 3KA3A 5JACA 4W4KB 4E40A 4U3GA 1MOJA 2MGYA 3ISEA 1N1QA 5FFDA 4LPNA 1MFRA 3PVTB 1F30A 1VJXA 1NFVA 3HIUA 2QF9A 4Y08A 1XZ1A 4KVSA 4II4B 3AK8A 1DATA 2FG4A 2C2JA 3NOZX 3PVTA 2N02A 5ERKA 3FRRA 3HL1A 4II4A 4KVRA 4PG1A 4MJYA 5GU0X 2OKCA 3EZ0A 5D8SA 4RC5B 4KVQA 5CZUA 1S30A 3WVUA 1NF4A 2C2FA 3H7GA 3EGMA 5E2DA 5GN8B 5C6FA 3PWQA 4RC5A 5HU6D 3ES3A 3VNXA 4TOAA 4A25A 2V2IA 1BCFA 3LKDA 1VLGA 2IU2A 3BVEA 3UOIA 3NP0X 4DI0A 2ITBA 2G4HA 1IESA 3M6JA 1JI5A 1RCIA 2V2NA 2RBDA 3ERZA 3IS7A 5K52A 3UNOA 5AXSA 2V2SA 5FFAA 2Y3QA 4CVRA 3NP2X 5JKLA 3GE4A 2C2UA 1JGCA 3E6RA 2BJYA 2JD70 1HRSA 4Z5SA 4MKUA 2Z5PA 2FZFA 5JDOB 3AJOA 3QVDA 2CN6A 2Z5RA 3N6OA 2Y44A 2XKQA 4ZLWA 3FRSA 3AF7X 3ISFA 4DZ0A 3F39A 3SE1A 3KX9A 4XGSA 3KXUA 2V8TA 1O9IA 3QZ3A 4WJG4 1JKVA 2XGWA 4KXRB 4LYUA 3RBCA 4IXKA 2VXIA 4PGIA 3R2LA 4LPJA 4DYXA 5FEJA 5HQOA 1H96A 1BFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ISM A;  3E1J A;  5J93 A;  5HJF A;  1TKO A;  1Z4A A;  2FKZ A;  3F35 A;  2F7N A;  3BVI A;  1O9R A;  1YV1 A;  3BVL A;  3GHQ A;  3MPS A;  2JD6 0;  3E1O A;  2BW1 A;  2V2O A;  3KWO A;  3A68 A;  2QQY A;  3R2R A;  3T9J A;  2JD8 0;  5D8O A;  2V15 A;  4IWJ A;  2YJK A;  1L8I A;  4Z3B A;  4ZMC A;  4XKT A;  3PVY B;  3SH6 A;  4AM2 A;  4ZJK A;  3R2S A;  3FVB A;  2FJC A;  4TW3 A;  4CMY A;  1JYB A;  3PVY A;  4RC8 A;  2IB0 A;  1YUX A;  1GWG A;  3OJ5 A;  3E6S A;  3SHX A;  3BVF A;  2CF7 A;  4TOB A;  1AEW A;  4ITW A;  4ZL5 A;  2W0O A;  1TK6 A;  2CLB A;  3RD0 A;  4TOD A;  2V2P A;  2FG8 A;  1DVB A;  5J8S A;  4AM4 A;  4DYU A;  5LG2 A;  5GN8 A;  5JKM A;  4YKH A;  3AF8 X;  1Z6O M;  1SQ3 A;  2GYD A;  4LQH A;  1R03 A;  5FFE A;  2CEI A;  3BKN A;  5GU3 X;  4ZKX A;  3KA8 A;  1JI4 A;  1VEI A;  3KA4 A;  4ZTT A;  4AM5 A;  5J9V A;  3E1Q A;  2ZA6 A;  5GOU A;  4MN9 A;  5D8Y A;  3TA8 A;  2CHP A;  4ERU A;  4CY9 A;  3A9Q A;  2WLA A;  4EVD A;  1F33 A;  4DAS A;  1DPS A;  3PVR B;  3PWQ C;  1JTS A;  4LQV A;  1RCG A;  2ZA7 A;  1RCC A;  4IWK A;  2XJO A;  4ISP A;  1ZUJ A;  4P18 A;  3PW8 A;  4QUW A;  2CLU A;  4MUD A;  4DYZ A;  4M35 A;  3PVR A;  1UVH A;  2Z90 A;  2FFX J;  1QGH A;  3Q4O A;  3GVY A;  4LPM A;  3F38 A;  5FFB A;  3UOF A;  3R2H A;  5JKL G;  2ZA8 A;  4E6K A;  5IX6 A;  3E1L A;  3WNW A;  2BKC A;  1S3Q A;  2YW6 A;  1SOF A;  1BG7 A;  1RCD A;  2GYQ A;  3RGD A;  3PWF A;  1JIG A;  2YW7 A;  3R2K A;  3O7S A;  5CMQ A;  2CN7 A;  5GU2 X;  3R2O A;  3AK9 A;  4CVS A;  3E1N A;  1J30 A;  2WTL A;  4CVT A;  2HTN A;  4EVB A;  2BK6 A;  3E1P A;  4DE6 A;  1KRQ A;  2V2L A;  3QHB A;  2FL0 A;  2CIH A;  3BT5 A;  4TOH A;  2XJM A;  4TOC A;  2V2M A;  1NNQ A;  3IQ1 A;  4LYX A;  2VXX A;  3EZU A;  3F32 A;  1L8H A;  2FHA A;  3QB9 A;  2GS4 A;  3KA6 A;  4TOE A;  1TJO A;  4R42 A;  1RCE A;  3R2M A;  1RYT A;  5CMR A;  1VEL A;  2HR5 A;  5D8Q A;  3WVW A;  5D8R A;  4TO9 A;  4OYN A;  5D8X A;  2UX1 A;  1JRE A;  4REU A;  1LKO A;  3Q4N A;  3F34 A;  3RAV A;  4XKS A;  2IY4 A;  3E2C A;  2ZUR X;  2Z5Q A;  1B71 A;  3Q4Q A;  1IER A;  1OTK A;  5LG8 A;  5E1U A;  3AJQ A;  4ITT A;  2V2R A;  2OC5 A;  2YJJ A;  4TOF A;  3IS8 A;  3OGH A;  1TKP A;  4ZKH A;  5I4J A;  1FHA A;  1XZ3 A;  4LQJ A;  3FI6 A;  2VZB A;  4M33 A;  3Q4R A;  3QD8 A;  5D8P A;  5LS9 A;  4CVP A;  1EUM A;  5J8W A;  2WLU A;  4CMY V;  1LKP A;  3SID A;  3AJP A;  1S2Z A;  2V2J A;  3F37 A;  1VEQ A;  5HJH A;  1LB3 A;  3E1M A;  5JKM G;  4PG0 A;  2ZG7 X;  3AF9 X;  2Z6M A;  5K53 A;  3F33 A;  2X17 0;  1JKU A;  3F36 A;  5GU1 X;  4ETR A;  3PW1 B;  2D5K A;  4PGK A;  4DYY A;  5LBH A;  2C41 A;  4RC6 B;  4CYA A;  4CYB A;  1NF6 A;  4ZL6 A;  3WVV A;  3QHC A;  3PW1 A;  1UMN A;  2PYB A;  1LKM A;  4EVE A;  4RC6 A;  5ERJ A;  1YUZ A;  4MY7 A;  4LQN A;  2ZG8 X;  2CHI A;  3U90 A;  4ZKW A;  3KA9 A;  5FFC A;  2ZG9 X;  1ZS3 A;  4XKU A;  1Z6O A;  1QYB A;  4M32 A;  3FSE A;  4RC7 B;  3PZA A;  4TOG A;  3BVK A;  2C6R A;  3O7R A;  4ML5 A;  4EVC A;  3RE7 A;  2XJN A;  3PW8 C;  4M34 A;  4RC7 A;  2OH3 A;  3KA3 A;  5JAC A;  4U3G A;  1MOJ A;  3ISE A;  1N1Q A;  5FFD A;  4LPN A;  1MFR A;  3PVT B;  1F30 A;  1VJX A;  1NFV A;  3HIU A;  2QF9 A;  4Y08 A;  1XZ1 A;  4KVS A;  4II4 B;  3AK8 A;  1DAT A;  2FG4 A;  2C2J A;  3NOZ X;  3PVT A;  5ERK A;  3HL1 A;  4II4 A;  4KVR A;  4PG1 A;  4MJY A;  5GU0 X;  3EZ0 A;  5D8S A;  4RC5 B;  4KVQ A;  5CZU A;  1S30 A;  3WVU A;  1NF4 A;  2C2F A;  3H7G A;  3EGM A;  5E2D A;  5GN8 B;  5C6F A;  3PWQ A;  4RC5 A;  3ES3 A;  3VNX A;  4TOA A;  4A25 A;  2V2I A;  1BCF A;  1VLG A;  2IU2 A;  3BVE A;  3UOI A;  3NP0 X;  4DI0 A;  2ITB A;  2G4H A;  1IES A;  1JI5 A;  1RCI A;  2V2N A;  2RBD A;  3ERZ A;  3IS7 A;  5K52 A;  3UNO A;  5AXS A;  2V2S A;  5FFA A;  2Y3Q A;  4CVR A;  3NP2 X;  5JKL A;  3GE4 A;  2C2U A;  1JGC A;  3E6R A;  2BJY A;  2JD7 0;  1HRS A;  4Z5S A;  4MKU A;  2Z5P A;  2FZF A;  3AJO A;  3QVD A;  2CN6 A;  2Z5R A;  4ZLW A;  2XKQ A;  3AF7 X;  3ISF A;  4DZ0 A;  3F39 A;  3SE1 A;  3KX9 A;  4XGS A;  3KXU A;  1O9I A;  3QZ3 A;  1JKV A;  2XGW A;  4LYU A;  3RBC A;  4IXK A;  2VXI A;  4PGI A;  3R2L A;  4LPJ A;  4DYX A;  5FEJ A;  5HQO A;  1H96 A;  1BFR A; 
#chains in the Genus database with same CATH topology
 4ISM A;  3E1J A;  5J93 A;  5HJF A;  1TKO A;  1Z4A A;  2FKZ A;  3F35 A;  3KDQ A;  3GGZ A;  2F7N A;  3BVI A;  1O9R A;  1YV1 A;  3BVL A;  3GHQ A;  3MPS A;  2JD6 0;  3E1O A;  2BW1 A;  2V2O A;  3KWO A;  3A68 A;  3VV9 A;  2QQY A;  3R2R A;  3T9J A;  2JD8 0;  5D8O A;  2V15 A;  4W4L B;  4IWJ A;  2YJK A;  1L8I A;  4Z3B A;  4ZMC A;  4XKT A;  3PVY B;  3SH6 A;  4AM2 A;  4ZJK A;  3R2S A;  3FVB A;  2FJC A;  4TW3 A;  4CMY A;  1JYB A;  3PVY A;  4RC8 A;  2IB0 A;  1YUX A;  1GWG A;  3OJ5 A;  3E6S A;  3SHX A;  3BVF A;  2CF7 A;  4TOB A;  1AEW A;  4ITW A;  4ZL5 A;  2W0O A;  1TK6 A;  2CLB A;  3RD0 A;  4TOD A;  2V2P A;  2FG8 A;  1DVB A;  5J8S A;  4AM4 A;  4DYU A;  4YVZ A;  5LG2 A;  5GN8 A;  5JKM A;  4YXJ A;  4YKH A;  3AF8 X;  1Z6O M;  1SQ3 A;  2GYD A;  4LQH A;  1R03 A;  5FFE A;  2CEI A;  3BKN A;  5GU3 X;  4ZKX A;  3KA8 A;  1JI4 A;  3D19 A;  1VEI A;  3KA4 A;  4ZTT A;  4AM5 A;  5J9V A;  3E1Q A;  2ZA6 A;  5GOU A;  4MN9 A;  5D8Y A;  3TA8 A;  2CHP A;  3DBY A;  3JZA B;  4ERU A;  4CY9 A;  3A9Q A;  2WLA A;  4EVD A;  1F33 A;  4DAS A;  1DPS A;  3PVR B;  3PWQ C;  1JTS A;  3GGY A;  4LQV A;  1RCG A;  2ZA7 A;  1RCC A;  4IWK A;  2XJO A;  4ISP A;  1ZUJ A;  4P18 A;  3PW8 A;  4QUW A;  2CLU A;  4MUD A;  4DYZ A;  4M35 A;  3PVR A;  5JDO A;  1UVH A;  2Z90 A;  2FFX J;  1QGH A;  3Q4O A;  3GVY A;  4LPM A;  3F38 A;  5FFB A;  3UFB A;  3UOF A;  3R2H A;  5JKL G;  2ZA8 A;  4E6K A;  5IX6 A;  3E1L A;  3WNW A;  2BKC A;  1S3Q A;  2YW6 A;  1SOF A;  1BG7 A;  1RCD A;  2GYQ A;  3RGD A;  3PWF A;  1JIG A;  2YW7 A;  3R2K A;  3O7S A;  4MXP A;  5CMQ A;  2CN7 A;  5GU2 X;  3R2O A;  3AK9 A;  4CVS A;  3E1N A;  1J30 A;  2WTL A;  4CVT A;  3JZ9 A;  2HTN A;  4EVB A;  2BK6 A;  3E1P A;  4DE6 A;  1KRQ A;  2V2L A;  3QHB A;  2FL0 A;  2CIH A;  3BT5 A;  4TOH A;  2XJM A;  4TOC A;  2V2M A;  3C1Z A;  3L0M A;  1NNQ A;  3IQ1 A;  4LYX A;  2VXX A;  3EZU A;  3F32 A;  1L8H A;  2FHA A;  3QB9 A;  2GS4 A;  3KA6 A;  4TOE A;  1TJO A;  4R42 A;  1RCE A;  3R2M A;  1RYT A;  5CMR A;  1VEL A;  3C21 A;  2HR5 A;  5D8Q A;  3WVW A;  5D8R A;  2CWL A;  4TO9 A;  4OYN A;  5D8X A;  2UX1 A;  1JRE A;  4REU A;  1LKO A;  3Q4N A;  3F34 A;  3RAV A;  4XKS A;  4X0J A;  2IY4 A;  3E2C A;  3W54 A;  2ZUR X;  2Z5Q A;  1B71 A;  3Q4Q A;  1IER A;  1OTK A;  5LG8 A;  3C1Y A;  5E1U A;  3AJQ A;  4ITT A;  2V2R A;  2OC5 A;  2YJJ A;  4TOF A;  3IS8 A;  3OGH A;  1TKP A;  3KHK A;  4ZKH A;  5I4J A;  1FHA A;  1XZ3 A;  4LQJ A;  3FI6 A;  2VZB A;  4M33 A;  3Q4R A;  3QD8 A;  5D8P A;  5LS9 A;  4CVP A;  1EUM A;  5J8W A;  2WLU A;  4CMY V;  1LKP A;  3SID A;  3AJP A;  1S2Z A;  2V2J A;  3F37 A;  1VEQ A;  5HJH A;  1LB3 A;  3E1M A;  5JKM G;  4PG0 A;  2ZG7 X;  3AF9 X;  4YXM A;  3C23 A;  2Z6M A;  5K53 A;  3F33 A;  2X17 0;  1JKU A;  3F36 A;  5GU1 X;  4ETR A;  3PW1 B;  2D5K A;  4PGK A;  4DYY A;  5LBH A;  2C41 A;  4RC6 B;  4CYA A;  4CYB A;  1NF6 A;  4ZL6 A;  3WVV A;  3QHC A;  3PW1 A;  3VVA A;  1UMN A;  2PYB A;  1LKM A;  2AR0 A;  4EVE A;  4RC6 A;  5ERJ A;  1YUZ A;  4MY7 A;  4LQN A;  2ZG8 X;  2CHI A;  3U90 A;  4ZKW A;  3KA9 A;  5FFC A;  2ZG9 X;  1ZS3 A;  4XKU A;  1Z6O A;  1QYB A;  3V3K B;  4M32 A;  3FSE A;  4RC7 B;  2G38 B;  3PZA A;  4TOG A;  3BVK A;  2C6R A;  3O7R A;  4ML5 A;  4EVC A;  3RE7 A;  2XJN A;  3PW8 C;  2WWX B;  4M34 A;  4RC7 A;  2V8U A;  2OH3 A;  3KA3 A;  5JAC A;  4W4K B;  4E40 A;  4U3G A;  1MOJ A;  2MGY A;  3ISE A;  1N1Q A;  5FFD A;  4LPN A;  1MFR A;  3PVT B;  1F30 A;  1VJX A;  1NFV A;  3HIU A;  2QF9 A;  4Y08 A;  1XZ1 A;  4KVS A;  4II4 B;  3AK8 A;  1DAT A;  2FG4 A;  2C2J A;  3NOZ X;  3PVT A;  2N02 A;  5ERK A;  3FRR A;  3HL1 A;  4II4 A;  4KVR A;  4PG1 A;  4MJY A;  5GU0 X;  2OKC A;  3EZ0 A;  5D8S A;  4RC5 B;  4KVQ A;  5CZU A;  1S30 A;  3WVU A;  1NF4 A;  2C2F A;  3H7G A;  3EGM A;  5E2D A;  5GN8 B;  5C6F A;  3PWQ A;  4RC5 A;  5HU6 D;  3ES3 A;  3VNX A;  4TOA A;  4A25 A;  2V2I A;  1BCF A;  3LKD A;  1VLG A;  2IU2 A;  3BVE A;  3UOI A;  3NP0 X;  4DI0 A;  2ITB A;  2G4H A;  1IES A;  3M6J A;  1JI5 A;  1RCI A;  2V2N A;  2RBD A;  3ERZ A;  3IS7 A;  5K52 A;  3UNO A;  5AXS A;  2V2S A;  5FFA A;  2Y3Q A;  4CVR A;  3NP2 X;  5JKL A;  3GE4 A;  2C2U A;  1JGC A;  3E6R A;  2BJY A;  2JD7 0;  1HRS A;  4Z5S A;  4MKU A;  2Z5P A;  2FZF A;  5JDO B;  3AJO A;  3QVD A;  2CN6 A;  2Z5R A;  3N6O A;  2Y44 A;  2XKQ A;  4ZLW A;  3FRS A;  3AF7 X;  3ISF A;  4DZ0 A;  3F39 A;  3SE1 A;  3KX9 A;  4XGS A;  3KXU A;  2V8T A;  1O9I A;  3QZ3 A;  4WJG 4;  1JKV A;  2XGW A;  4KXR B;  4LYU A;  3RBC A;  4IXK A;  2VXI A;  4PGI A;  3R2L A;  4LPJ A;  4DYX A;  5FEJ A;  5HQO A;  1H96 A;  1BFR A; 
#chains in the Genus database with same CATH homology
 4ISM A;  3E1J A;  5J93 A;  5HJF A;  1TKO A;  1Z4A A;  2FKZ A;  3F35 A;  3KDQ A;  3GGZ A;  2F7N A;  3BVI A;  1O9R A;  1YV1 A;  3BVL A;  3GHQ A;  3MPS A;  2JD6 0;  3E1O A;  2BW1 A;  2V2O A;  3KWO A;  3A68 A;  3VV9 A;  2QQY A;  3R2R A;  3T9J A;  2JD8 0;  5D8O A;  2V15 A;  4W4L B;  4IWJ A;  2YJK A;  1L8I A;  4Z3B A;  4ZMC A;  4XKT A;  3PVY B;  3SH6 A;  4AM2 A;  4ZJK A;  3R2S A;  3FVB A;  2FJC A;  4TW3 A;  4CMY A;  1JYB A;  3PVY A;  4RC8 A;  2IB0 A;  1YUX A;  1GWG A;  3OJ5 A;  3E6S A;  3SHX A;  3BVF A;  2CF7 A;  4TOB A;  1AEW A;  4ITW A;  4ZL5 A;  2W0O A;  1TK6 A;  2CLB A;  3RD0 A;  4TOD A;  2V2P A;  2FG8 A;  1DVB A;  5J8S A;  4AM4 A;  4DYU A;  4YVZ A;  5LG2 A;  5GN8 A;  5JKM A;  4YXJ A;  4YKH A;  3AF8 X;  1Z6O M;  1SQ3 A;  2GYD A;  4LQH A;  1R03 A;  5FFE A;  2CEI A;  3BKN A;  5GU3 X;  4ZKX A;  3KA8 A;  1JI4 A;  3D19 A;  1VEI A;  3KA4 A;  4ZTT A;  4AM5 A;  5J9V A;  3E1Q A;  2ZA6 A;  5GOU A;  4MN9 A;  5D8Y A;  3TA8 A;  2CHP A;  3DBY A;  3JZA B;  4ERU A;  4CY9 A;  3A9Q A;  2WLA A;  4EVD A;  1F33 A;  4DAS A;  1DPS A;  3PVR B;  3PWQ C;  1JTS A;  3GGY A;  4LQV A;  1RCG A;  2ZA7 A;  1RCC A;  4IWK A;  2XJO A;  4ISP A;  1ZUJ A;  4P18 A;  3PW8 A;  4QUW A;  2CLU A;  4MUD A;  4DYZ A;  4M35 A;  3PVR A;  5JDO A;  1UVH A;  2Z90 A;  2FFX J;  1QGH A;  3Q4O A;  3GVY A;  4LPM A;  3F38 A;  5FFB A;  3UFB A;  3UOF A;  3R2H A;  5JKL G;  2ZA8 A;  4E6K A;  5IX6 A;  3E1L A;  3WNW A;  2BKC A;  1S3Q A;  2YW6 A;  1SOF A;  1BG7 A;  1RCD A;  2GYQ A;  3RGD A;  3PWF A;  1JIG A;  2YW7 A;  3R2K A;  3O7S A;  4MXP A;  5CMQ A;  2CN7 A;  5GU2 X;  3R2O A;  3AK9 A;  4CVS A;  3E1N A;  1J30 A;  2WTL A;  4CVT A;  3JZ9 A;  2HTN A;  4EVB A;  2BK6 A;  3E1P A;  4DE6 A;  1KRQ A;  2V2L A;  3QHB A;  2FL0 A;  2CIH A;  3BT5 A;  4TOH A;  2XJM A;  4TOC A;  2V2M A;  3C1Z A;  3L0M A;  1NNQ A;  3IQ1 A;  4LYX A;  2VXX A;  3EZU A;  3F32 A;  1L8H A;  2FHA A;  3QB9 A;  2GS4 A;  3KA6 A;  4TOE A;  1TJO A;  4R42 A;  1RCE A;  3R2M A;  1RYT A;  5CMR A;  1VEL A;  3C21 A;  2HR5 A;  5D8Q A;  3WVW A;  5D8R A;  2CWL A;  4TO9 A;  4OYN A;  5D8X A;  2UX1 A;  1JRE A;  4REU A;  1LKO A;  3Q4N A;  3F34 A;  3RAV A;  4XKS A;  4X0J A;  2IY4 A;  3E2C A;  3W54 A;  2ZUR X;  2Z5Q A;  1B71 A;  3Q4Q A;  1IER A;  1OTK A;  5LG8 A;  3C1Y A;  5E1U A;  3AJQ A;  4ITT A;  2V2R A;  2OC5 A;  2YJJ A;  4TOF A;  3IS8 A;  3OGH A;  1TKP A;  3KHK A;  4ZKH A;  5I4J A;  1FHA A;  1XZ3 A;  4LQJ A;  3FI6 A;  2VZB A;  4M33 A;  3Q4R A;  3QD8 A;  5D8P A;  5LS9 A;  4CVP A;  1EUM A;  5J8W A;  2WLU A;  4CMY V;  1LKP A;  3SID A;  3AJP A;  1S2Z A;  2V2J A;  3F37 A;  1VEQ A;  5HJH A;  1LB3 A;  3E1M A;  5JKM G;  4PG0 A;  2ZG7 X;  3AF9 X;  4YXM A;  3C23 A;  2Z6M A;  5K53 A;  3F33 A;  2X17 0;  1JKU A;  3F36 A;  5GU1 X;  4ETR A;  3PW1 B;  2D5K A;  4PGK A;  4DYY A;  5LBH A;  2C41 A;  4RC6 B;  4CYA A;  4CYB A;  1NF6 A;  4ZL6 A;  3WVV A;  3QHC A;  3PW1 A;  3VVA A;  1UMN A;  2PYB A;  1LKM A;  2AR0 A;  4EVE A;  4RC6 A;  5ERJ A;  1YUZ A;  4MY7 A;  4LQN A;  2ZG8 X;  2CHI A;  3U90 A;  4ZKW A;  3KA9 A;  5FFC A;  2ZG9 X;  1ZS3 A;  4XKU A;  1Z6O A;  1QYB A;  3V3K B;  4M32 A;  3FSE A;  4RC7 B;  2G38 B;  3PZA A;  4TOG A;  3BVK A;  2C6R A;  3O7R A;  4ML5 A;  4EVC A;  3RE7 A;  2XJN A;  3PW8 C;  2WWX B;  4M34 A;  4RC7 A;  2V8U A;  2OH3 A;  3KA3 A;  5JAC A;  4W4K B;  4E40 A;  4U3G A;  1MOJ A;  2MGY A;  3ISE A;  1N1Q A;  5FFD A;  4LPN A;  1MFR A;  3PVT B;  1F30 A;  1VJX A;  1NFV A;  3HIU A;  2QF9 A;  4Y08 A;  1XZ1 A;  4KVS A;  4II4 B;  3AK8 A;  1DAT A;  2FG4 A;  2C2J A;  3NOZ X;  3PVT A;  2N02 A;  5ERK A;  3FRR A;  3HL1 A;  4II4 A;  4KVR A;  4PG1 A;  4MJY A;  5GU0 X;  2OKC A;  3EZ0 A;  5D8S A;  4RC5 B;  4KVQ A;  5CZU A;  1S30 A;  3WVU A;  1NF4 A;  2C2F A;  3H7G A;  3EGM A;  5E2D A;  5GN8 B;  5C6F A;  3PWQ A;  4RC5 A;  5HU6 D;  3ES3 A;  3VNX A;  4TOA A;  4A25 A;  2V2I A;  1BCF A;  3LKD A;  1VLG A;  2IU2 A;  3BVE A;  3UOI A;  3NP0 X;  4DI0 A;  2ITB A;  2G4H A;  1IES A;  3M6J A;  1JI5 A;  1RCI A;  2V2N A;  2RBD A;  3ERZ A;  3IS7 A;  5K52 A;  3UNO A;  5AXS A;  2V2S A;  5FFA A;  2Y3Q A;  4CVR A;  3NP2 X;  5JKL A;  3GE4 A;  2C2U A;  1JGC A;  3E6R A;  2BJY A;  2JD7 0;  1HRS A;  4Z5S A;  4MKU A;  2Z5P A;  2FZF A;  5JDO B;  3AJO A;  3QVD A;  2CN6 A;  2Z5R A;  3N6O A;  2Y44 A;  2XKQ A;  4ZLW A;  3FRS A;  3AF7 X;  3ISF A;  4DZ0 A;  3F39 A;  3SE1 A;  3KX9 A;  4XGS A;  3KXU A;  2V8T A;  1O9I A;  3QZ3 A;  4WJG 4;  1JKV A;  2XGW A;  4KXR B;  4LYU A;  3RBC A;  4IXK A;  2VXI A;  4PGI A;  3R2L A;  4LPJ A;  4DYX A;  5FEJ A;  5HQO A;  1H96 A;  1BFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...