5C6FA

Crystal structures of ferritin mutants reveal side-on binding to diiron and end-on cleavage of oxygen
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
172
structure length
172
Chain Sequence
HHSQDPMLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYELEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial non-heme ferritin
publication title Structural Basis of Novel Iron-Uptake Route and Reaction Intermediates in Ferritins from Gram-Negative Bacteria.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 78
structure length 172
sequence length 172
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5c6fA00
1O9RA 1YUXA 5I4JA 3KX9A 1TJOA 2ZG7X 3R2SA 1S30A 2ITBA 3R2KA 1LKOA 2V2RA 2Z90A 4KVSA 2ZA8A 2XJOA 4IWKA 1HRSA 1BFRA 4IXKA 3VNXA 5AXSA 5HQOA 2CLUA 3AJPA 2OC5A 4ITTA 2PYBA 2C2JA 3U90A 3EGMA 3IS8A 1UMNA 3AF9X 5JACA 3SE1A 5FEJA 3QD8A 1XZ1A 5E2DA 4ZLWA 1AEWA 3UNOA 1VLGA 2ZG8X 3KA8A 4DYYA 3HL1A 2BK6A 4ETRA 1RCCA 4PGIA 4DASA 3NP0X 1FHAA 1XZ3A 4EVCA 3PW8A 3Q4RA 5JKLA 1JIGA 3E1JA 2BKCA 3KA4A 4XGSA 3RAVA 3BKNA 3O7SA 5LG8A 1Z4AA 1L8IA 1QGHA 4E6KA 4EVBA 4II4B 5GU0X 3R2RA 2VZBA 4TOFA 3Q4OA 5CMRA 4TOHA 5J93A 4XKTA 4TOAA 4DYZA 3BVLA 2C2UA 3E1NA 2HTNA 1BCFA 3AK8A 2C41A 4ZL5A 1VEQA 4TODA 3EZ0A 3PVRA 4P18A 4ZL6A 2CEIA 2FZFA 4XKSA 5FFBA 2VXIA 2FJCA 2YW6A 3RE7A 5D8XA 5J8WA 1S2ZA 1ZUJA 5E1UA 4CVSA 2Z5RA 2G4HA 3QB9A 3PWQC 1BG7A 2FHAA 3KA9A 1RYTA 3FSEA 2XKQA 3UOIA 3E1OA 3Q4QA 2CN7A 4LQJA 4LYXA 4LYUA 3ISFA 4LQHA 4LQNA 3GHQA 2WTLA 2ZG9X 4MY7A 5JKMG 5CZUA 1UVHA 3BVFA 1NNQA 1S3QA 4TOCA 2IB0A 3MPSA 3AF8X 1DVBA 3E2CA 4ZMCA 2GS4A 2FFXJ 3R2MA 1L8HA 5GN8A 1JREA 4ZTTA 4ITWA 4PG1A 3TA8A 3SIDA 5HJFA 1J30A 3SHXA 2HR5A 2V2JA 5D8YA 2C2FA 3H7GA 2Z5PA 3KXUA 4PGKA 2FKZA 1GWGA 4ML5A 1Z6OA 1Z6OM 5D8QA 3QVDA 5FFAA 2XJMA 2ZA6A 4TO9A 2Z6MA 5GU2X 3PVYB 1TK6A 3E1MA 3NP2X 3PVTB 5ERKA 3BVIA 3PWFA 3KA3A 3BVEA 1R03A 1F33A 4A25A 2QQYA 3F36A 5GOUA 4PG0A 4LQVA 2V2PA 2V2NA 3ISEA 3QZ3A 1RCGA 3PVRB 2C6RA 1IESA 3PVYA 2IU2A 3PVTA 3PW1B 3WNWA 4ISPA 4M32A 5GU3X 2YW7A 4RC8A 3NOZX 1LKMA 3F38A 3KA6A 4DE6A 3FVBA 2CHIA 4U3GA 3F39A 5JKMA 3PW1A 1MFRA 4M35A 1RCDA 3A9QA 4DI0A 4CVPA 2V2MA 2RBDA 3F37A 2BW1A 4CYBA 3R2OA 3R2LA 4RC5B 2FG8A 1SOFA 3PW8C 5LBHA 5JKLG 2BJYA 4MJYA 4DYUA 2V2SA 4ZJKA 2YJKA 3A68A 1TKPA 3AJQA 2Z5QA 3T9JA 4KVRA 1N1QA 2CF7A 4CY9A 1JI5A 2ZA7A 5GN8B 5J8SA 4MN9A 4RC5A 4AM5A 3WVVA 3F33A 2GYQA 5FFDA 2VXXA 1EUMA 3UOFA 1QYBA 1RCIA 2X170 5FFEA 5ERJA 4CMYA 4TW3A 2OH3A 3OJ5A 5GU1X 2CIHA 1NF6A 3E1LA 1B71A 1F30A 4YKHA 3AK9A 3E6SA 4LPNA 3GVYA 4Y08A 4TOBA 5C6FA 5D8OA 4IWJA 2FG4A 3FI6A 3BVKA 4KVQA 2GYDA 1VELA 4RC7B 5LS9A 3SH6A 3Q4NA 1SQ3A 4EVDA 1LB3A 1MOJA 3AF7X 1KRQA 1LKPA 2V15A 2IY4A 3F32A 1JKUA 1JI4A 3PZAA 4QUWA 4MKUA 2QF9A 4XKUA 2JD70 4AM4A 4OYNA 1DPSA 1DATA 3E6RA 1VJXA 4RC7A 1TKOA 3IQ1A 1RCEA 2WLUA 1JYBA 3GE4A 3PWQA 3O7RA 4CMYV 4LPMA 3E1PA 5FFCA 4RC6B 1JKVA 5D8PA 5CMQA 2V2IA 3WVWA 4EVEA 3F35A 3HIUA 4DZ0A 3QHCA 4Z3BA 2WLAA 4Z5SA 1YUZA 1ZS3A 2YJJA 2Y3QA 3QHBA 5K52A 1OTKA 4R42A 2V2LA 2FL0A 1IERA 4MUDA 5D8RA 3ERZA 5IX6A 3IS7A 4ERUA 3KWOA 4TOEA 2JD60 1O9IA 4RC6A 4CVRA 1H96A 4CVTA 1NFVA 4TOGA 2CN6A 2UX1A 3WVUA 3BT5A 4II4A 4ZKHA 2XJNA 3EZUA 4CYAA 4LPJA 2JD80 3E1QA 2CHPA 2W0OA 4M34A 3OGHA 4REUA 1YV1A 2V2OA 3AJOA 2ZURX 5J9VA 5D8SA 5LG2A 2XGWA 3F34A 4DYXA 5HJHA 4ZKXA 4M33A 1NF4A 2CLBA 1JGCA 4ZKWA 3ES3A 3RGDA 2D5KA 2F7NA 4ISMA 4AM2A 1JTSA 3RBCA 3R2HA 3RD0A 5K53A 1VEIA
chains in the Genus database with same CATH superfamily
1O9RA 1YUXA 5I4JA 3KX9A 1TJOA 2ZG7X 3R2SA 4KXRB 1S30A 2ITBA 3R2KA 1LKOA 2V2RA 2Z90A 4KVSA 2MGYA 2ZA8A 4E40A 2XJOA 4IWKA 1HRSA 1BFRA 2OKCA 4IXKA 3VNXA 5AXSA 4YVZA 5HQOA 2CLUA 3AJPA 2OC5A 4ITTA 2PYBA 2C2JA 3U90A 3EGMA 3IS8A 1UMNA 3AF9X 5JACA 3SE1A 5FEJA 3QD8A 1XZ1A 5E2DA 4ZLWA 3KDQA 1AEWA 3UNOA 1VLGA 2ZG8X 3GGYA 3KA8A 4DYYA 3HL1A 2BK6A 4ETRA 1RCCA 4PGIA 4DASA 3C1YA 3NP0X 1FHAA 1XZ3A 4EVCA 3PW8A 3Q4RA 5JKLA 1JIGA 3E1JA 2BKCA 3KA4A 4XGSA 3RAVA 3BKNA 3O7SA 5LG8A 1Z4AA 1L8IA 1QGHA 4E6KA 4EVBA 4II4B 5GU0X 3R2RA 2VZBA 4YXJA 4TOFA 3Q4OA 5CMRA 4TOHA 5J93A 4XKTA 4TOAA 4DYZA 3BVLA 2C2UA 3E1NA 2HTNA 1BCFA 3AK8A 2C41A 4ZL5A 1VEQA 4TODA 3C21A 3EZ0A 3PVRA 4P18A 4ZL6A 2CEIA 2FZFA 4XKSA 5FFBA 2VXIA 2FJCA 2YW6A 3RE7A 5D8XA 5J8WA 1S2ZA 1ZUJA 5E1UA 3VVAA 4CVSA 2Z5RA 2G4HA 3QB9A 3PWQC 1BG7A 2FHAA 3KA9A 1RYTA 3FSEA 2XKQA 3UOIA 3E1OA 3Q4QA 4YXMA 2CN7A 4LQJA 4LYXA 4LYUA 3ISFA 4LQHA 2Y44A 4LQNA 3GHQA 2WTLA 2ZG9X 4MY7A 3V3KB 5JKMG 5CZUA 1UVHA 3BVFA 1NNQA 3C23A 1S3QA 4TOCA 2IB0A 3MPSA 3AF8X 1DVBA 3E2CA 4ZMCA 2GS4A 2FFXJ 3R2MA 1L8HA 3KHKA 5GN8A 1JREA 4ZTTA 4ITWA 4PG1A 3TA8A 3SIDA 5HJFA 1J30A 3SHXA 2HR5A 2V2JA 5D8YA 2C2FA 3H7GA 2Z5PA 3KXUA 4PGKA 2FKZA 1GWGA 3L0MA 4ML5A 1Z6OA 1Z6OM 5D8QA 3QVDA 5FFAA 2XJMA 2ZA6A 4TO9A 2Z6MA 5GU2X 3PVYB 1TK6A 3E1MA 3NP2X 3PVTB 5ERKA 3BVIA 3PWFA 3KA3A 3BVEA 5HU6D 1R03A 1F33A 4A25A 2QQYA 3F36A 5GOUA 4PG0A 4LQVA 2V2PA 2V2NA 3ISEA 3QZ3A 1RCGA 3PVRB 2C6RA 1IESA 3PVYA 2IU2A 4MXPA 3PVTA 3PW1B 3WNWA 4ISPA 4M32A 5GU3X 2YW7A 4RC8A 3NOZX 1LKMA 3F38A 3W54A 3KA6A 4DE6A 3FVBA 2CHIA 4U3GA 3F39A 5JKMA 3PW1A 1MFRA 4M35A 1RCDA 3A9QA 4DI0A 3M6JA 4CVPA 2V2MA 2RBDA 3F37A 2BW1A 3LKDA 4CYBA 3R2OA 3R2LA 4RC5B 2FG8A 1SOFA 3PW8C 5LBHA 3N6OA 5JKLG 2BJYA 4MJYA 4DYUA 2V2SA 4ZJKA 2YJKA 3A68A 1TKPA 3AJQA 2Z5QA 3T9JA 5JDOA 4KVRA 1N1QA 2CF7A 3UFBA 4CY9A 1JI5A 2ZA7A 5GN8B 5J8SA 3GGZA 4MN9A 4RC5A 4AM5A 3WVVA 3F33A 2GYQA 5FFDA 2VXXA 1EUMA 3UOFA 1QYBA 1RCIA 2X170 5FFEA 5ERJA 4CMYA 4TW3A 2OH3A 3OJ5A 5GU1X 2CIHA 1NF6A 2AR0A 3E1LA 1B71A 1F30A 4YKHA 3AK9A 3FRRA 3E6SA 3JZ9A 4LPNA 3GVYA 4Y08A 4TOBA 5C6FA 5D8OA 4IWJA 2FG4A 3FI6A 3BVKA 4KVQA 2GYDA 1VELA 3C1ZA 4RC7B 5LS9A 3SH6A 3Q4NA 1SQ3A 4EVDA 1LB3A 1MOJA 2N02A 3AF7X 1KRQA 1LKPA 2V15A 2IY4A 3F32A 2G38B 1JKUA 1JI4A 3PZAA 4QUWA 4MKUA 2QF9A 4XKUA 2JD70 4AM4A 4OYNA 1DPSA 1DATA 3E6RA 1VJXA 4RC7A 4X0JA 1TKOA 3IQ1A 1RCEA 2V8UA 2WLUA 3JZAB 1JYBA 3GE4A 2WWXB 4WJG4 3PWQA 3O7RA 4CMYV 4LPMA 3E1PA 5FFCA 4RC6B 1JKVA 5D8PA 5CMQA 2V2IA 3WVWA 4EVEA 3F35A 3HIUA 4DZ0A 3QHCA 4Z3BA 2WLAA 2V8TA 4Z5SA 1YUZA 1ZS3A 2YJJA 2Y3QA 3QHBA 3D19A 5K52A 1OTKA 4R42A 2V2LA 2FL0A 1IERA 4MUDA 5D8RA 3ERZA 5IX6A 3IS7A 4ERUA 3KWOA 4TOEA 2JD60 1O9IA 4RC6A 4CVRA 1H96A 4CVTA 1NFVA 5JDOB 4TOGA 2CN6A 2UX1A 3WVUA 3BT5A 4II4A 4ZKHA 2XJNA 3EZUA 4CYAA 3VV9A 4LPJA 2JD80 3E1QA 2CHPA 2W0OA 4M34A 3OGHA 4REUA 2CWLA 1YV1A 2V2OA 3AJOA 2ZURX 5J9VA 5D8SA 5LG2A 2XGWA 3F34A 4DYXA 3FRSA 3DBYA 5HJHA 4ZKXA 4M33A 1NF4A 2CLBA 1JGCA 4ZKWA 4W4LB 3ES3A 4W4KB 3RGDA 2D5KA 2F7NA 4ISMA 4AM2A 1JTSA 3RBCA 3R2HA 3RD0A 5K53A 1VEIA
chains in the Genus database with same CATH topology
1O9RA 1YUXA 5I4JA 3KX9A 1TJOA 2ZG7X 3R2SA 4KXRB 1S30A 2ITBA 3R2KA 1LKOA 2V2RA 2Z90A 4KVSA 2MGYA 2ZA8A 4E40A 2XJOA 4IWKA 1HRSA 1BFRA 2OKCA 4IXKA 3VNXA 5AXSA 4YVZA 5HQOA 2CLUA 3AJPA 2OC5A 4ITTA 2PYBA 2C2JA 3U90A 3EGMA 3IS8A 1UMNA 3AF9X 5JACA 3SE1A 5FEJA 3QD8A 1XZ1A 5E2DA 4ZLWA 3KDQA 1AEWA 3UNOA 1VLGA 2ZG8X 3GGYA 3KA8A 4DYYA 3HL1A 2BK6A 4ETRA 1RCCA 4PGIA 4DASA 3C1YA 3NP0X 1FHAA 1XZ3A 4EVCA 3PW8A 3Q4RA 5JKLA 1JIGA 3E1JA 2BKCA 3KA4A 4XGSA 3RAVA 3BKNA 3O7SA 5LG8A 1Z4AA 1L8IA 1QGHA 4E6KA 4EVBA 4II4B 5GU0X 3R2RA 2VZBA 4YXJA 4TOFA 3Q4OA 5CMRA 4TOHA 5J93A 4XKTA 4TOAA 4DYZA 3BVLA 2C2UA 3E1NA 2HTNA 1BCFA 3AK8A 2C41A 4ZL5A 1VEQA 4TODA 3C21A 3EZ0A 3PVRA 4P18A 4ZL6A 2CEIA 2FZFA 4XKSA 5FFBA 2VXIA 2FJCA 2YW6A 3RE7A 5D8XA 5J8WA 1S2ZA 1ZUJA 5E1UA 3VVAA 4CVSA 2Z5RA 2G4HA 3QB9A 3PWQC 1BG7A 2FHAA 3KA9A 1RYTA 3FSEA 2XKQA 3UOIA 3E1OA 3Q4QA 4YXMA 2CN7A 4LQJA 4LYXA 4LYUA 3ISFA 4LQHA 2Y44A 4LQNA 3GHQA 2WTLA 2ZG9X 4MY7A 3V3KB 5JKMG 5CZUA 1UVHA 3BVFA 1NNQA 3C23A 1S3QA 4TOCA 2IB0A 3MPSA 3AF8X 1DVBA 3E2CA 4ZMCA 2GS4A 2FFXJ 3R2MA 1L8HA 3KHKA 5GN8A 1JREA 4ZTTA 4ITWA 4PG1A 3TA8A 3SIDA 5HJFA 1J30A 3SHXA 2HR5A 2V2JA 5D8YA 2C2FA 3H7GA 2Z5PA 3KXUA 4PGKA 2FKZA 1GWGA 3L0MA 4ML5A 1Z6OA 1Z6OM 5D8QA 3QVDA 5FFAA 2XJMA 2ZA6A 4TO9A 2Z6MA 5GU2X 3PVYB 1TK6A 3E1MA 3NP2X 3PVTB 5ERKA 3BVIA 3PWFA 3KA3A 3BVEA 5HU6D 1R03A 1F33A 4A25A 2QQYA 3F36A 5GOUA 4PG0A 4LQVA 2V2PA 2V2NA 3ISEA 3QZ3A 1RCGA 3PVRB 2C6RA 1IESA 3PVYA 2IU2A 4MXPA 3PVTA 3PW1B 3WNWA 4ISPA 4M32A 5GU3X 2YW7A 4RC8A 3NOZX 1LKMA 3F38A 3W54A 3KA6A 4DE6A 3FVBA 2CHIA 4U3GA 3F39A 5JKMA 3PW1A 1MFRA 4M35A 1RCDA 3A9QA 4DI0A 3M6JA 4CVPA 2V2MA 2RBDA 3F37A 2BW1A 3LKDA 4CYBA 3R2OA 3R2LA 4RC5B 2FG8A 1SOFA 3PW8C 5LBHA 3N6OA 5JKLG 2BJYA 4MJYA 4DYUA 2V2SA 4ZJKA 2YJKA 3A68A 1TKPA 3AJQA 2Z5QA 3T9JA 5JDOA 4KVRA 1N1QA 2CF7A 3UFBA 4CY9A 1JI5A 2ZA7A 5GN8B 5J8SA 3GGZA 4MN9A 4RC5A 4AM5A 3WVVA 3F33A 2GYQA 5FFDA 2VXXA 1EUMA 3UOFA 1QYBA 1RCIA 2X170 5FFEA 5ERJA 4CMYA 4TW3A 2OH3A 3OJ5A 5GU1X 2CIHA 1NF6A 2AR0A 3E1LA 1B71A 1F30A 4YKHA 3AK9A 3FRRA 3E6SA 3JZ9A 4LPNA 3GVYA 4Y08A 4TOBA 5C6FA 5D8OA 4IWJA 2FG4A 3FI6A 3BVKA 4KVQA 2GYDA 1VELA 3C1ZA 4RC7B 5LS9A 3SH6A 3Q4NA 1SQ3A 4EVDA 1LB3A 1MOJA 2N02A 3AF7X 1KRQA 1LKPA 2V15A 2IY4A 3F32A 2G38B 1JKUA 1JI4A 3PZAA 4QUWA 4MKUA 2QF9A 4XKUA 2JD70 4AM4A 4OYNA 1DPSA 1DATA 3E6RA 1VJXA 4RC7A 4X0JA 1TKOA 3IQ1A 1RCEA 2V8UA 2WLUA 3JZAB 1JYBA 3GE4A 2WWXB 4WJG4 3PWQA 3O7RA 4CMYV 4LPMA 3E1PA 5FFCA 4RC6B 1JKVA 5D8PA 5CMQA 2V2IA 3WVWA 4EVEA 3F35A 3HIUA 4DZ0A 3QHCA 4Z3BA 2WLAA 2V8TA 4Z5SA 1YUZA 1ZS3A 2YJJA 2Y3QA 3QHBA 3D19A 5K52A 1OTKA 4R42A 2V2LA 2FL0A 1IERA 4MUDA 5D8RA 3ERZA 5IX6A 3IS7A 4ERUA 3KWOA 4TOEA 2JD60 1O9IA 4RC6A 4CVRA 1H96A 4CVTA 1NFVA 5JDOB 4TOGA 2CN6A 2UX1A 3WVUA 3BT5A 4II4A 4ZKHA 2XJNA 3EZUA 4CYAA 3VV9A 4LPJA 2JD80 3E1QA 2CHPA 2W0OA 4M34A 3OGHA 4REUA 2CWLA 1YV1A 2V2OA 3AJOA 2ZURX 5J9VA 5D8SA 5LG2A 2XGWA 3F34A 4DYXA 3FRSA 3DBYA 5HJHA 4ZKXA 4M33A 1NF4A 2CLBA 1JGCA 4ZKWA 4W4LB 3ES3A 4W4KB 3RGDA 2D5KA 2F7NA 4ISMA 4AM2A 1JTSA 3RBCA 3R2HA 3RD0A 5K53A 1VEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9R A;  1YUX A;  5I4J A;  3KX9 A;  1TJO A;  2ZG7 X;  3R2S A;  1S30 A;  2ITB A;  3R2K A;  1LKO A;  2V2R A;  2Z90 A;  4KVS A;  2ZA8 A;  2XJO A;  4IWK A;  1HRS A;  1BFR A;  4IXK A;  3VNX A;  5AXS A;  5HQO A;  2CLU A;  3AJP A;  2OC5 A;  4ITT A;  2PYB A;  2C2J A;  3U90 A;  3EGM A;  3IS8 A;  1UMN A;  3AF9 X;  5JAC A;  3SE1 A;  5FEJ A;  3QD8 A;  1XZ1 A;  5E2D A;  4ZLW A;  1AEW A;  3UNO A;  1VLG A;  2ZG8 X;  3KA8 A;  4DYY A;  3HL1 A;  2BK6 A;  4ETR A;  1RCC A;  4PGI A;  4DAS A;  3NP0 X;  1FHA A;  1XZ3 A;  4EVC A;  3PW8 A;  3Q4R A;  5JKL A;  1JIG A;  3E1J A;  2BKC A;  3KA4 A;  4XGS A;  3RAV A;  3BKN A;  3O7S A;  5LG8 A;  1Z4A A;  1L8I A;  1QGH A;  4E6K A;  4EVB A;  4II4 B;  5GU0 X;  3R2R A;  2VZB A;  4TOF A;  3Q4O A;  5CMR A;  4TOH A;  5J93 A;  4XKT A;  4TOA A;  4DYZ A;  3BVL A;  2C2U A;  3E1N A;  2HTN A;  1BCF A;  3AK8 A;  2C41 A;  4ZL5 A;  1VEQ A;  4TOD A;  3EZ0 A;  3PVR A;  4P18 A;  4ZL6 A;  2CEI A;  2FZF A;  4XKS A;  5FFB A;  2VXI A;  2FJC A;  2YW6 A;  3RE7 A;  5D8X A;  5J8W A;  1S2Z A;  1ZUJ A;  5E1U A;  4CVS A;  2Z5R A;  2G4H A;  3QB9 A;  3PWQ C;  1BG7 A;  2FHA A;  3KA9 A;  1RYT A;  3FSE A;  2XKQ A;  3UOI A;  3E1O A;  3Q4Q A;  2CN7 A;  4LQJ A;  4LYX A;  4LYU A;  3ISF A;  4LQH A;  4LQN A;  3GHQ A;  2WTL A;  2ZG9 X;  4MY7 A;  5JKM G;  5CZU A;  1UVH A;  3BVF A;  1NNQ A;  1S3Q A;  4TOC A;  2IB0 A;  3MPS A;  3AF8 X;  1DVB A;  3E2C A;  4ZMC A;  2GS4 A;  2FFX J;  3R2M A;  1L8H A;  5GN8 A;  1JRE A;  4ZTT A;  4ITW A;  4PG1 A;  3TA8 A;  3SID A;  5HJF A;  1J30 A;  3SHX A;  2HR5 A;  2V2J A;  5D8Y A;  2C2F A;  3H7G A;  2Z5P A;  3KXU A;  4PGK A;  2FKZ A;  1GWG A;  4ML5 A;  1Z6O A;  1Z6O M;  5D8Q A;  3QVD A;  5FFA A;  2XJM A;  2ZA6 A;  4TO9 A;  2Z6M A;  5GU2 X;  3PVY B;  1TK6 A;  3E1M A;  3NP2 X;  3PVT B;  5ERK A;  3BVI A;  3PWF A;  3KA3 A;  3BVE A;  1R03 A;  1F33 A;  4A25 A;  2QQY A;  3F36 A;  5GOU A;  4PG0 A;  4LQV A;  2V2P A;  2V2N A;  3ISE A;  3QZ3 A;  1RCG A;  3PVR B;  2C6R A;  1IES A;  3PVY A;  2IU2 A;  3PVT A;  3PW1 B;  3WNW A;  4ISP A;  4M32 A;  5GU3 X;  2YW7 A;  4RC8 A;  3NOZ X;  1LKM A;  3F38 A;  3KA6 A;  4DE6 A;  3FVB A;  2CHI A;  4U3G A;  3F39 A;  5JKM A;  3PW1 A;  1MFR A;  4M35 A;  1RCD A;  3A9Q A;  4DI0 A;  4CVP A;  2V2M A;  2RBD A;  3F37 A;  2BW1 A;  4CYB A;  3R2O A;  3R2L A;  4RC5 B;  2FG8 A;  1SOF A;  3PW8 C;  5LBH A;  5JKL G;  2BJY A;  4MJY A;  4DYU A;  2V2S A;  4ZJK A;  2YJK A;  3A68 A;  1TKP A;  3AJQ A;  2Z5Q A;  3T9J A;  4KVR A;  1N1Q A;  2CF7 A;  4CY9 A;  1JI5 A;  2ZA7 A;  5GN8 B;  5J8S A;  4MN9 A;  4RC5 A;  4AM5 A;  3WVV A;  3F33 A;  2GYQ A;  5FFD A;  2VXX A;  1EUM A;  3UOF A;  1QYB A;  1RCI A;  2X17 0;  5FFE A;  5ERJ A;  4CMY A;  4TW3 A;  2OH3 A;  3OJ5 A;  5GU1 X;  2CIH A;  1NF6 A;  3E1L A;  1B71 A;  1F30 A;  4YKH A;  3AK9 A;  3E6S A;  4LPN A;  3GVY A;  4Y08 A;  4TOB A;  5C6F A;  5D8O A;  4IWJ A;  2FG4 A;  3FI6 A;  3BVK A;  4KVQ A;  2GYD A;  1VEL A;  4RC7 B;  5LS9 A;  3SH6 A;  3Q4N A;  1SQ3 A;  4EVD A;  1LB3 A;  1MOJ A;  3AF7 X;  1KRQ A;  1LKP A;  2V15 A;  2IY4 A;  3F32 A;  1JKU A;  1JI4 A;  3PZA A;  4QUW A;  4MKU A;  2QF9 A;  4XKU A;  2JD7 0;  4AM4 A;  4OYN A;  1DPS A;  1DAT A;  3E6R A;  1VJX A;  4RC7 A;  1TKO A;  3IQ1 A;  1RCE A;  2WLU A;  1JYB A;  3GE4 A;  3PWQ A;  3O7R A;  4CMY V;  4LPM A;  3E1P A;  5FFC A;  4RC6 B;  1JKV A;  5D8P A;  5CMQ A;  2V2I A;  3WVW A;  4EVE A;  3F35 A;  3HIU A;  4DZ0 A;  3QHC A;  4Z3B A;  2WLA A;  4Z5S A;  1YUZ A;  1ZS3 A;  2YJJ A;  2Y3Q A;  3QHB A;  5K52 A;  1OTK A;  4R42 A;  2V2L A;  2FL0 A;  1IER A;  4MUD A;  5D8R A;  3ERZ A;  5IX6 A;  3IS7 A;  4ERU A;  3KWO A;  4TOE A;  2JD6 0;  1O9I A;  4RC6 A;  4CVR A;  1H96 A;  4CVT A;  1NFV A;  4TOG A;  2CN6 A;  2UX1 A;  3WVU A;  3BT5 A;  4II4 A;  4ZKH A;  2XJN A;  3EZU A;  4CYA A;  4LPJ A;  2JD8 0;  3E1Q A;  2CHP A;  2W0O A;  4M34 A;  3OGH A;  4REU A;  1YV1 A;  2V2O A;  3AJO A;  2ZUR X;  5J9V A;  5D8S A;  5LG2 A;  2XGW A;  3F34 A;  4DYX A;  5HJH A;  4ZKX A;  4M33 A;  1NF4 A;  2CLB A;  1JGC A;  4ZKW A;  3ES3 A;  3RGD A;  2D5K A;  2F7N A;  4ISM A;  4AM2 A;  1JTS A;  3RBC A;  3R2H A;  3RD0 A;  5K53 A;  1VEI A; 
#chains in the Genus database with same CATH topology
 1O9R A;  1YUX A;  5I4J A;  3KX9 A;  1TJO A;  2ZG7 X;  3R2S A;  4KXR B;  1S30 A;  2ITB A;  3R2K A;  1LKO A;  2V2R A;  2Z90 A;  4KVS A;  2MGY A;  2ZA8 A;  4E40 A;  2XJO A;  4IWK A;  1HRS A;  1BFR A;  2OKC A;  4IXK A;  3VNX A;  5AXS A;  4YVZ A;  5HQO A;  2CLU A;  3AJP A;  2OC5 A;  4ITT A;  2PYB A;  2C2J A;  3U90 A;  3EGM A;  3IS8 A;  1UMN A;  3AF9 X;  5JAC A;  3SE1 A;  5FEJ A;  3QD8 A;  1XZ1 A;  5E2D A;  4ZLW A;  3KDQ A;  1AEW A;  3UNO A;  1VLG A;  2ZG8 X;  3GGY A;  3KA8 A;  4DYY A;  3HL1 A;  2BK6 A;  4ETR A;  1RCC A;  4PGI A;  4DAS A;  3C1Y A;  3NP0 X;  1FHA A;  1XZ3 A;  4EVC A;  3PW8 A;  3Q4R A;  5JKL A;  1JIG A;  3E1J A;  2BKC A;  3KA4 A;  4XGS A;  3RAV A;  3BKN A;  3O7S A;  5LG8 A;  1Z4A A;  1L8I A;  1QGH A;  4E6K A;  4EVB A;  4II4 B;  5GU0 X;  3R2R A;  2VZB A;  4YXJ A;  4TOF A;  3Q4O A;  5CMR A;  4TOH A;  5J93 A;  4XKT A;  4TOA A;  4DYZ A;  3BVL A;  2C2U A;  3E1N A;  2HTN A;  1BCF A;  3AK8 A;  2C41 A;  4ZL5 A;  1VEQ A;  4TOD A;  3C21 A;  3EZ0 A;  3PVR A;  4P18 A;  4ZL6 A;  2CEI A;  2FZF A;  4XKS A;  5FFB A;  2VXI A;  2FJC A;  2YW6 A;  3RE7 A;  5D8X A;  5J8W A;  1S2Z A;  1ZUJ A;  5E1U A;  3VVA A;  4CVS A;  2Z5R A;  2G4H A;  3QB9 A;  3PWQ C;  1BG7 A;  2FHA A;  3KA9 A;  1RYT A;  3FSE A;  2XKQ A;  3UOI A;  3E1O A;  3Q4Q A;  4YXM A;  2CN7 A;  4LQJ A;  4LYX A;  4LYU A;  3ISF A;  4LQH A;  2Y44 A;  4LQN A;  3GHQ A;  2WTL A;  2ZG9 X;  4MY7 A;  3V3K B;  5JKM G;  5CZU A;  1UVH A;  3BVF A;  1NNQ A;  3C23 A;  1S3Q A;  4TOC A;  2IB0 A;  3MPS A;  3AF8 X;  1DVB A;  3E2C A;  4ZMC A;  2GS4 A;  2FFX J;  3R2M A;  1L8H A;  3KHK A;  5GN8 A;  1JRE A;  4ZTT A;  4ITW A;  4PG1 A;  3TA8 A;  3SID A;  5HJF A;  1J30 A;  3SHX A;  2HR5 A;  2V2J A;  5D8Y A;  2C2F A;  3H7G A;  2Z5P A;  3KXU A;  4PGK A;  2FKZ A;  1GWG A;  3L0M A;  4ML5 A;  1Z6O A;  1Z6O M;  5D8Q A;  3QVD A;  5FFA A;  2XJM A;  2ZA6 A;  4TO9 A;  2Z6M A;  5GU2 X;  3PVY B;  1TK6 A;  3E1M A;  3NP2 X;  3PVT B;  5ERK A;  3BVI A;  3PWF A;  3KA3 A;  3BVE A;  5HU6 D;  1R03 A;  1F33 A;  4A25 A;  2QQY A;  3F36 A;  5GOU A;  4PG0 A;  4LQV A;  2V2P A;  2V2N A;  3ISE A;  3QZ3 A;  1RCG A;  3PVR B;  2C6R A;  1IES A;  3PVY A;  2IU2 A;  4MXP A;  3PVT A;  3PW1 B;  3WNW A;  4ISP A;  4M32 A;  5GU3 X;  2YW7 A;  4RC8 A;  3NOZ X;  1LKM A;  3F38 A;  3W54 A;  3KA6 A;  4DE6 A;  3FVB A;  2CHI A;  4U3G A;  3F39 A;  5JKM A;  3PW1 A;  1MFR A;  4M35 A;  1RCD A;  3A9Q A;  4DI0 A;  3M6J A;  4CVP A;  2V2M A;  2RBD A;  3F37 A;  2BW1 A;  3LKD A;  4CYB A;  3R2O A;  3R2L A;  4RC5 B;  2FG8 A;  1SOF A;  3PW8 C;  5LBH A;  3N6O A;  5JKL G;  2BJY A;  4MJY A;  4DYU A;  2V2S A;  4ZJK A;  2YJK A;  3A68 A;  1TKP A;  3AJQ A;  2Z5Q A;  3T9J A;  5JDO A;  4KVR A;  1N1Q A;  2CF7 A;  3UFB A;  4CY9 A;  1JI5 A;  2ZA7 A;  5GN8 B;  5J8S A;  3GGZ A;  4MN9 A;  4RC5 A;  4AM5 A;  3WVV A;  3F33 A;  2GYQ A;  5FFD A;  2VXX A;  1EUM A;  3UOF A;  1QYB A;  1RCI A;  2X17 0;  5FFE A;  5ERJ A;  4CMY A;  4TW3 A;  2OH3 A;  3OJ5 A;  5GU1 X;  2CIH A;  1NF6 A;  2AR0 A;  3E1L A;  1B71 A;  1F30 A;  4YKH A;  3AK9 A;  3FRR A;  3E6S A;  3JZ9 A;  4LPN A;  3GVY A;  4Y08 A;  4TOB A;  5C6F A;  5D8O A;  4IWJ A;  2FG4 A;  3FI6 A;  3BVK A;  4KVQ A;  2GYD A;  1VEL A;  3C1Z A;  4RC7 B;  5LS9 A;  3SH6 A;  3Q4N A;  1SQ3 A;  4EVD A;  1LB3 A;  1MOJ A;  2N02 A;  3AF7 X;  1KRQ A;  1LKP A;  2V15 A;  2IY4 A;  3F32 A;  2G38 B;  1JKU A;  1JI4 A;  3PZA A;  4QUW A;  4MKU A;  2QF9 A;  4XKU A;  2JD7 0;  4AM4 A;  4OYN A;  1DPS A;  1DAT A;  3E6R A;  1VJX A;  4RC7 A;  4X0J A;  1TKO A;  3IQ1 A;  1RCE A;  2V8U A;  2WLU A;  3JZA B;  1JYB A;  3GE4 A;  2WWX B;  4WJG 4;  3PWQ A;  3O7R A;  4CMY V;  4LPM A;  3E1P A;  5FFC A;  4RC6 B;  1JKV A;  5D8P A;  5CMQ A;  2V2I A;  3WVW A;  4EVE A;  3F35 A;  3HIU A;  4DZ0 A;  3QHC A;  4Z3B A;  2WLA A;  2V8T A;  4Z5S A;  1YUZ A;  1ZS3 A;  2YJJ A;  2Y3Q A;  3QHB A;  3D19 A;  5K52 A;  1OTK A;  4R42 A;  2V2L A;  2FL0 A;  1IER A;  4MUD A;  5D8R A;  3ERZ A;  5IX6 A;  3IS7 A;  4ERU A;  3KWO A;  4TOE A;  2JD6 0;  1O9I A;  4RC6 A;  4CVR A;  1H96 A;  4CVT A;  1NFV A;  5JDO B;  4TOG A;  2CN6 A;  2UX1 A;  3WVU A;  3BT5 A;  4II4 A;  4ZKH A;  2XJN A;  3EZU A;  4CYA A;  3VV9 A;  4LPJ A;  2JD8 0;  3E1Q A;  2CHP A;  2W0O A;  4M34 A;  3OGH A;  4REU A;  2CWL A;  1YV1 A;  2V2O A;  3AJO A;  2ZUR X;  5J9V A;  5D8S A;  5LG2 A;  2XGW A;  3F34 A;  4DYX A;  3FRS A;  3DBY A;  5HJH A;  4ZKX A;  4M33 A;  1NF4 A;  2CLB A;  1JGC A;  4ZKW A;  4W4L B;  3ES3 A;  4W4K B;  3RGD A;  2D5K A;  2F7N A;  4ISM A;  4AM2 A;  1JTS A;  3RBC A;  3R2H A;  3RD0 A;  5K53 A;  1VEI A; 
#chains in the Genus database with same CATH homology
 1O9R A;  1YUX A;  5I4J A;  3KX9 A;  1TJO A;  2ZG7 X;  3R2S A;  4KXR B;  1S30 A;  2ITB A;  3R2K A;  1LKO A;  2V2R A;  2Z90 A;  4KVS A;  2MGY A;  2ZA8 A;  4E40 A;  2XJO A;  4IWK A;  1HRS A;  1BFR A;  2OKC A;  4IXK A;  3VNX A;  5AXS A;  4YVZ A;  5HQO A;  2CLU A;  3AJP A;  2OC5 A;  4ITT A;  2PYB A;  2C2J A;  3U90 A;  3EGM A;  3IS8 A;  1UMN A;  3AF9 X;  5JAC A;  3SE1 A;  5FEJ A;  3QD8 A;  1XZ1 A;  5E2D A;  4ZLW A;  3KDQ A;  1AEW A;  3UNO A;  1VLG A;  2ZG8 X;  3GGY A;  3KA8 A;  4DYY A;  3HL1 A;  2BK6 A;  4ETR A;  1RCC A;  4PGI A;  4DAS A;  3C1Y A;  3NP0 X;  1FHA A;  1XZ3 A;  4EVC A;  3PW8 A;  3Q4R A;  5JKL A;  1JIG A;  3E1J A;  2BKC A;  3KA4 A;  4XGS A;  3RAV A;  3BKN A;  3O7S A;  5LG8 A;  1Z4A A;  1L8I A;  1QGH A;  4E6K A;  4EVB A;  4II4 B;  5GU0 X;  3R2R A;  2VZB A;  4YXJ A;  4TOF A;  3Q4O A;  5CMR A;  4TOH A;  5J93 A;  4XKT A;  4TOA A;  4DYZ A;  3BVL A;  2C2U A;  3E1N A;  2HTN A;  1BCF A;  3AK8 A;  2C41 A;  4ZL5 A;  1VEQ A;  4TOD A;  3C21 A;  3EZ0 A;  3PVR A;  4P18 A;  4ZL6 A;  2CEI A;  2FZF A;  4XKS A;  5FFB A;  2VXI A;  2FJC A;  2YW6 A;  3RE7 A;  5D8X A;  5J8W A;  1S2Z A;  1ZUJ A;  5E1U A;  3VVA A;  4CVS A;  2Z5R A;  2G4H A;  3QB9 A;  3PWQ C;  1BG7 A;  2FHA A;  3KA9 A;  1RYT A;  3FSE A;  2XKQ A;  3UOI A;  3E1O A;  3Q4Q A;  4YXM A;  2CN7 A;  4LQJ A;  4LYX A;  4LYU A;  3ISF A;  4LQH A;  2Y44 A;  4LQN A;  3GHQ A;  2WTL A;  2ZG9 X;  4MY7 A;  3V3K B;  5JKM G;  5CZU A;  1UVH A;  3BVF A;  1NNQ A;  3C23 A;  1S3Q A;  4TOC A;  2IB0 A;  3MPS A;  3AF8 X;  1DVB A;  3E2C A;  4ZMC A;  2GS4 A;  2FFX J;  3R2M A;  1L8H A;  3KHK A;  5GN8 A;  1JRE A;  4ZTT A;  4ITW A;  4PG1 A;  3TA8 A;  3SID A;  5HJF A;  1J30 A;  3SHX A;  2HR5 A;  2V2J A;  5D8Y A;  2C2F A;  3H7G A;  2Z5P A;  3KXU A;  4PGK A;  2FKZ A;  1GWG A;  3L0M A;  4ML5 A;  1Z6O A;  1Z6O M;  5D8Q A;  3QVD A;  5FFA A;  2XJM A;  2ZA6 A;  4TO9 A;  2Z6M A;  5GU2 X;  3PVY B;  1TK6 A;  3E1M A;  3NP2 X;  3PVT B;  5ERK A;  3BVI A;  3PWF A;  3KA3 A;  3BVE A;  5HU6 D;  1R03 A;  1F33 A;  4A25 A;  2QQY A;  3F36 A;  5GOU A;  4PG0 A;  4LQV A;  2V2P A;  2V2N A;  3ISE A;  3QZ3 A;  1RCG A;  3PVR B;  2C6R A;  1IES A;  3PVY A;  2IU2 A;  4MXP A;  3PVT A;  3PW1 B;  3WNW A;  4ISP A;  4M32 A;  5GU3 X;  2YW7 A;  4RC8 A;  3NOZ X;  1LKM A;  3F38 A;  3W54 A;  3KA6 A;  4DE6 A;  3FVB A;  2CHI A;  4U3G A;  3F39 A;  5JKM A;  3PW1 A;  1MFR A;  4M35 A;  1RCD A;  3A9Q A;  4DI0 A;  3M6J A;  4CVP A;  2V2M A;  2RBD A;  3F37 A;  2BW1 A;  3LKD A;  4CYB A;  3R2O A;  3R2L A;  4RC5 B;  2FG8 A;  1SOF A;  3PW8 C;  5LBH A;  3N6O A;  5JKL G;  2BJY A;  4MJY A;  4DYU A;  2V2S A;  4ZJK A;  2YJK A;  3A68 A;  1TKP A;  3AJQ A;  2Z5Q A;  3T9J A;  5JDO A;  4KVR A;  1N1Q A;  2CF7 A;  3UFB A;  4CY9 A;  1JI5 A;  2ZA7 A;  5GN8 B;  5J8S A;  3GGZ A;  4MN9 A;  4RC5 A;  4AM5 A;  3WVV A;  3F33 A;  2GYQ A;  5FFD A;  2VXX A;  1EUM A;  3UOF A;  1QYB A;  1RCI A;  2X17 0;  5FFE A;  5ERJ A;  4CMY A;  4TW3 A;  2OH3 A;  3OJ5 A;  5GU1 X;  2CIH A;  1NF6 A;  2AR0 A;  3E1L A;  1B71 A;  1F30 A;  4YKH A;  3AK9 A;  3FRR A;  3E6S A;  3JZ9 A;  4LPN A;  3GVY A;  4Y08 A;  4TOB A;  5C6F A;  5D8O A;  4IWJ A;  2FG4 A;  3FI6 A;  3BVK A;  4KVQ A;  2GYD A;  1VEL A;  3C1Z A;  4RC7 B;  5LS9 A;  3SH6 A;  3Q4N A;  1SQ3 A;  4EVD A;  1LB3 A;  1MOJ A;  2N02 A;  3AF7 X;  1KRQ A;  1LKP A;  2V15 A;  2IY4 A;  3F32 A;  2G38 B;  1JKU A;  1JI4 A;  3PZA A;  4QUW A;  4MKU A;  2QF9 A;  4XKU A;  2JD7 0;  4AM4 A;  4OYN A;  1DPS A;  1DAT A;  3E6R A;  1VJX A;  4RC7 A;  4X0J A;  1TKO A;  3IQ1 A;  1RCE A;  2V8U A;  2WLU A;  3JZA B;  1JYB A;  3GE4 A;  2WWX B;  4WJG 4;  3PWQ A;  3O7R A;  4CMY V;  4LPM A;  3E1P A;  5FFC A;  4RC6 B;  1JKV A;  5D8P A;  5CMQ A;  2V2I A;  3WVW A;  4EVE A;  3F35 A;  3HIU A;  4DZ0 A;  3QHC A;  4Z3B A;  2WLA A;  2V8T A;  4Z5S A;  1YUZ A;  1ZS3 A;  2YJJ A;  2Y3Q A;  3QHB A;  3D19 A;  5K52 A;  1OTK A;  4R42 A;  2V2L A;  2FL0 A;  1IER A;  4MUD A;  5D8R A;  3ERZ A;  5IX6 A;  3IS7 A;  4ERU A;  3KWO A;  4TOE A;  2JD6 0;  1O9I A;  4RC6 A;  4CVR A;  1H96 A;  4CVT A;  1NFV A;  5JDO B;  4TOG A;  2CN6 A;  2UX1 A;  3WVU A;  3BT5 A;  4II4 A;  4ZKH A;  2XJN A;  3EZU A;  4CYA A;  3VV9 A;  4LPJ A;  2JD8 0;  3E1Q A;  2CHP A;  2W0O A;  4M34 A;  3OGH A;  4REU A;  2CWL A;  1YV1 A;  2V2O A;  3AJO A;  2ZUR X;  5J9V A;  5D8S A;  5LG2 A;  2XGW A;  3F34 A;  4DYX A;  3FRS A;  3DBY A;  5HJH A;  4ZKX A;  4M33 A;  1NF4 A;  2CLB A;  1JGC A;  4ZKW A;  4W4L B;  3ES3 A;  4W4K B;  3RGD A;  2D5K A;  2F7N A;  4ISM A;  4AM2 A;  1JTS A;  3RBC A;  3R2H A;  3RD0 A;  5K53 A;  1VEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...