1QGHA

The x-ray structure of the unusual dodecameric ferritin from listeria innocua, reveals a novel intersubunit iron binding site.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
150
structure length
150
Chain Sequence
VDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTLELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords NON-HEME IRON-CONTAINING FERRITIN
publication title The dodecameric ferritin from Listeria innocua contains a novel intersubunit iron-binding site.
pubmed doi rcsb
total genus 65
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 1999-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1qghA00
4ZKXA 4DYYA 3WVWA 3E6RA 4CVSA 1XZ3A 4DI0A 1MFRA 4II4A 2ZG7X 3WVUA 4AM5A 2ZA7A 3F32A 3R2HA 3AJPA 5CZUA 3QVDA 5J8SA 3OGHA 3O7SA 4PG1A 4TO9A 3F36A 4TOBA 2ZG8X 3E1NA 3KXUA 4ITWA 2V2NA 1N1QA 3F34A 2Y3QA 3WVVA 1HRSA 1TJOA 3GVYA 5K53A 3QHBA 5D8RA 3GE4A 3PW1A 4R42A 1YUZA 4KVQA 4CMYV 4PGIA 4RC7A 5JKMG 5LG8A 2ZA8A 3E1LA 3ERZA 3F39A 1Z6OA 3E6SA 3F37A 4ZLWA 5D8OA 2XKQA 1RYTA 3E2CA 2XJNA 2BJYA 1JKVA 4IWJA 4TOGA 1BCFA 2BKCA 3H7GA 4YKHA 1KRQA 1B71A 1O9IA 1RCDA 1IESA 4CYBA 2G4HA 3NOZX 4LPJA 2HTNA 2Z5QA 2Z90A 2QQYA 2WLUA 4LQHA 4DASA 4XKSA 2Z5PA 4DZ0A 3R2OA 3R2KA 2C6RA 4CVRA 4LPNA 2VXXA 4RC6B 4ETRA 3RE7A 3GHQA 4KVRA 5D8XA 3PW8A 3E1PA 4LYXA 2XGWA 1S3QA 3UOIA 2FL0A 4PG0A 1TK6A 1LB3A 5CMQA 1JI5A 1MOJA 3HL1A 3BVLA 1ZUJA 2FKZA 2YW6A 1F33A 1JIGA 3KA9A 1JTSA 2PYBA 2C2UA 3ISFA 5GOUA 3F35A 1RCCA 2RBDA 2V2RA 3E1QA 4IXKA 2JD60 1BFRA 4DYXA 3BVFA 5ERJA 5JKMA 4LQVA 2OC5A 3NP2X 4IWKA 2V2PA 4ML5A 5GU2X 4M33A 3F33A 2IB0A 4MY7A 5HJHA 5J9VA 2CF7A 3PZAA 2XJMA 5FFEA 3KA6A 4ZMCA 1YV1A 1JYBA 3EZUA 2VZBA 2F7NA 4TW3A 3U90A 5JKLG 4ITTA 3R2RA 5GN8B 3TA8A 4RC6A 4ISMA 1LKPA 4RC5B 3SHXA 2ZA6A 4A25A 4TOFA 1DATA 2V2JA 3QB9A 1GWGA 2CIHA 1RCEA 3AF8X 1NF4A 3SE1A 2V2IA 1VEQA 3KWOA 1NFVA 2YJJA 3PVYB 3NP0X 1S2ZA 1YUXA 3QZ3A 5LBHA 2V2MA 1O9RA 2BW1A 3Q4RA 2CN6A 4CVTA 1RCGA 2ZURX 4DE6A 2V2SA 4ZKHA 3WNWA 2FG8A 3F38A 3FVBA 5LG2A 1J30A 1F30A 4AM4A 3KX9A 1Z6OM 3OJ5A 3E1MA 4XKTA 1L8HA 1DPSA 2C41A 4EVDA 5GU1X 1Z4AA 2CEIA 3E1OA 5GN8A 2W0OA 2YW7A 4PGKA 3RAVA 1UMNA 4P18A 3PWFA 2X170 1LKMA 3AK9A 4QUWA 4RC5A 2Z5RA 4CYAA 4M32A 5JKLA 3IS8A 4ZKWA 1SOFA 1JREA 2CHIA 3BKNA 4Z3BA 1ZS3A 5D8SA 2WTLA 5JACA 5I4JA 1VLGA 2D5KA 4EVEA 5CMRA 2Z6MA 3PVYA 3SIDA 2BK6A 4DYZA 1JGCA 4XKUA 2V2LA 1JKUA 5C6FA 5D8YA 2V2OA 3PVTB 4RC7B 2ITBA 3FI6A 1XZ1A 3AJQA 3VNXA 5E2DA 1TKPA 3UNOA 3EZ0A 4MUDA 3R2SA 5LS9A 3KA8A 3UOFA 3AF7X 4MJYA 1AEWA 2FHAA 4EVCA 2V15A 1JI4A 3Q4OA 4XGSA 5GU3X 3A9QA 3R2MA 2XJOA 4KVSA 1RCIA 3PVRB 3T9JA 3ISEA 5IX6A 3KA3A 4TOHA 5FFAA 1DVBA 1VELA 4CVPA 1SQ3A 5FFDA 4ISPA 4TOCA 5ERKA 1R03A 3RD0A 3FSEA 5HJFA 2C2FA 4RC8A 5J93A 3AJOA 5D8QA 1H96A 4ZTTA 5FFCA 3BVKA 5AXSA 4E6KA 5K52A 3KA4A 2JD80 4LQJA 3ES3A 4TODA 3RBCA 3Q4QA 4Z5SA 2FJCA 3PVTA 2WLAA 2YJKA 5D8PA 4TOEA 2GYQA 4M34A 4CMYA 5HQOA 1UVHA 1BG7A 1EUMA 2FZFA 3AF9X 4ZJKA 3EGMA 1S30A 2JD70 5FEJA 2IU2A 3HIUA 4OYNA 5J8WA 3BVEA 3PVRA 4MN9A 4II4B 3BVIA 4U3GA 3MPSA 2CHPA 2GS4A 3QD8A 4ZL6A 3E1JA 1NF6A 2IY4A 3PW8C 3SH6A 4ZL5A 3QHCA 3PWQC 1LKOA 2C2JA 4CY9A 4LPMA 4M35A 2CLBA 3R2LA 4REUA 3RGDA 3PWQA 1FHAA 1QGHA 3IS7A 4LQNA 2OH3A 4DYUA 1OTKA 1VJXA 3PW1B 2CLUA 1VEIA 5E1UA 2HR5A 4MKUA 4ERUA 3BT5A 1TKOA 4Y08A 2ZG9X 3IQ1A 2FFXJ 3A68A 1QYBA 2UX1A 1IERA 2QF9A 3O7RA 3AK8A 4TOAA 5GU0X 1NNQA 2VXIA 1L8IA 2GYDA 4AM2A 3Q4NA 2CN7A 4LYUA 5FFBA 2FG4A 4EVBA
chains in the Genus database with same CATH superfamily
4ZKXA 4DYYA 3WVWA 3E6RA 4CVSA 1XZ3A 4DI0A 1MFRA 4II4A 2ZG7X 3WVUA 4AM5A 2ZA7A 3F32A 3R2HA 3AJPA 5CZUA 3QVDA 5J8SA 3OGHA 3O7SA 4PG1A 4TO9A 3F36A 4TOBA 2ZG8X 3E1NA 3KXUA 4ITWA 4YVZA 2V2NA 1N1QA 3F34A 2Y3QA 4W4KB 3WVVA 1HRSA 1TJOA 3GVYA 5K53A 3QHBA 5D8RA 3GE4A 3PW1A 4R42A 1YUZA 4KVQA 2V8TA 4CMYV 4PGIA 4RC7A 5JKMG 5LG8A 2ZA8A 3E1LA 3ERZA 3F39A 1Z6OA 3E6SA 3F37A 4ZLWA 5D8OA 2XKQA 1RYTA 3E2CA 2XJNA 2BJYA 1JKVA 4IWJA 3GGYA 4TOGA 1BCFA 2BKCA 3H7GA 4YKHA 1KRQA 1B71A 1O9IA 1RCDA 1IESA 2AR0A 4CYBA 2G4HA 3NOZX 4LPJA 2HTNA 2Z5QA 2Z90A 2QQYA 2WLUA 4LQHA 4DASA 4XKSA 2Z5PA 4DZ0A 3R2OA 3R2KA 2C6RA 4CVRA 4LPNA 2VXXA 4RC6B 4ETRA 3RE7A 3GHQA 4KVRA 5D8XA 4KXRB 3PW8A 3E1PA 4LYXA 2XGWA 1S3QA 3UOIA 2FL0A 4PG0A 1TK6A 1LB3A 4YXJA 2OKCA 5CMQA 1JI5A 1MOJA 3HL1A 3BVLA 1ZUJA 2FKZA 2YW6A 1F33A 1JIGA 3KA9A 3VVAA 1JTSA 2PYBA 2C2UA 3ISFA 5GOUA 3F35A 1RCCA 2RBDA 2V2RA 3E1QA 4IXKA 2JD60 1BFRA 4DYXA 3BVFA 5ERJA 5JKMA 4LQVA 2OC5A 3NP2X 4IWKA 3M6JA 2V2PA 3GGZA 4ML5A 5GU2X 4M33A 3F33A 2IB0A 4MY7A 3V3KB 2MGYA 5HJHA 5J9VA 2CF7A 3PZAA 3C23A 2XJMA 5FFEA 3KA6A 4ZMCA 2N02A 1YV1A 1JYBA 3EZUA 2VZBA 2F7NA 4TW3A 3U90A 5JKLG 4ITTA 3R2RA 5GN8B 3TA8A 4RC6A 5HU6D 4ISMA 1LKPA 4RC5B 3SHXA 2ZA6A 3JZ9A 4A25A 4TOFA 1DATA 4W4LB 2V2JA 3QB9A 1GWGA 2CIHA 1RCEA 3AF8X 3DBYA 1NF4A 3SE1A 2V2IA 1VEQA 3KWOA 1NFVA 2G38B 2YJJA 3PVYB 3NP0X 3FRRA 1S2ZA 1YUXA 3N6OA 3QZ3A 5LBHA 2V2MA 1O9RA 2BW1A 3Q4RA 2CN6A 4CVTA 1RCGA 2ZURX 4DE6A 2V2SA 4ZKHA 3WNWA 2FG8A 3F38A 3FVBA 5LG2A 3UFBA 1J30A 1F30A 4AM4A 3KX9A 1Z6OM 3D19A 4X0JA 3OJ5A 3E1MA 4XKTA 1L8HA 1DPSA 2C41A 4EVDA 5GU1X 1Z4AA 2CEIA 3E1OA 5GN8A 2W0OA 2YW7A 3C1YA 4PGKA 3RAVA 1UMNA 4P18A 3PWFA 2X170 1LKMA 3AK9A 4QUWA 4RC5A 2Z5RA 4CYAA 3C21A 4M32A 5JKLA 3IS8A 4ZKWA 1SOFA 1JREA 2CHIA 3BKNA 4Z3BA 1ZS3A 5D8SA 2WTLA 5JACA 5I4JA 1VLGA 2D5KA 4EVEA 5CMRA 2Z6MA 3PVYA 3SIDA 2BK6A 4DYZA 1JGCA 4XKUA 2V2LA 1JKUA 3LKDA 5C6FA 5D8YA 3KHKA 2V2OA 3PVTB 4RC7B 2ITBA 3FI6A 1XZ1A 3AJQA 3L0MA 3VNXA 5E2DA 1TKPA 3UNOA 3EZ0A 2V8UA 4MUDA 3R2SA 2Y44A 5LS9A 3KA8A 3UOFA 3AF7X 4MJYA 1AEWA 2FHAA 4EVCA 2V15A 1JI4A 3Q4OA 4XGSA 5GU3X 3A9QA 5JDOB 3R2MA 2XJOA 4KVSA 1RCIA 3PVRB 3FRSA 3T9JA 3W54A 3ISEA 3KDQA 3VV9A 5IX6A 3KA3A 4TOHA 4MXPA 5FFAA 1DVBA 1VELA 4CVPA 1SQ3A 5FFDA 4ISPA 4E40A 4TOCA 5ERKA 1R03A 3RD0A 3FSEA 5HJFA 2C2FA 4RC8A 5J93A 3AJOA 5D8QA 1H96A 3C1ZA 4ZTTA 5FFCA 3BVKA 5AXSA 4E6KA 5K52A 3KA4A 2JD80 4LQJA 3ES3A 4TODA 3RBCA 3Q4QA 4Z5SA 2FJCA 3PVTA 2WLAA 2YJKA 5D8PA 4TOEA 2GYQA 4M34A 4CMYA 5HQOA 1UVHA 1BG7A 1EUMA 2FZFA 3AF9X 4ZJKA 3EGMA 1S30A 2JD70 5FEJA 2IU2A 3HIUA 4OYNA 5J8WA 5JDOA 3BVEA 3PVRA 4MN9A 4II4B 3BVIA 4U3GA 3MPSA 2CHPA 2GS4A 3QD8A 4ZL6A 3E1JA 1NF6A 2IY4A 3PW8C 3SH6A 4ZL5A 3JZAB 3QHCA 3PWQC 1LKOA 2C2JA 4CY9A 4LPMA 4M35A 2CLBA 3R2LA 4REUA 3RGDA 3PWQA 1FHAA 1QGHA 3IS7A 4LQNA 2OH3A 4DYUA 1OTKA 1VJXA 3PW1B 2CLUA 1VEIA 2WWXB 5E1UA 2HR5A 4MKUA 4YXMA 4ERUA 3BT5A 1TKOA 4Y08A 2ZG9X 3IQ1A 2FFXJ 3A68A 1QYBA 2UX1A 1IERA 2QF9A 3O7RA 3AK8A 4TOAA 5GU0X 2CWLA 1NNQA 2VXIA 1L8IA 2GYDA 4AM2A 3Q4NA 2CN7A 4WJG4 4LYUA 5FFBA 2FG4A 4EVBA
chains in the Genus database with same CATH topology
4ZKXA 4DYYA 3WVWA 3E6RA 4CVSA 1XZ3A 4DI0A 1MFRA 4II4A 2ZG7X 3WVUA 4AM5A 2ZA7A 3F32A 3R2HA 3AJPA 5CZUA 3QVDA 5J8SA 3OGHA 3O7SA 4PG1A 4TO9A 3F36A 4TOBA 2ZG8X 3E1NA 3KXUA 4ITWA 4YVZA 2V2NA 1N1QA 3F34A 2Y3QA 4W4KB 3WVVA 1HRSA 1TJOA 3GVYA 5K53A 3QHBA 5D8RA 3GE4A 3PW1A 4R42A 1YUZA 4KVQA 2V8TA 4CMYV 4PGIA 4RC7A 5JKMG 5LG8A 2ZA8A 3E1LA 3ERZA 3F39A 1Z6OA 3E6SA 3F37A 4ZLWA 5D8OA 2XKQA 1RYTA 3E2CA 2XJNA 2BJYA 1JKVA 4IWJA 3GGYA 4TOGA 1BCFA 2BKCA 3H7GA 4YKHA 1KRQA 1B71A 1O9IA 1RCDA 1IESA 2AR0A 4CYBA 2G4HA 3NOZX 4LPJA 2HTNA 2Z5QA 2Z90A 2QQYA 2WLUA 4LQHA 4DASA 4XKSA 2Z5PA 4DZ0A 3R2OA 3R2KA 2C6RA 4CVRA 4LPNA 2VXXA 4RC6B 4ETRA 3RE7A 3GHQA 4KVRA 5D8XA 4KXRB 3PW8A 3E1PA 4LYXA 2XGWA 1S3QA 3UOIA 2FL0A 4PG0A 1TK6A 1LB3A 4YXJA 2OKCA 5CMQA 1JI5A 1MOJA 3HL1A 3BVLA 1ZUJA 2FKZA 2YW6A 1F33A 1JIGA 3KA9A 3VVAA 1JTSA 2PYBA 2C2UA 3ISFA 5GOUA 3F35A 1RCCA 2RBDA 2V2RA 3E1QA 4IXKA 2JD60 1BFRA 4DYXA 3BVFA 5ERJA 5JKMA 4LQVA 2OC5A 3NP2X 4IWKA 3M6JA 2V2PA 3GGZA 4ML5A 5GU2X 4M33A 3F33A 2IB0A 4MY7A 3V3KB 2MGYA 5HJHA 5J9VA 2CF7A 3PZAA 3C23A 2XJMA 5FFEA 3KA6A 4ZMCA 2N02A 1YV1A 1JYBA 3EZUA 2VZBA 2F7NA 4TW3A 3U90A 5JKLG 4ITTA 3R2RA 5GN8B 3TA8A 4RC6A 5HU6D 4ISMA 1LKPA 4RC5B 3SHXA 2ZA6A 3JZ9A 4A25A 4TOFA 1DATA 4W4LB 2V2JA 3QB9A 1GWGA 2CIHA 1RCEA 3AF8X 3DBYA 1NF4A 3SE1A 2V2IA 1VEQA 3KWOA 1NFVA 2G38B 2YJJA 3PVYB 3NP0X 3FRRA 1S2ZA 1YUXA 3N6OA 3QZ3A 5LBHA 2V2MA 1O9RA 2BW1A 3Q4RA 2CN6A 4CVTA 1RCGA 2ZURX 4DE6A 2V2SA 4ZKHA 3WNWA 2FG8A 3F38A 3FVBA 5LG2A 3UFBA 1J30A 1F30A 4AM4A 3KX9A 1Z6OM 3D19A 4X0JA 3OJ5A 3E1MA 4XKTA 1L8HA 1DPSA 2C41A 4EVDA 5GU1X 1Z4AA 2CEIA 3E1OA 5GN8A 2W0OA 2YW7A 3C1YA 4PGKA 3RAVA 1UMNA 4P18A 3PWFA 2X170 1LKMA 3AK9A 4QUWA 4RC5A 2Z5RA 4CYAA 3C21A 4M32A 5JKLA 3IS8A 4ZKWA 1SOFA 1JREA 2CHIA 3BKNA 4Z3BA 1ZS3A 5D8SA 2WTLA 5JACA 5I4JA 1VLGA 2D5KA 4EVEA 5CMRA 2Z6MA 3PVYA 3SIDA 2BK6A 4DYZA 1JGCA 4XKUA 2V2LA 1JKUA 3LKDA 5C6FA 5D8YA 3KHKA 2V2OA 3PVTB 4RC7B 2ITBA 3FI6A 1XZ1A 3AJQA 3L0MA 3VNXA 5E2DA 1TKPA 3UNOA 3EZ0A 2V8UA 4MUDA 3R2SA 2Y44A 5LS9A 3KA8A 3UOFA 3AF7X 4MJYA 1AEWA 2FHAA 4EVCA 2V15A 1JI4A 3Q4OA 4XGSA 5GU3X 3A9QA 5JDOB 3R2MA 2XJOA 4KVSA 1RCIA 3PVRB 3FRSA 3T9JA 3W54A 3ISEA 3KDQA 3VV9A 5IX6A 3KA3A 4TOHA 4MXPA 5FFAA 1DVBA 1VELA 4CVPA 1SQ3A 5FFDA 4ISPA 4E40A 4TOCA 5ERKA 1R03A 3RD0A 3FSEA 5HJFA 2C2FA 4RC8A 5J93A 3AJOA 5D8QA 1H96A 3C1ZA 4ZTTA 5FFCA 3BVKA 5AXSA 4E6KA 5K52A 3KA4A 2JD80 4LQJA 3ES3A 4TODA 3RBCA 3Q4QA 4Z5SA 2FJCA 3PVTA 2WLAA 2YJKA 5D8PA 4TOEA 2GYQA 4M34A 4CMYA 5HQOA 1UVHA 1BG7A 1EUMA 2FZFA 3AF9X 4ZJKA 3EGMA 1S30A 2JD70 5FEJA 2IU2A 3HIUA 4OYNA 5J8WA 5JDOA 3BVEA 3PVRA 4MN9A 4II4B 3BVIA 4U3GA 3MPSA 2CHPA 2GS4A 3QD8A 4ZL6A 3E1JA 1NF6A 2IY4A 3PW8C 3SH6A 4ZL5A 3JZAB 3QHCA 3PWQC 1LKOA 2C2JA 4CY9A 4LPMA 4M35A 2CLBA 3R2LA 4REUA 3RGDA 3PWQA 1FHAA 1QGHA 3IS7A 4LQNA 2OH3A 4DYUA 1OTKA 1VJXA 3PW1B 2CLUA 1VEIA 2WWXB 5E1UA 2HR5A 4MKUA 4YXMA 4ERUA 3BT5A 1TKOA 4Y08A 2ZG9X 3IQ1A 2FFXJ 3A68A 1QYBA 2UX1A 1IERA 2QF9A 3O7RA 3AK8A 4TOAA 5GU0X 2CWLA 1NNQA 2VXIA 1L8IA 2GYDA 4AM2A 3Q4NA 2CN7A 4WJG4 4LYUA 5FFBA 2FG4A 4EVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKX A;  4DYY A;  3WVW A;  3E6R A;  4CVS A;  1XZ3 A;  4DI0 A;  1MFR A;  4II4 A;  2ZG7 X;  3WVU A;  4AM5 A;  2ZA7 A;  3F32 A;  3R2H A;  3AJP A;  5CZU A;  3QVD A;  5J8S A;  3OGH A;  3O7S A;  4PG1 A;  4TO9 A;  3F36 A;  4TOB A;  2ZG8 X;  3E1N A;  3KXU A;  4ITW A;  2V2N A;  1N1Q A;  3F34 A;  2Y3Q A;  3WVV A;  1HRS A;  1TJO A;  3GVY A;  5K53 A;  3QHB A;  5D8R A;  3GE4 A;  3PW1 A;  4R42 A;  1YUZ A;  4KVQ A;  4CMY V;  4PGI A;  4RC7 A;  5JKM G;  5LG8 A;  2ZA8 A;  3E1L A;  3ERZ A;  3F39 A;  1Z6O A;  3E6S A;  3F37 A;  4ZLW A;  5D8O A;  2XKQ A;  1RYT A;  3E2C A;  2XJN A;  2BJY A;  1JKV A;  4IWJ A;  4TOG A;  1BCF A;  2BKC A;  3H7G A;  4YKH A;  1KRQ A;  1B71 A;  1O9I A;  1RCD A;  1IES A;  4CYB A;  2G4H A;  3NOZ X;  4LPJ A;  2HTN A;  2Z5Q A;  2Z90 A;  2QQY A;  2WLU A;  4LQH A;  4DAS A;  4XKS A;  2Z5P A;  4DZ0 A;  3R2O A;  3R2K A;  2C6R A;  4CVR A;  4LPN A;  2VXX A;  4RC6 B;  4ETR A;  3RE7 A;  3GHQ A;  4KVR A;  5D8X A;  3PW8 A;  3E1P A;  4LYX A;  2XGW A;  1S3Q A;  3UOI A;  2FL0 A;  4PG0 A;  1TK6 A;  1LB3 A;  5CMQ A;  1JI5 A;  1MOJ A;  3HL1 A;  3BVL A;  1ZUJ A;  2FKZ A;  2YW6 A;  1F33 A;  1JIG A;  3KA9 A;  1JTS A;  2PYB A;  2C2U A;  3ISF A;  5GOU A;  3F35 A;  1RCC A;  2RBD A;  2V2R A;  3E1Q A;  4IXK A;  2JD6 0;  1BFR A;  4DYX A;  3BVF A;  5ERJ A;  5JKM A;  4LQV A;  2OC5 A;  3NP2 X;  4IWK A;  2V2P A;  4ML5 A;  5GU2 X;  4M33 A;  3F33 A;  2IB0 A;  4MY7 A;  5HJH A;  5J9V A;  2CF7 A;  3PZA A;  2XJM A;  5FFE A;  3KA6 A;  4ZMC A;  1YV1 A;  1JYB A;  3EZU A;  2VZB A;  2F7N A;  4TW3 A;  3U90 A;  5JKL G;  4ITT A;  3R2R A;  5GN8 B;  3TA8 A;  4RC6 A;  4ISM A;  1LKP A;  4RC5 B;  3SHX A;  2ZA6 A;  4A25 A;  4TOF A;  1DAT A;  2V2J A;  3QB9 A;  1GWG A;  2CIH A;  1RCE A;  3AF8 X;  1NF4 A;  3SE1 A;  2V2I A;  1VEQ A;  3KWO A;  1NFV A;  2YJJ A;  3PVY B;  3NP0 X;  1S2Z A;  1YUX A;  3QZ3 A;  5LBH A;  2V2M A;  1O9R A;  2BW1 A;  3Q4R A;  2CN6 A;  4CVT A;  1RCG A;  2ZUR X;  4DE6 A;  2V2S A;  4ZKH A;  3WNW A;  2FG8 A;  3F38 A;  3FVB A;  5LG2 A;  1J30 A;  1F30 A;  4AM4 A;  3KX9 A;  1Z6O M;  3OJ5 A;  3E1M A;  4XKT A;  1L8H A;  1DPS A;  2C41 A;  4EVD A;  5GU1 X;  1Z4A A;  2CEI A;  3E1O A;  5GN8 A;  2W0O A;  2YW7 A;  4PGK A;  3RAV A;  1UMN A;  4P18 A;  3PWF A;  2X17 0;  1LKM A;  3AK9 A;  4QUW A;  4RC5 A;  2Z5R A;  4CYA A;  4M32 A;  5JKL A;  3IS8 A;  4ZKW A;  1SOF A;  1JRE A;  2CHI A;  3BKN A;  4Z3B A;  1ZS3 A;  5D8S A;  2WTL A;  5JAC A;  5I4J A;  1VLG A;  2D5K A;  4EVE A;  5CMR A;  2Z6M A;  3PVY A;  3SID A;  2BK6 A;  4DYZ A;  1JGC A;  4XKU A;  2V2L A;  1JKU A;  5C6F A;  5D8Y A;  2V2O A;  3PVT B;  4RC7 B;  2ITB A;  3FI6 A;  1XZ1 A;  3AJQ A;  3VNX A;  5E2D A;  1TKP A;  3UNO A;  3EZ0 A;  4MUD A;  3R2S A;  5LS9 A;  3KA8 A;  3UOF A;  3AF7 X;  4MJY A;  1AEW A;  2FHA A;  4EVC A;  2V15 A;  1JI4 A;  3Q4O A;  4XGS A;  5GU3 X;  3A9Q A;  3R2M A;  2XJO A;  4KVS A;  1RCI A;  3PVR B;  3T9J A;  3ISE A;  5IX6 A;  3KA3 A;  4TOH A;  5FFA A;  1DVB A;  1VEL A;  4CVP A;  1SQ3 A;  5FFD A;  4ISP A;  4TOC A;  5ERK A;  1R03 A;  3RD0 A;  3FSE A;  5HJF A;  2C2F A;  4RC8 A;  5J93 A;  3AJO A;  5D8Q A;  1H96 A;  4ZTT A;  5FFC A;  3BVK A;  5AXS A;  4E6K A;  5K52 A;  3KA4 A;  2JD8 0;  4LQJ A;  3ES3 A;  4TOD A;  3RBC A;  3Q4Q A;  4Z5S A;  2FJC A;  3PVT A;  2WLA A;  2YJK A;  5D8P A;  4TOE A;  2GYQ A;  4M34 A;  4CMY A;  5HQO A;  1UVH A;  1BG7 A;  1EUM A;  2FZF A;  3AF9 X;  4ZJK A;  3EGM A;  1S30 A;  2JD7 0;  5FEJ A;  2IU2 A;  3HIU A;  4OYN A;  5J8W A;  3BVE A;  3PVR A;  4MN9 A;  4II4 B;  3BVI A;  4U3G A;  3MPS A;  2CHP A;  2GS4 A;  3QD8 A;  4ZL6 A;  3E1J A;  1NF6 A;  2IY4 A;  3PW8 C;  3SH6 A;  4ZL5 A;  3QHC A;  3PWQ C;  1LKO A;  2C2J A;  4CY9 A;  4LPM A;  4M35 A;  2CLB A;  3R2L A;  4REU A;  3RGD A;  3PWQ A;  1FHA A;  1QGH A;  3IS7 A;  4LQN A;  2OH3 A;  4DYU A;  1OTK A;  1VJX A;  3PW1 B;  2CLU A;  1VEI A;  5E1U A;  2HR5 A;  4MKU A;  4ERU A;  3BT5 A;  1TKO A;  4Y08 A;  2ZG9 X;  3IQ1 A;  2FFX J;  3A68 A;  1QYB A;  2UX1 A;  1IER A;  2QF9 A;  3O7R A;  3AK8 A;  4TOA A;  5GU0 X;  1NNQ A;  2VXI A;  1L8I A;  2GYD A;  4AM2 A;  3Q4N A;  2CN7 A;  4LYU A;  5FFB A;  2FG4 A;  4EVB A; 
#chains in the Genus database with same CATH topology
 4ZKX A;  4DYY A;  3WVW A;  3E6R A;  4CVS A;  1XZ3 A;  4DI0 A;  1MFR A;  4II4 A;  2ZG7 X;  3WVU A;  4AM5 A;  2ZA7 A;  3F32 A;  3R2H A;  3AJP A;  5CZU A;  3QVD A;  5J8S A;  3OGH A;  3O7S A;  4PG1 A;  4TO9 A;  3F36 A;  4TOB A;  2ZG8 X;  3E1N A;  3KXU A;  4ITW A;  4YVZ A;  2V2N A;  1N1Q A;  3F34 A;  2Y3Q A;  4W4K B;  3WVV A;  1HRS A;  1TJO A;  3GVY A;  5K53 A;  3QHB A;  5D8R A;  3GE4 A;  3PW1 A;  4R42 A;  1YUZ A;  4KVQ A;  2V8T A;  4CMY V;  4PGI A;  4RC7 A;  5JKM G;  5LG8 A;  2ZA8 A;  3E1L A;  3ERZ A;  3F39 A;  1Z6O A;  3E6S A;  3F37 A;  4ZLW A;  5D8O A;  2XKQ A;  1RYT A;  3E2C A;  2XJN A;  2BJY A;  1JKV A;  4IWJ A;  3GGY A;  4TOG A;  1BCF A;  2BKC A;  3H7G A;  4YKH A;  1KRQ A;  1B71 A;  1O9I A;  1RCD A;  1IES A;  2AR0 A;  4CYB A;  2G4H A;  3NOZ X;  4LPJ A;  2HTN A;  2Z5Q A;  2Z90 A;  2QQY A;  2WLU A;  4LQH A;  4DAS A;  4XKS A;  2Z5P A;  4DZ0 A;  3R2O A;  3R2K A;  2C6R A;  4CVR A;  4LPN A;  2VXX A;  4RC6 B;  4ETR A;  3RE7 A;  3GHQ A;  4KVR A;  5D8X A;  4KXR B;  3PW8 A;  3E1P A;  4LYX A;  2XGW A;  1S3Q A;  3UOI A;  2FL0 A;  4PG0 A;  1TK6 A;  1LB3 A;  4YXJ A;  2OKC A;  5CMQ A;  1JI5 A;  1MOJ A;  3HL1 A;  3BVL A;  1ZUJ A;  2FKZ A;  2YW6 A;  1F33 A;  1JIG A;  3KA9 A;  3VVA A;  1JTS A;  2PYB A;  2C2U A;  3ISF A;  5GOU A;  3F35 A;  1RCC A;  2RBD A;  2V2R A;  3E1Q A;  4IXK A;  2JD6 0;  1BFR A;  4DYX A;  3BVF A;  5ERJ A;  5JKM A;  4LQV A;  2OC5 A;  3NP2 X;  4IWK A;  3M6J A;  2V2P A;  3GGZ A;  4ML5 A;  5GU2 X;  4M33 A;  3F33 A;  2IB0 A;  4MY7 A;  3V3K B;  2MGY A;  5HJH A;  5J9V A;  2CF7 A;  3PZA A;  3C23 A;  2XJM A;  5FFE A;  3KA6 A;  4ZMC A;  2N02 A;  1YV1 A;  1JYB A;  3EZU A;  2VZB A;  2F7N A;  4TW3 A;  3U90 A;  5JKL G;  4ITT A;  3R2R A;  5GN8 B;  3TA8 A;  4RC6 A;  5HU6 D;  4ISM A;  1LKP A;  4RC5 B;  3SHX A;  2ZA6 A;  3JZ9 A;  4A25 A;  4TOF A;  1DAT A;  4W4L B;  2V2J A;  3QB9 A;  1GWG A;  2CIH A;  1RCE A;  3AF8 X;  3DBY A;  1NF4 A;  3SE1 A;  2V2I A;  1VEQ A;  3KWO A;  1NFV A;  2G38 B;  2YJJ A;  3PVY B;  3NP0 X;  3FRR A;  1S2Z A;  1YUX A;  3N6O A;  3QZ3 A;  5LBH A;  2V2M A;  1O9R A;  2BW1 A;  3Q4R A;  2CN6 A;  4CVT A;  1RCG A;  2ZUR X;  4DE6 A;  2V2S A;  4ZKH A;  3WNW A;  2FG8 A;  3F38 A;  3FVB A;  5LG2 A;  3UFB A;  1J30 A;  1F30 A;  4AM4 A;  3KX9 A;  1Z6O M;  3D19 A;  4X0J A;  3OJ5 A;  3E1M A;  4XKT A;  1L8H A;  1DPS A;  2C41 A;  4EVD A;  5GU1 X;  1Z4A A;  2CEI A;  3E1O A;  5GN8 A;  2W0O A;  2YW7 A;  3C1Y A;  4PGK A;  3RAV A;  1UMN A;  4P18 A;  3PWF A;  2X17 0;  1LKM A;  3AK9 A;  4QUW A;  4RC5 A;  2Z5R A;  4CYA A;  3C21 A;  4M32 A;  5JKL A;  3IS8 A;  4ZKW A;  1SOF A;  1JRE A;  2CHI A;  3BKN A;  4Z3B A;  1ZS3 A;  5D8S A;  2WTL A;  5JAC A;  5I4J A;  1VLG A;  2D5K A;  4EVE A;  5CMR A;  2Z6M A;  3PVY A;  3SID A;  2BK6 A;  4DYZ A;  1JGC A;  4XKU A;  2V2L A;  1JKU A;  3LKD A;  5C6F A;  5D8Y A;  3KHK A;  2V2O A;  3PVT B;  4RC7 B;  2ITB A;  3FI6 A;  1XZ1 A;  3AJQ A;  3L0M A;  3VNX A;  5E2D A;  1TKP A;  3UNO A;  3EZ0 A;  2V8U A;  4MUD A;  3R2S A;  2Y44 A;  5LS9 A;  3KA8 A;  3UOF A;  3AF7 X;  4MJY A;  1AEW A;  2FHA A;  4EVC A;  2V15 A;  1JI4 A;  3Q4O A;  4XGS A;  5GU3 X;  3A9Q A;  5JDO B;  3R2M A;  2XJO A;  4KVS A;  1RCI A;  3PVR B;  3FRS A;  3T9J A;  3W54 A;  3ISE A;  3KDQ A;  3VV9 A;  5IX6 A;  3KA3 A;  4TOH A;  4MXP A;  5FFA A;  1DVB A;  1VEL A;  4CVP A;  1SQ3 A;  5FFD A;  4ISP A;  4E40 A;  4TOC A;  5ERK A;  1R03 A;  3RD0 A;  3FSE A;  5HJF A;  2C2F A;  4RC8 A;  5J93 A;  3AJO A;  5D8Q A;  1H96 A;  3C1Z A;  4ZTT A;  5FFC A;  3BVK A;  5AXS A;  4E6K A;  5K52 A;  3KA4 A;  2JD8 0;  4LQJ A;  3ES3 A;  4TOD A;  3RBC A;  3Q4Q A;  4Z5S A;  2FJC A;  3PVT A;  2WLA A;  2YJK A;  5D8P A;  4TOE A;  2GYQ A;  4M34 A;  4CMY A;  5HQO A;  1UVH A;  1BG7 A;  1EUM A;  2FZF A;  3AF9 X;  4ZJK A;  3EGM A;  1S30 A;  2JD7 0;  5FEJ A;  2IU2 A;  3HIU A;  4OYN A;  5J8W A;  5JDO A;  3BVE A;  3PVR A;  4MN9 A;  4II4 B;  3BVI A;  4U3G A;  3MPS A;  2CHP A;  2GS4 A;  3QD8 A;  4ZL6 A;  3E1J A;  1NF6 A;  2IY4 A;  3PW8 C;  3SH6 A;  4ZL5 A;  3JZA B;  3QHC A;  3PWQ C;  1LKO A;  2C2J A;  4CY9 A;  4LPM A;  4M35 A;  2CLB A;  3R2L A;  4REU A;  3RGD A;  3PWQ A;  1FHA A;  1QGH A;  3IS7 A;  4LQN A;  2OH3 A;  4DYU A;  1OTK A;  1VJX A;  3PW1 B;  2CLU A;  1VEI A;  2WWX B;  5E1U A;  2HR5 A;  4MKU A;  4YXM A;  4ERU A;  3BT5 A;  1TKO A;  4Y08 A;  2ZG9 X;  3IQ1 A;  2FFX J;  3A68 A;  1QYB A;  2UX1 A;  1IER A;  2QF9 A;  3O7R A;  3AK8 A;  4TOA A;  5GU0 X;  2CWL A;  1NNQ A;  2VXI A;  1L8I A;  2GYD A;  4AM2 A;  3Q4N A;  2CN7 A;  4WJG 4;  4LYU A;  5FFB A;  2FG4 A;  4EVB A; 
#chains in the Genus database with same CATH homology
 4ZKX A;  4DYY A;  3WVW A;  3E6R A;  4CVS A;  1XZ3 A;  4DI0 A;  1MFR A;  4II4 A;  2ZG7 X;  3WVU A;  4AM5 A;  2ZA7 A;  3F32 A;  3R2H A;  3AJP A;  5CZU A;  3QVD A;  5J8S A;  3OGH A;  3O7S A;  4PG1 A;  4TO9 A;  3F36 A;  4TOB A;  2ZG8 X;  3E1N A;  3KXU A;  4ITW A;  4YVZ A;  2V2N A;  1N1Q A;  3F34 A;  2Y3Q A;  4W4K B;  3WVV A;  1HRS A;  1TJO A;  3GVY A;  5K53 A;  3QHB A;  5D8R A;  3GE4 A;  3PW1 A;  4R42 A;  1YUZ A;  4KVQ A;  2V8T A;  4CMY V;  4PGI A;  4RC7 A;  5JKM G;  5LG8 A;  2ZA8 A;  3E1L A;  3ERZ A;  3F39 A;  1Z6O A;  3E6S A;  3F37 A;  4ZLW A;  5D8O A;  2XKQ A;  1RYT A;  3E2C A;  2XJN A;  2BJY A;  1JKV A;  4IWJ A;  3GGY A;  4TOG A;  1BCF A;  2BKC A;  3H7G A;  4YKH A;  1KRQ A;  1B71 A;  1O9I A;  1RCD A;  1IES A;  2AR0 A;  4CYB A;  2G4H A;  3NOZ X;  4LPJ A;  2HTN A;  2Z5Q A;  2Z90 A;  2QQY A;  2WLU A;  4LQH A;  4DAS A;  4XKS A;  2Z5P A;  4DZ0 A;  3R2O A;  3R2K A;  2C6R A;  4CVR A;  4LPN A;  2VXX A;  4RC6 B;  4ETR A;  3RE7 A;  3GHQ A;  4KVR A;  5D8X A;  4KXR B;  3PW8 A;  3E1P A;  4LYX A;  2XGW A;  1S3Q A;  3UOI A;  2FL0 A;  4PG0 A;  1TK6 A;  1LB3 A;  4YXJ A;  2OKC A;  5CMQ A;  1JI5 A;  1MOJ A;  3HL1 A;  3BVL A;  1ZUJ A;  2FKZ A;  2YW6 A;  1F33 A;  1JIG A;  3KA9 A;  3VVA A;  1JTS A;  2PYB A;  2C2U A;  3ISF A;  5GOU A;  3F35 A;  1RCC A;  2RBD A;  2V2R A;  3E1Q A;  4IXK A;  2JD6 0;  1BFR A;  4DYX A;  3BVF A;  5ERJ A;  5JKM A;  4LQV A;  2OC5 A;  3NP2 X;  4IWK A;  3M6J A;  2V2P A;  3GGZ A;  4ML5 A;  5GU2 X;  4M33 A;  3F33 A;  2IB0 A;  4MY7 A;  3V3K B;  2MGY A;  5HJH A;  5J9V A;  2CF7 A;  3PZA A;  3C23 A;  2XJM A;  5FFE A;  3KA6 A;  4ZMC A;  2N02 A;  1YV1 A;  1JYB A;  3EZU A;  2VZB A;  2F7N A;  4TW3 A;  3U90 A;  5JKL G;  4ITT A;  3R2R A;  5GN8 B;  3TA8 A;  4RC6 A;  5HU6 D;  4ISM A;  1LKP A;  4RC5 B;  3SHX A;  2ZA6 A;  3JZ9 A;  4A25 A;  4TOF A;  1DAT A;  4W4L B;  2V2J A;  3QB9 A;  1GWG A;  2CIH A;  1RCE A;  3AF8 X;  3DBY A;  1NF4 A;  3SE1 A;  2V2I A;  1VEQ A;  3KWO A;  1NFV A;  2G38 B;  2YJJ A;  3PVY B;  3NP0 X;  3FRR A;  1S2Z A;  1YUX A;  3N6O A;  3QZ3 A;  5LBH A;  2V2M A;  1O9R A;  2BW1 A;  3Q4R A;  2CN6 A;  4CVT A;  1RCG A;  2ZUR X;  4DE6 A;  2V2S A;  4ZKH A;  3WNW A;  2FG8 A;  3F38 A;  3FVB A;  5LG2 A;  3UFB A;  1J30 A;  1F30 A;  4AM4 A;  3KX9 A;  1Z6O M;  3D19 A;  4X0J A;  3OJ5 A;  3E1M A;  4XKT A;  1L8H A;  1DPS A;  2C41 A;  4EVD A;  5GU1 X;  1Z4A A;  2CEI A;  3E1O A;  5GN8 A;  2W0O A;  2YW7 A;  3C1Y A;  4PGK A;  3RAV A;  1UMN A;  4P18 A;  3PWF A;  2X17 0;  1LKM A;  3AK9 A;  4QUW A;  4RC5 A;  2Z5R A;  4CYA A;  3C21 A;  4M32 A;  5JKL A;  3IS8 A;  4ZKW A;  1SOF A;  1JRE A;  2CHI A;  3BKN A;  4Z3B A;  1ZS3 A;  5D8S A;  2WTL A;  5JAC A;  5I4J A;  1VLG A;  2D5K A;  4EVE A;  5CMR A;  2Z6M A;  3PVY A;  3SID A;  2BK6 A;  4DYZ A;  1JGC A;  4XKU A;  2V2L A;  1JKU A;  3LKD A;  5C6F A;  5D8Y A;  3KHK A;  2V2O A;  3PVT B;  4RC7 B;  2ITB A;  3FI6 A;  1XZ1 A;  3AJQ A;  3L0M A;  3VNX A;  5E2D A;  1TKP A;  3UNO A;  3EZ0 A;  2V8U A;  4MUD A;  3R2S A;  2Y44 A;  5LS9 A;  3KA8 A;  3UOF A;  3AF7 X;  4MJY A;  1AEW A;  2FHA A;  4EVC A;  2V15 A;  1JI4 A;  3Q4O A;  4XGS A;  5GU3 X;  3A9Q A;  5JDO B;  3R2M A;  2XJO A;  4KVS A;  1RCI A;  3PVR B;  3FRS A;  3T9J A;  3W54 A;  3ISE A;  3KDQ A;  3VV9 A;  5IX6 A;  3KA3 A;  4TOH A;  4MXP A;  5FFA A;  1DVB A;  1VEL A;  4CVP A;  1SQ3 A;  5FFD A;  4ISP A;  4E40 A;  4TOC A;  5ERK A;  1R03 A;  3RD0 A;  3FSE A;  5HJF A;  2C2F A;  4RC8 A;  5J93 A;  3AJO A;  5D8Q A;  1H96 A;  3C1Z A;  4ZTT A;  5FFC A;  3BVK A;  5AXS A;  4E6K A;  5K52 A;  3KA4 A;  2JD8 0;  4LQJ A;  3ES3 A;  4TOD A;  3RBC A;  3Q4Q A;  4Z5S A;  2FJC A;  3PVT A;  2WLA A;  2YJK A;  5D8P A;  4TOE A;  2GYQ A;  4M34 A;  4CMY A;  5HQO A;  1UVH A;  1BG7 A;  1EUM A;  2FZF A;  3AF9 X;  4ZJK A;  3EGM A;  1S30 A;  2JD7 0;  5FEJ A;  2IU2 A;  3HIU A;  4OYN A;  5J8W A;  5JDO A;  3BVE A;  3PVR A;  4MN9 A;  4II4 B;  3BVI A;  4U3G A;  3MPS A;  2CHP A;  2GS4 A;  3QD8 A;  4ZL6 A;  3E1J A;  1NF6 A;  2IY4 A;  3PW8 C;  3SH6 A;  4ZL5 A;  3JZA B;  3QHC A;  3PWQ C;  1LKO A;  2C2J A;  4CY9 A;  4LPM A;  4M35 A;  2CLB A;  3R2L A;  4REU A;  3RGD A;  3PWQ A;  1FHA A;  1QGH A;  3IS7 A;  4LQN A;  2OH3 A;  4DYU A;  1OTK A;  1VJX A;  3PW1 B;  2CLU A;  1VEI A;  2WWX B;  5E1U A;  2HR5 A;  4MKU A;  4YXM A;  4ERU A;  3BT5 A;  1TKO A;  4Y08 A;  2ZG9 X;  3IQ1 A;  2FFX J;  3A68 A;  1QYB A;  2UX1 A;  1IER A;  2QF9 A;  3O7R A;  3AK8 A;  4TOA A;  5GU0 X;  2CWL A;  1NNQ A;  2VXI A;  1L8I A;  2GYD A;  4AM2 A;  3Q4N A;  2CN7 A;  4WJG 4;  4LYU A;  5FFB A;  2FG4 A;  4EVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...