3Q4RA

Crystal structure of a deletion mutant(11-185) of hypothetical protein mj0754 with zn2+
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
170
structure length
170
Chain Sequence
QPISEEEKEGLIEMREEEKLARDVYLTLYNKWKLQIFKNIAESEQTHMDAVKYLLEKYNIPDPVKNDSIGVFSNPKFEELYKKLVEKGDKSEVDALKVGATIEDLDIADLEKWINKTDNEDIKFVYENLMKGSRNHMRAFVRMLNNYGSNYTPQYISKEEYEEIISSSTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein MJ0754
publication title Structural insights into the metal binding properties of hypothetical protein MJ0754 from Methanococcus jannaschii DSM 2661
doi rcsb
source organism Methanocaldococcus jannaschii
total genus 73
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2010-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09968 DUF2202 Uncharacterized protein domain (DUF2202)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3q4rA00
3PVYA 2C2JA 2YW6A 5AXSA 3BT5A 1NF6A 2ITBA 4LPJA 3F35A 1YV1A 3F39A 1L8HA 3AF8X 5HJFA 2XJMA 1H96A 3R2KA 4CVTA 1N1QA 3ISFA 5E2DA 4Z3BA 2YW7A 3KA9A 5CZUA 2JD60 1O9IA 2V2NA 5GU1X 5K53A 3KXUA 3GE4A 3RGDA 4ZKWA 2FL0A 2F7NA 3OGHA 1RYTA 2V2MA 3KX9A 3GVYA 1O9RA 4PGIA 2IY4A 4REUA 5IX6A 4IXKA 1SQ3A 1VEIA 3PVRB 2CN7A 3F34A 4ERUA 1VEQA 1LKMA 3IS8A 1Z6OA 2RBDA 4M35A 1JI4A 2X170 3BVKA 4EVCA 2GYQA 2XJOA 1SOFA 2FG4A 4PG1A 2GS4A 2Z5QA 3R2RA 3SIDA 5FEJA 3VNXA 2W0OA 4ML5A 3MPSA 2ZA8A 3FI6A 1VELA 1MOJA 1DATA 4LYUA 4RC5B 2CHIA 4Z5SA 3H7GA 3TA8A 4LQVA 3E1MA 3BVEA 4PGKA 4TO9A 2C41A 1IESA 2PYBA 2C2UA 3PVRA 3Q4NA 5HJHA 5J8SA 4RC8A 3KA3A 5D8RA 1TJOA 4TOGA 2G4HA 3EGMA 2CIHA 2VXIA 1YUZA 3PW8C 3AK9A 3BVLA 5GU0X 3HL1A 2BJYA 4RC7B 1OTKA 3R2OA 3ERZA 4MJYA 3WVVA 4LYXA 4ZJKA 4RC5A 3BVIA 2BKCA 3R2SA 4U3GA 2V2JA 3F37A 4ETRA 3UNOA 4DE6A 4QUWA 2C6RA 3NOZX 4II4B 4ZKXA 2WLUA 5GU2X 4ITWA 4TOCA 3E6RA 3FSEA 3O7SA 4LQJA 1NNQA 1S30A 1RCEA 3EZ0A 1RCGA 1JGCA 3A9QA 2IB0A 2V2IA 2D5KA 4P18A 5D8YA 1RCIA 4MY7A 2FKZA 2XGWA 1LKPA 3E1JA 1JKUA 5CMQA 3QB9A 1J30A 1TKOA 4AM5A 5JKLA 3E1QA 5K52A 4RC7A 5JKLG 1F33A 3HIUA 2V2OA 1BFRA 5I4JA 3PW8A 2ZG9X 2ZURX 4R42A 3AJOA 3ES3A 1UVHA 4DYYA 4II4A 4ZL6A 3QVDA 2YJKA 2C2FA 3PZAA 1Z4AA 4OYNA 5ERJA 3E2CA 5HQOA 4ISPA 3E1OA 4MN9A 1JYBA 4TOAA 2OC5A 2V15A 4DASA 4M33A 2FZFA 2XJNA 1HRSA 2VXXA 3QZ3A 1S3QA 4KVQA 5FFDA 4KVRA 1R03A 5CMRA 2ZA7A 5FFAA 4LPNA 5GOUA 4TODA 2FFXJ 2GYDA 4EVBA 4CY9A 3F33A 3WVWA 4M32A 1F30A 1QYBA 4ISMA 3PWQA 3NP0X 5FFEA 5ERKA 5J8WA 4CVRA 5JACA 5LG2A 2V2RA 4XKSA 2HR5A 3QHCA 4ZMCA 1VLGA 1MFRA 3QD8A 3F36A 3NP2X 3R2MA 3AF7X 4DYZA 3E1PA 2CN6A 2QQYA 5LBHA 3F38A 4DYUA 4ZKHA 5FFBA 2JD70 5FFCA 4DI0A 2CF7A 1DVBA 5D8SA 1TK6A 5J9VA 1QGHA 3OJ5A 4TOBA 4CMYV 1LKOA 4XGSA 1NF4A 5GN8B 3KA8A 4M34A 4MUDA 1JI5A 3EZUA 3F32A 3PWFA 1AEWA 4CVSA 3UOIA 3SH6A 2ZG7X 2BW1A 2XKQA 1XZ1A 2VZBA 2WTLA 4DZ0A 3Q4RA 3PWQC 4IWJA 1JIGA 2IU2A 3IS7A 4ITTA 2JD80 3BKNA 1YUXA 4ZLWA 3T9JA 1JKVA 1UMNA 2Z5RA 3PW1B 3KA4A 5LS9A 2V2SA 2V2PA 5GN8A 4XKTA 3SE1A 3KWOA 3BVFA 1GWGA 4LQHA 3PVTB 1NFVA 3E1NA 3WNWA 5GU3X 2CEIA 3IQ1A 1S2ZA 2FJCA 1Z6OM 5D8QA 5E1UA 5LG8A 4CYAA 4TW3A 3A68A 1DPSA 1TKPA 2CLUA 2V2LA 4EVDA 3PW1A 3R2HA 2CLBA 3RD0A 4IWKA 3RE7A 3GHQA 3ISEA 2WLAA 2Y3QA 3SHXA 4A25A 3AF9X 2Z90A 1VJXA 3AK8A 3PVTA 3QHBA 2Z5PA 4E6KA 3WVUA 4XKUA 3AJQA 5D8XA 3FVBA 1ZUJA 3AJPA 4TOHA 1B71A 1FHAA 3RBCA 2FHAA 3KA6A 4MKUA 4DYXA 4TOEA 2CHPA 4RC6B 3O7RA 4TOFA 4CMYA 1XZ3A 4LPMA 3U90A 1BCFA 3PVYB 5D8OA 4ZL5A 2ZA6A 1L8IA 1LB3A 5C6FA 1EUMA 4AM4A 4Y08A 1IERA 2BK6A 3RAVA 1BG7A 5D8PA 1RCDA 3R2LA 4ZTTA 2YJJA 2QF9A 4AM2A 2HTNA 2Z6MA 4LQNA 1JREA 1RCCA 1KRQA 1JTSA 2OH3A 5JKMA 2ZG8X 5JKMG 4PG0A 4EVEA 3E6SA 3E1LA 5J93A 4RC6A 3Q4OA 4YKHA 2UX1A 4KVSA 3Q4QA 1ZS3A 4CVPA 3UOFA 4CYBA 2FG8A
chains in the Genus database with same CATH superfamily
3PVYA 2C2JA 2YW6A 3FRRA 5AXSA 4W4KB 3BT5A 1NF6A 2ITBA 4LPJA 3F35A 1YV1A 3F39A 1L8HA 2G38B 3AF8X 5HJFA 2XJMA 3KDQA 1H96A 3R2KA 4CVTA 1N1QA 3ISFA 5E2DA 4Z3BA 2YW7A 3FRSA 3KA9A 3C1YA 5CZUA 2JD60 1O9IA 2V2NA 5GU1X 5K53A 2CWLA 3KXUA 3GE4A 3RGDA 4ZKWA 2FL0A 2F7NA 5JDOB 3OGHA 1RYTA 3C23A 2V2MA 2MGYA 3KX9A 3GVYA 1O9RA 4PGIA 2IY4A 4REUA 5IX6A 4IXKA 1SQ3A 1VEIA 3PVRB 2CN7A 3F34A 4ERUA 1VEQA 1LKMA 3IS8A 1Z6OA 2RBDA 4M35A 1JI4A 2X170 3BVKA 4EVCA 2GYQA 2XJOA 1SOFA 2FG4A 4PG1A 2GS4A 2Z5QA 3R2RA 3SIDA 5FEJA 3VNXA 2W0OA 4ML5A 3MPSA 2ZA8A 3FI6A 1VELA 3JZAB 1MOJA 1DATA 4LYUA 4RC5B 2CHIA 4Z5SA 3H7GA 3TA8A 4LQVA 5JDOA 3UFBA 3E1MA 3BVEA 4PGKA 4TO9A 2C41A 1IESA 2PYBA 2C2UA 2V8TA 3PVRA 3Q4NA 5HJHA 5J8SA 4RC8A 2V8UA 3KA3A 5D8RA 1TJOA 4TOGA 2G4HA 3EGMA 2CIHA 2VXIA 1YUZA 3PW8C 3AK9A 3BVLA 5GU0X 3HL1A 2BJYA 4RC7B 1OTKA 3R2OA 3ERZA 4MJYA 3WVVA 4LYXA 4ZJKA 4RC5A 2N02A 3BVIA 2BKCA 3R2SA 4U3GA 2V2JA 3F37A 2OKCA 4ETRA 3UNOA 3VVAA 4DE6A 4QUWA 2C6RA 3NOZX 4II4B 4ZKXA 2WLUA 5GU2X 4ITWA 4TOCA 3E6RA 3FSEA 3O7SA 4LQJA 1NNQA 1S30A 1RCEA 3EZ0A 1RCGA 1JGCA 3A9QA 4W4LB 2IB0A 2V2IA 2D5KA 4P18A 5D8YA 1RCIA 4MY7A 2FKZA 2XGWA 1LKPA 3E1JA 1JKUA 5CMQA 3QB9A 1J30A 1TKOA 4AM5A 5JKLA 3E1QA 5K52A 4RC7A 5JKLG 2Y44A 1F33A 3HIUA 2V2OA 1BFRA 4YXMA 5I4JA 3PW8A 2ZG9X 2ZURX 4R42A 3AJOA 3ES3A 1UVHA 4DYYA 4II4A 4ZL6A 3QVDA 2YJKA 2C2FA 3PZAA 1Z4AA 4OYNA 5ERJA 3E2CA 5HQOA 4ISPA 3E1OA 4MN9A 1JYBA 4TOAA 2OC5A 2V15A 4DASA 3JZ9A 4M33A 2FZFA 2XJNA 1HRSA 2VXXA 3QZ3A 1S3QA 4KVQA 5FFDA 4KVRA 1R03A 5CMRA 3L0MA 2ZA7A 5FFAA 4LPNA 5GOUA 4TODA 2FFXJ 2GYDA 4EVBA 4CY9A 3F33A 3WVWA 4M32A 1F30A 1QYBA 4ISMA 3PWQA 3NP0X 5FFEA 5ERKA 5J8WA 4CVRA 3D19A 5JACA 5LG2A 2V2RA 4XKSA 2HR5A 3QHCA 4ZMCA 3N6OA 1VLGA 1MFRA 3QD8A 3F36A 3NP2X 3R2MA 3AF7X 4DYZA 3E1PA 2CN6A 2QQYA 5LBHA 3F38A 4DYUA 4ZKHA 5FFBA 2JD70 5FFCA 4X0JA 4DI0A 2CF7A 3KHKA 2WWXB 1DVBA 3W54A 4YVZA 5D8SA 1TK6A 5J9VA 1QGHA 3OJ5A 4TOBA 4CMYV 1LKOA 4XGSA 1NF4A 5GN8B 3KA8A 4M34A 4MUDA 1JI5A 3EZUA 3F32A 3PWFA 1AEWA 4CVSA 3UOIA 3SH6A 2ZG7X 2BW1A 2XKQA 1XZ1A 2VZBA 2WTLA 4DZ0A 3Q4RA 3PWQC 4IWJA 1JIGA 2IU2A 3IS7A 4ITTA 2JD80 3BKNA 1YUXA 4ZLWA 3T9JA 1JKVA 1UMNA 2Z5RA 3PW1B 3KA4A 5LS9A 2V2SA 2V2PA 5GN8A 4XKTA 3SE1A 3KWOA 3BVFA 1GWGA 4LQHA 3PVTB 1NFVA 3E1NA 3WNWA 3C21A 3GGZA 5GU3X 2CEIA 3IQ1A 1S2ZA 2FJCA 1Z6OM 5D8QA 4E40A 5E1UA 5LG8A 4CYAA 4TW3A 3A68A 1DPSA 1TKPA 2CLUA 2V2LA 4EVDA 3PW1A 3R2HA 2CLBA 3RD0A 4IWKA 3RE7A 3GHQA 3ISEA 2WLAA 2Y3QA 3SHXA 4A25A 3AF9X 2Z90A 1VJXA 3AK8A 3PVTA 3QHBA 2Z5PA 4E6KA 3WVUA 4XKUA 3AJQA 5D8XA 4MXPA 3FVBA 1ZUJA 3AJPA 4TOHA 1B71A 1FHAA 3RBCA 3M6JA 2FHAA 3KA6A 4MKUA 5HU6D 4DYXA 4WJG4 4TOEA 2CHPA 4RC6B 3V3KB 3O7RA 4TOFA 4CMYA 1XZ3A 4LPMA 3U90A 1BCFA 3PVYB 5D8OA 2AR0A 3DBYA 4ZL5A 2ZA6A 1L8IA 1LB3A 5C6FA 1EUMA 4AM4A 4Y08A 1IERA 2BK6A 3LKDA 3RAVA 1BG7A 5D8PA 3C1ZA 4YXJA 1RCDA 3R2LA 4ZTTA 2YJJA 2QF9A 4AM2A 2HTNA 2Z6MA 4LQNA 1JREA 1RCCA 1KRQA 1JTSA 2OH3A 5JKMA 2ZG8X 5JKMG 3VV9A 4PG0A 4EVEA 3E6SA 3E1LA 5J93A 4RC6A 3GGYA 3Q4OA 4YKHA 2UX1A 4KVSA 3Q4QA 1ZS3A 4KXRB 4CVPA 3UOFA 4CYBA 2FG8A
chains in the Genus database with same CATH topology
3PVYA 2C2JA 2YW6A 3FRRA 5AXSA 4W4KB 3BT5A 1NF6A 2ITBA 4LPJA 3F35A 1YV1A 3F39A 1L8HA 2G38B 3AF8X 5HJFA 2XJMA 3KDQA 1H96A 3R2KA 4CVTA 1N1QA 3ISFA 5E2DA 4Z3BA 2YW7A 3FRSA 3KA9A 3C1YA 5CZUA 2JD60 1O9IA 2V2NA 5GU1X 5K53A 2CWLA 3KXUA 3GE4A 3RGDA 4ZKWA 2FL0A 2F7NA 5JDOB 3OGHA 1RYTA 3C23A 2V2MA 2MGYA 3KX9A 3GVYA 1O9RA 4PGIA 2IY4A 4REUA 5IX6A 4IXKA 1SQ3A 1VEIA 3PVRB 2CN7A 3F34A 4ERUA 1VEQA 1LKMA 3IS8A 1Z6OA 2RBDA 4M35A 1JI4A 2X170 3BVKA 4EVCA 2GYQA 2XJOA 1SOFA 2FG4A 4PG1A 2GS4A 2Z5QA 3R2RA 3SIDA 5FEJA 3VNXA 2W0OA 4ML5A 3MPSA 2ZA8A 3FI6A 1VELA 3JZAB 1MOJA 1DATA 4LYUA 4RC5B 2CHIA 4Z5SA 3H7GA 3TA8A 4LQVA 5JDOA 3UFBA 3E1MA 3BVEA 4PGKA 4TO9A 2C41A 1IESA 2PYBA 2C2UA 2V8TA 3PVRA 3Q4NA 5HJHA 5J8SA 4RC8A 2V8UA 3KA3A 5D8RA 1TJOA 4TOGA 2G4HA 3EGMA 2CIHA 2VXIA 1YUZA 3PW8C 3AK9A 3BVLA 5GU0X 3HL1A 2BJYA 4RC7B 1OTKA 3R2OA 3ERZA 4MJYA 3WVVA 4LYXA 4ZJKA 4RC5A 2N02A 3BVIA 2BKCA 3R2SA 4U3GA 2V2JA 3F37A 2OKCA 4ETRA 3UNOA 3VVAA 4DE6A 4QUWA 2C6RA 3NOZX 4II4B 4ZKXA 2WLUA 5GU2X 4ITWA 4TOCA 3E6RA 3FSEA 3O7SA 4LQJA 1NNQA 1S30A 1RCEA 3EZ0A 1RCGA 1JGCA 3A9QA 4W4LB 2IB0A 2V2IA 2D5KA 4P18A 5D8YA 1RCIA 4MY7A 2FKZA 2XGWA 1LKPA 3E1JA 1JKUA 5CMQA 3QB9A 1J30A 1TKOA 4AM5A 5JKLA 3E1QA 5K52A 4RC7A 5JKLG 2Y44A 1F33A 3HIUA 2V2OA 1BFRA 4YXMA 5I4JA 3PW8A 2ZG9X 2ZURX 4R42A 3AJOA 3ES3A 1UVHA 4DYYA 4II4A 4ZL6A 3QVDA 2YJKA 2C2FA 3PZAA 1Z4AA 4OYNA 5ERJA 3E2CA 5HQOA 4ISPA 3E1OA 4MN9A 1JYBA 4TOAA 2OC5A 2V15A 4DASA 3JZ9A 4M33A 2FZFA 2XJNA 1HRSA 2VXXA 3QZ3A 1S3QA 4KVQA 5FFDA 4KVRA 1R03A 5CMRA 3L0MA 2ZA7A 5FFAA 4LPNA 5GOUA 4TODA 2FFXJ 2GYDA 4EVBA 4CY9A 3F33A 3WVWA 4M32A 1F30A 1QYBA 4ISMA 3PWQA 3NP0X 5FFEA 5ERKA 5J8WA 4CVRA 3D19A 5JACA 5LG2A 2V2RA 4XKSA 2HR5A 3QHCA 4ZMCA 3N6OA 1VLGA 1MFRA 3QD8A 3F36A 3NP2X 3R2MA 3AF7X 4DYZA 3E1PA 2CN6A 2QQYA 5LBHA 3F38A 4DYUA 4ZKHA 5FFBA 2JD70 5FFCA 4X0JA 4DI0A 2CF7A 3KHKA 2WWXB 1DVBA 3W54A 4YVZA 5D8SA 1TK6A 5J9VA 1QGHA 3OJ5A 4TOBA 4CMYV 1LKOA 4XGSA 1NF4A 5GN8B 3KA8A 4M34A 4MUDA 1JI5A 3EZUA 3F32A 3PWFA 1AEWA 4CVSA 3UOIA 3SH6A 2ZG7X 2BW1A 2XKQA 1XZ1A 2VZBA 2WTLA 4DZ0A 3Q4RA 3PWQC 4IWJA 1JIGA 2IU2A 3IS7A 4ITTA 2JD80 3BKNA 1YUXA 4ZLWA 3T9JA 1JKVA 1UMNA 2Z5RA 3PW1B 3KA4A 5LS9A 2V2SA 2V2PA 5GN8A 4XKTA 3SE1A 3KWOA 3BVFA 1GWGA 4LQHA 3PVTB 1NFVA 3E1NA 3WNWA 3C21A 3GGZA 5GU3X 2CEIA 3IQ1A 1S2ZA 2FJCA 1Z6OM 5D8QA 4E40A 5E1UA 5LG8A 4CYAA 4TW3A 3A68A 1DPSA 1TKPA 2CLUA 2V2LA 4EVDA 3PW1A 3R2HA 2CLBA 3RD0A 4IWKA 3RE7A 3GHQA 3ISEA 2WLAA 2Y3QA 3SHXA 4A25A 3AF9X 2Z90A 1VJXA 3AK8A 3PVTA 3QHBA 2Z5PA 4E6KA 3WVUA 4XKUA 3AJQA 5D8XA 4MXPA 3FVBA 1ZUJA 3AJPA 4TOHA 1B71A 1FHAA 3RBCA 3M6JA 2FHAA 3KA6A 4MKUA 5HU6D 4DYXA 4WJG4 4TOEA 2CHPA 4RC6B 3V3KB 3O7RA 4TOFA 4CMYA 1XZ3A 4LPMA 3U90A 1BCFA 3PVYB 5D8OA 2AR0A 3DBYA 4ZL5A 2ZA6A 1L8IA 1LB3A 5C6FA 1EUMA 4AM4A 4Y08A 1IERA 2BK6A 3LKDA 3RAVA 1BG7A 5D8PA 3C1ZA 4YXJA 1RCDA 3R2LA 4ZTTA 2YJJA 2QF9A 4AM2A 2HTNA 2Z6MA 4LQNA 1JREA 1RCCA 1KRQA 1JTSA 2OH3A 5JKMA 2ZG8X 5JKMG 3VV9A 4PG0A 4EVEA 3E6SA 3E1LA 5J93A 4RC6A 3GGYA 3Q4OA 4YKHA 2UX1A 4KVSA 3Q4QA 1ZS3A 4KXRB 4CVPA 3UOFA 4CYBA 2FG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVY A;  2C2J A;  2YW6 A;  5AXS A;  3BT5 A;  1NF6 A;  2ITB A;  4LPJ A;  3F35 A;  1YV1 A;  3F39 A;  1L8H A;  3AF8 X;  5HJF A;  2XJM A;  1H96 A;  3R2K A;  4CVT A;  1N1Q A;  3ISF A;  5E2D A;  4Z3B A;  2YW7 A;  3KA9 A;  5CZU A;  2JD6 0;  1O9I A;  2V2N A;  5GU1 X;  5K53 A;  3KXU A;  3GE4 A;  3RGD A;  4ZKW A;  2FL0 A;  2F7N A;  3OGH A;  1RYT A;  2V2M A;  3KX9 A;  3GVY A;  1O9R A;  4PGI A;  2IY4 A;  4REU A;  5IX6 A;  4IXK A;  1SQ3 A;  1VEI A;  3PVR B;  2CN7 A;  3F34 A;  4ERU A;  1VEQ A;  1LKM A;  3IS8 A;  1Z6O A;  2RBD A;  4M35 A;  1JI4 A;  2X17 0;  3BVK A;  4EVC A;  2GYQ A;  2XJO A;  1SOF A;  2FG4 A;  4PG1 A;  2GS4 A;  2Z5Q A;  3R2R A;  3SID A;  5FEJ A;  3VNX A;  2W0O A;  4ML5 A;  3MPS A;  2ZA8 A;  3FI6 A;  1VEL A;  1MOJ A;  1DAT A;  4LYU A;  4RC5 B;  2CHI A;  4Z5S A;  3H7G A;  3TA8 A;  4LQV A;  3E1M A;  3BVE A;  4PGK A;  4TO9 A;  2C41 A;  1IES A;  2PYB A;  2C2U A;  3PVR A;  3Q4N A;  5HJH A;  5J8S A;  4RC8 A;  3KA3 A;  5D8R A;  1TJO A;  4TOG A;  2G4H A;  3EGM A;  2CIH A;  2VXI A;  1YUZ A;  3PW8 C;  3AK9 A;  3BVL A;  5GU0 X;  3HL1 A;  2BJY A;  4RC7 B;  1OTK A;  3R2O A;  3ERZ A;  4MJY A;  3WVV A;  4LYX A;  4ZJK A;  4RC5 A;  3BVI A;  2BKC A;  3R2S A;  4U3G A;  2V2J A;  3F37 A;  4ETR A;  3UNO A;  4DE6 A;  4QUW A;  2C6R A;  3NOZ X;  4II4 B;  4ZKX A;  2WLU A;  5GU2 X;  4ITW A;  4TOC A;  3E6R A;  3FSE A;  3O7S A;  4LQJ A;  1NNQ A;  1S30 A;  1RCE A;  3EZ0 A;  1RCG A;  1JGC A;  3A9Q A;  2IB0 A;  2V2I A;  2D5K A;  4P18 A;  5D8Y A;  1RCI A;  4MY7 A;  2FKZ A;  2XGW A;  1LKP A;  3E1J A;  1JKU A;  5CMQ A;  3QB9 A;  1J30 A;  1TKO A;  4AM5 A;  5JKL A;  3E1Q A;  5K52 A;  4RC7 A;  5JKL G;  1F33 A;  3HIU A;  2V2O A;  1BFR A;  5I4J A;  3PW8 A;  2ZG9 X;  2ZUR X;  4R42 A;  3AJO A;  3ES3 A;  1UVH A;  4DYY A;  4II4 A;  4ZL6 A;  3QVD A;  2YJK A;  2C2F A;  3PZA A;  1Z4A A;  4OYN A;  5ERJ A;  3E2C A;  5HQO A;  4ISP A;  3E1O A;  4MN9 A;  1JYB A;  4TOA A;  2OC5 A;  2V15 A;  4DAS A;  4M33 A;  2FZF A;  2XJN A;  1HRS A;  2VXX A;  3QZ3 A;  1S3Q A;  4KVQ A;  5FFD A;  4KVR A;  1R03 A;  5CMR A;  2ZA7 A;  5FFA A;  4LPN A;  5GOU A;  4TOD A;  2FFX J;  2GYD A;  4EVB A;  4CY9 A;  3F33 A;  3WVW A;  4M32 A;  1F30 A;  1QYB A;  4ISM A;  3PWQ A;  3NP0 X;  5FFE A;  5ERK A;  5J8W A;  4CVR A;  5JAC A;  5LG2 A;  2V2R A;  4XKS A;  2HR5 A;  3QHC A;  4ZMC A;  1VLG A;  1MFR A;  3QD8 A;  3F36 A;  3NP2 X;  3R2M A;  3AF7 X;  4DYZ A;  3E1P A;  2CN6 A;  2QQY A;  5LBH A;  3F38 A;  4DYU A;  4ZKH A;  5FFB A;  2JD7 0;  5FFC A;  4DI0 A;  2CF7 A;  1DVB A;  5D8S A;  1TK6 A;  5J9V A;  1QGH A;  3OJ5 A;  4TOB A;  4CMY V;  1LKO A;  4XGS A;  1NF4 A;  5GN8 B;  3KA8 A;  4M34 A;  4MUD A;  1JI5 A;  3EZU A;  3F32 A;  3PWF A;  1AEW A;  4CVS A;  3UOI A;  3SH6 A;  2ZG7 X;  2BW1 A;  2XKQ A;  1XZ1 A;  2VZB A;  2WTL A;  4DZ0 A;  3Q4R A;  3PWQ C;  4IWJ A;  1JIG A;  2IU2 A;  3IS7 A;  4ITT A;  2JD8 0;  3BKN A;  1YUX A;  4ZLW A;  3T9J A;  1JKV A;  1UMN A;  2Z5R A;  3PW1 B;  3KA4 A;  5LS9 A;  2V2S A;  2V2P A;  5GN8 A;  4XKT A;  3SE1 A;  3KWO A;  3BVF A;  1GWG A;  4LQH A;  3PVT B;  1NFV A;  3E1N A;  3WNW A;  5GU3 X;  2CEI A;  3IQ1 A;  1S2Z A;  2FJC A;  1Z6O M;  5D8Q A;  5E1U A;  5LG8 A;  4CYA A;  4TW3 A;  3A68 A;  1DPS A;  1TKP A;  2CLU A;  2V2L A;  4EVD A;  3PW1 A;  3R2H A;  2CLB A;  3RD0 A;  4IWK A;  3RE7 A;  3GHQ A;  3ISE A;  2WLA A;  2Y3Q A;  3SHX A;  4A25 A;  3AF9 X;  2Z90 A;  1VJX A;  3AK8 A;  3PVT A;  3QHB A;  2Z5P A;  4E6K A;  3WVU A;  4XKU A;  3AJQ A;  5D8X A;  3FVB A;  1ZUJ A;  3AJP A;  4TOH A;  1B71 A;  1FHA A;  3RBC A;  2FHA A;  3KA6 A;  4MKU A;  4DYX A;  4TOE A;  2CHP A;  4RC6 B;  3O7R A;  4TOF A;  4CMY A;  1XZ3 A;  4LPM A;  3U90 A;  1BCF A;  3PVY B;  5D8O A;  4ZL5 A;  2ZA6 A;  1L8I A;  1LB3 A;  5C6F A;  1EUM A;  4AM4 A;  4Y08 A;  1IER A;  2BK6 A;  3RAV A;  1BG7 A;  5D8P A;  1RCD A;  3R2L A;  4ZTT A;  2YJJ A;  2QF9 A;  4AM2 A;  2HTN A;  2Z6M A;  4LQN A;  1JRE A;  1RCC A;  1KRQ A;  1JTS A;  2OH3 A;  5JKM A;  2ZG8 X;  5JKM G;  4PG0 A;  4EVE A;  3E6S A;  3E1L A;  5J93 A;  4RC6 A;  3Q4O A;  4YKH A;  2UX1 A;  4KVS A;  3Q4Q A;  1ZS3 A;  4CVP A;  3UOF A;  4CYB A;  2FG8 A; 
#chains in the Genus database with same CATH topology
 3PVY A;  2C2J A;  2YW6 A;  3FRR A;  5AXS A;  4W4K B;  3BT5 A;  1NF6 A;  2ITB A;  4LPJ A;  3F35 A;  1YV1 A;  3F39 A;  1L8H A;  2G38 B;  3AF8 X;  5HJF A;  2XJM A;  3KDQ A;  1H96 A;  3R2K A;  4CVT A;  1N1Q A;  3ISF A;  5E2D A;  4Z3B A;  2YW7 A;  3FRS A;  3KA9 A;  3C1Y A;  5CZU A;  2JD6 0;  1O9I A;  2V2N A;  5GU1 X;  5K53 A;  2CWL A;  3KXU A;  3GE4 A;  3RGD A;  4ZKW A;  2FL0 A;  2F7N A;  5JDO B;  3OGH A;  1RYT A;  3C23 A;  2V2M A;  2MGY A;  3KX9 A;  3GVY A;  1O9R A;  4PGI A;  2IY4 A;  4REU A;  5IX6 A;  4IXK A;  1SQ3 A;  1VEI A;  3PVR B;  2CN7 A;  3F34 A;  4ERU A;  1VEQ A;  1LKM A;  3IS8 A;  1Z6O A;  2RBD A;  4M35 A;  1JI4 A;  2X17 0;  3BVK A;  4EVC A;  2GYQ A;  2XJO A;  1SOF A;  2FG4 A;  4PG1 A;  2GS4 A;  2Z5Q A;  3R2R A;  3SID A;  5FEJ A;  3VNX A;  2W0O A;  4ML5 A;  3MPS A;  2ZA8 A;  3FI6 A;  1VEL A;  3JZA B;  1MOJ A;  1DAT A;  4LYU A;  4RC5 B;  2CHI A;  4Z5S A;  3H7G A;  3TA8 A;  4LQV A;  5JDO A;  3UFB A;  3E1M A;  3BVE A;  4PGK A;  4TO9 A;  2C41 A;  1IES A;  2PYB A;  2C2U A;  2V8T A;  3PVR A;  3Q4N A;  5HJH A;  5J8S A;  4RC8 A;  2V8U A;  3KA3 A;  5D8R A;  1TJO A;  4TOG A;  2G4H A;  3EGM A;  2CIH A;  2VXI A;  1YUZ A;  3PW8 C;  3AK9 A;  3BVL A;  5GU0 X;  3HL1 A;  2BJY A;  4RC7 B;  1OTK A;  3R2O A;  3ERZ A;  4MJY A;  3WVV A;  4LYX A;  4ZJK A;  4RC5 A;  2N02 A;  3BVI A;  2BKC A;  3R2S A;  4U3G A;  2V2J A;  3F37 A;  2OKC A;  4ETR A;  3UNO A;  3VVA A;  4DE6 A;  4QUW A;  2C6R A;  3NOZ X;  4II4 B;  4ZKX A;  2WLU A;  5GU2 X;  4ITW A;  4TOC A;  3E6R A;  3FSE A;  3O7S A;  4LQJ A;  1NNQ A;  1S30 A;  1RCE A;  3EZ0 A;  1RCG A;  1JGC A;  3A9Q A;  4W4L B;  2IB0 A;  2V2I A;  2D5K A;  4P18 A;  5D8Y A;  1RCI A;  4MY7 A;  2FKZ A;  2XGW A;  1LKP A;  3E1J A;  1JKU A;  5CMQ A;  3QB9 A;  1J30 A;  1TKO A;  4AM5 A;  5JKL A;  3E1Q A;  5K52 A;  4RC7 A;  5JKL G;  2Y44 A;  1F33 A;  3HIU A;  2V2O A;  1BFR A;  4YXM A;  5I4J A;  3PW8 A;  2ZG9 X;  2ZUR X;  4R42 A;  3AJO A;  3ES3 A;  1UVH A;  4DYY A;  4II4 A;  4ZL6 A;  3QVD A;  2YJK A;  2C2F A;  3PZA A;  1Z4A A;  4OYN A;  5ERJ A;  3E2C A;  5HQO A;  4ISP A;  3E1O A;  4MN9 A;  1JYB A;  4TOA A;  2OC5 A;  2V15 A;  4DAS A;  3JZ9 A;  4M33 A;  2FZF A;  2XJN A;  1HRS A;  2VXX A;  3QZ3 A;  1S3Q A;  4KVQ A;  5FFD A;  4KVR A;  1R03 A;  5CMR A;  3L0M A;  2ZA7 A;  5FFA A;  4LPN A;  5GOU A;  4TOD A;  2FFX J;  2GYD A;  4EVB A;  4CY9 A;  3F33 A;  3WVW A;  4M32 A;  1F30 A;  1QYB A;  4ISM A;  3PWQ A;  3NP0 X;  5FFE A;  5ERK A;  5J8W A;  4CVR A;  3D19 A;  5JAC A;  5LG2 A;  2V2R A;  4XKS A;  2HR5 A;  3QHC A;  4ZMC A;  3N6O A;  1VLG A;  1MFR A;  3QD8 A;  3F36 A;  3NP2 X;  3R2M A;  3AF7 X;  4DYZ A;  3E1P A;  2CN6 A;  2QQY A;  5LBH A;  3F38 A;  4DYU A;  4ZKH A;  5FFB A;  2JD7 0;  5FFC A;  4X0J A;  4DI0 A;  2CF7 A;  3KHK A;  2WWX B;  1DVB A;  3W54 A;  4YVZ A;  5D8S A;  1TK6 A;  5J9V A;  1QGH A;  3OJ5 A;  4TOB A;  4CMY V;  1LKO A;  4XGS A;  1NF4 A;  5GN8 B;  3KA8 A;  4M34 A;  4MUD A;  1JI5 A;  3EZU A;  3F32 A;  3PWF A;  1AEW A;  4CVS A;  3UOI A;  3SH6 A;  2ZG7 X;  2BW1 A;  2XKQ A;  1XZ1 A;  2VZB A;  2WTL A;  4DZ0 A;  3Q4R A;  3PWQ C;  4IWJ A;  1JIG A;  2IU2 A;  3IS7 A;  4ITT A;  2JD8 0;  3BKN A;  1YUX A;  4ZLW A;  3T9J A;  1JKV A;  1UMN A;  2Z5R A;  3PW1 B;  3KA4 A;  5LS9 A;  2V2S A;  2V2P A;  5GN8 A;  4XKT A;  3SE1 A;  3KWO A;  3BVF A;  1GWG A;  4LQH A;  3PVT B;  1NFV A;  3E1N A;  3WNW A;  3C21 A;  3GGZ A;  5GU3 X;  2CEI A;  3IQ1 A;  1S2Z A;  2FJC A;  1Z6O M;  5D8Q A;  4E40 A;  5E1U A;  5LG8 A;  4CYA A;  4TW3 A;  3A68 A;  1DPS A;  1TKP A;  2CLU A;  2V2L A;  4EVD A;  3PW1 A;  3R2H A;  2CLB A;  3RD0 A;  4IWK A;  3RE7 A;  3GHQ A;  3ISE A;  2WLA A;  2Y3Q A;  3SHX A;  4A25 A;  3AF9 X;  2Z90 A;  1VJX A;  3AK8 A;  3PVT A;  3QHB A;  2Z5P A;  4E6K A;  3WVU A;  4XKU A;  3AJQ A;  5D8X A;  4MXP A;  3FVB A;  1ZUJ A;  3AJP A;  4TOH A;  1B71 A;  1FHA A;  3RBC A;  3M6J A;  2FHA A;  3KA6 A;  4MKU A;  5HU6 D;  4DYX A;  4WJG 4;  4TOE A;  2CHP A;  4RC6 B;  3V3K B;  3O7R A;  4TOF A;  4CMY A;  1XZ3 A;  4LPM A;  3U90 A;  1BCF A;  3PVY B;  5D8O A;  2AR0 A;  3DBY A;  4ZL5 A;  2ZA6 A;  1L8I A;  1LB3 A;  5C6F A;  1EUM A;  4AM4 A;  4Y08 A;  1IER A;  2BK6 A;  3LKD A;  3RAV A;  1BG7 A;  5D8P A;  3C1Z A;  4YXJ A;  1RCD A;  3R2L A;  4ZTT A;  2YJJ A;  2QF9 A;  4AM2 A;  2HTN A;  2Z6M A;  4LQN A;  1JRE A;  1RCC A;  1KRQ A;  1JTS A;  2OH3 A;  5JKM A;  2ZG8 X;  5JKM G;  3VV9 A;  4PG0 A;  4EVE A;  3E6S A;  3E1L A;  5J93 A;  4RC6 A;  3GGY A;  3Q4O A;  4YKH A;  2UX1 A;  4KVS A;  3Q4Q A;  1ZS3 A;  4KXR B;  4CVP A;  3UOF A;  4CYB A;  2FG8 A; 
#chains in the Genus database with same CATH homology
 3PVY A;  2C2J A;  2YW6 A;  3FRR A;  5AXS A;  4W4K B;  3BT5 A;  1NF6 A;  2ITB A;  4LPJ A;  3F35 A;  1YV1 A;  3F39 A;  1L8H A;  2G38 B;  3AF8 X;  5HJF A;  2XJM A;  3KDQ A;  1H96 A;  3R2K A;  4CVT A;  1N1Q A;  3ISF A;  5E2D A;  4Z3B A;  2YW7 A;  3FRS A;  3KA9 A;  3C1Y A;  5CZU A;  2JD6 0;  1O9I A;  2V2N A;  5GU1 X;  5K53 A;  2CWL A;  3KXU A;  3GE4 A;  3RGD A;  4ZKW A;  2FL0 A;  2F7N A;  5JDO B;  3OGH A;  1RYT A;  3C23 A;  2V2M A;  2MGY A;  3KX9 A;  3GVY A;  1O9R A;  4PGI A;  2IY4 A;  4REU A;  5IX6 A;  4IXK A;  1SQ3 A;  1VEI A;  3PVR B;  2CN7 A;  3F34 A;  4ERU A;  1VEQ A;  1LKM A;  3IS8 A;  1Z6O A;  2RBD A;  4M35 A;  1JI4 A;  2X17 0;  3BVK A;  4EVC A;  2GYQ A;  2XJO A;  1SOF A;  2FG4 A;  4PG1 A;  2GS4 A;  2Z5Q A;  3R2R A;  3SID A;  5FEJ A;  3VNX A;  2W0O A;  4ML5 A;  3MPS A;  2ZA8 A;  3FI6 A;  1VEL A;  3JZA B;  1MOJ A;  1DAT A;  4LYU A;  4RC5 B;  2CHI A;  4Z5S A;  3H7G A;  3TA8 A;  4LQV A;  5JDO A;  3UFB A;  3E1M A;  3BVE A;  4PGK A;  4TO9 A;  2C41 A;  1IES A;  2PYB A;  2C2U A;  2V8T A;  3PVR A;  3Q4N A;  5HJH A;  5J8S A;  4RC8 A;  2V8U A;  3KA3 A;  5D8R A;  1TJO A;  4TOG A;  2G4H A;  3EGM A;  2CIH A;  2VXI A;  1YUZ A;  3PW8 C;  3AK9 A;  3BVL A;  5GU0 X;  3HL1 A;  2BJY A;  4RC7 B;  1OTK A;  3R2O A;  3ERZ A;  4MJY A;  3WVV A;  4LYX A;  4ZJK A;  4RC5 A;  2N02 A;  3BVI A;  2BKC A;  3R2S A;  4U3G A;  2V2J A;  3F37 A;  2OKC A;  4ETR A;  3UNO A;  3VVA A;  4DE6 A;  4QUW A;  2C6R A;  3NOZ X;  4II4 B;  4ZKX A;  2WLU A;  5GU2 X;  4ITW A;  4TOC A;  3E6R A;  3FSE A;  3O7S A;  4LQJ A;  1NNQ A;  1S30 A;  1RCE A;  3EZ0 A;  1RCG A;  1JGC A;  3A9Q A;  4W4L B;  2IB0 A;  2V2I A;  2D5K A;  4P18 A;  5D8Y A;  1RCI A;  4MY7 A;  2FKZ A;  2XGW A;  1LKP A;  3E1J A;  1JKU A;  5CMQ A;  3QB9 A;  1J30 A;  1TKO A;  4AM5 A;  5JKL A;  3E1Q A;  5K52 A;  4RC7 A;  5JKL G;  2Y44 A;  1F33 A;  3HIU A;  2V2O A;  1BFR A;  4YXM A;  5I4J A;  3PW8 A;  2ZG9 X;  2ZUR X;  4R42 A;  3AJO A;  3ES3 A;  1UVH A;  4DYY A;  4II4 A;  4ZL6 A;  3QVD A;  2YJK A;  2C2F A;  3PZA A;  1Z4A A;  4OYN A;  5ERJ A;  3E2C A;  5HQO A;  4ISP A;  3E1O A;  4MN9 A;  1JYB A;  4TOA A;  2OC5 A;  2V15 A;  4DAS A;  3JZ9 A;  4M33 A;  2FZF A;  2XJN A;  1HRS A;  2VXX A;  3QZ3 A;  1S3Q A;  4KVQ A;  5FFD A;  4KVR A;  1R03 A;  5CMR A;  3L0M A;  2ZA7 A;  5FFA A;  4LPN A;  5GOU A;  4TOD A;  2FFX J;  2GYD A;  4EVB A;  4CY9 A;  3F33 A;  3WVW A;  4M32 A;  1F30 A;  1QYB A;  4ISM A;  3PWQ A;  3NP0 X;  5FFE A;  5ERK A;  5J8W A;  4CVR A;  3D19 A;  5JAC A;  5LG2 A;  2V2R A;  4XKS A;  2HR5 A;  3QHC A;  4ZMC A;  3N6O A;  1VLG A;  1MFR A;  3QD8 A;  3F36 A;  3NP2 X;  3R2M A;  3AF7 X;  4DYZ A;  3E1P A;  2CN6 A;  2QQY A;  5LBH A;  3F38 A;  4DYU A;  4ZKH A;  5FFB A;  2JD7 0;  5FFC A;  4X0J A;  4DI0 A;  2CF7 A;  3KHK A;  2WWX B;  1DVB A;  3W54 A;  4YVZ A;  5D8S A;  1TK6 A;  5J9V A;  1QGH A;  3OJ5 A;  4TOB A;  4CMY V;  1LKO A;  4XGS A;  1NF4 A;  5GN8 B;  3KA8 A;  4M34 A;  4MUD A;  1JI5 A;  3EZU A;  3F32 A;  3PWF A;  1AEW A;  4CVS A;  3UOI A;  3SH6 A;  2ZG7 X;  2BW1 A;  2XKQ A;  1XZ1 A;  2VZB A;  2WTL A;  4DZ0 A;  3Q4R A;  3PWQ C;  4IWJ A;  1JIG A;  2IU2 A;  3IS7 A;  4ITT A;  2JD8 0;  3BKN A;  1YUX A;  4ZLW A;  3T9J A;  1JKV A;  1UMN A;  2Z5R A;  3PW1 B;  3KA4 A;  5LS9 A;  2V2S A;  2V2P A;  5GN8 A;  4XKT A;  3SE1 A;  3KWO A;  3BVF A;  1GWG A;  4LQH A;  3PVT B;  1NFV A;  3E1N A;  3WNW A;  3C21 A;  3GGZ A;  5GU3 X;  2CEI A;  3IQ1 A;  1S2Z A;  2FJC A;  1Z6O M;  5D8Q A;  4E40 A;  5E1U A;  5LG8 A;  4CYA A;  4TW3 A;  3A68 A;  1DPS A;  1TKP A;  2CLU A;  2V2L A;  4EVD A;  3PW1 A;  3R2H A;  2CLB A;  3RD0 A;  4IWK A;  3RE7 A;  3GHQ A;  3ISE A;  2WLA A;  2Y3Q A;  3SHX A;  4A25 A;  3AF9 X;  2Z90 A;  1VJX A;  3AK8 A;  3PVT A;  3QHB A;  2Z5P A;  4E6K A;  3WVU A;  4XKU A;  3AJQ A;  5D8X A;  4MXP A;  3FVB A;  1ZUJ A;  3AJP A;  4TOH A;  1B71 A;  1FHA A;  3RBC A;  3M6J A;  2FHA A;  3KA6 A;  4MKU A;  5HU6 D;  4DYX A;  4WJG 4;  4TOE A;  2CHP A;  4RC6 B;  3V3K B;  3O7R A;  4TOF A;  4CMY A;  1XZ3 A;  4LPM A;  3U90 A;  1BCF A;  3PVY B;  5D8O A;  2AR0 A;  3DBY A;  4ZL5 A;  2ZA6 A;  1L8I A;  1LB3 A;  5C6F A;  1EUM A;  4AM4 A;  4Y08 A;  1IER A;  2BK6 A;  3LKD A;  3RAV A;  1BG7 A;  5D8P A;  3C1Z A;  4YXJ A;  1RCD A;  3R2L A;  4ZTT A;  2YJJ A;  2QF9 A;  4AM2 A;  2HTN A;  2Z6M A;  4LQN A;  1JRE A;  1RCC A;  1KRQ A;  1JTS A;  2OH3 A;  5JKM A;  2ZG8 X;  5JKM G;  3VV9 A;  4PG0 A;  4EVE A;  3E6S A;  3E1L A;  5J93 A;  4RC6 A;  3GGY A;  3Q4O A;  4YKH A;  2UX1 A;  4KVS A;  3Q4Q A;  1ZS3 A;  4KXR B;  4CVP A;  3UOF A;  4CYB A;  2FG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...