1ZUJA

The crystal structure of the lactococcus lactis mg1363 dpsa protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
168
structure length
168
Chain Sequence
SIDEKYEAEVKKSEIDHHKPTAGAMLSHVLSNIFYEKISLMQAGLYAKSANYRIKFREIALKEDEWFYLISEQLLDENELVPTTLDEFVSNHKFIENDPKAKYWTDEALIENFINDFQNQNLFIGRAIKLAQKEEKFSLELAIRKLYGYNLSIIPYFAGELGKTIGEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords hypothetical protein Llacc01001955
publication title The crystal structures of Lactococcus lactis MG1363 Dps proteins reveal the presence of an N-terminal helix that is required for DNA binding.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 56
structure length 168
sequence length 168
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1zujA00
3OJ5A 5I4JA 3PZAA 3SIDA 2V2IA 5CMQA 5D8OA 1JIGA 5D8PA 5IX6A 1LKOA 2W0OA 1LKPA 3F32A 2CF7A 3QB9A 5ERJA 5J8SA 5GN8A 4DYZA 1RCCA 4TOBA 3QZ3A 3PW8A 4CY9A 4EVEA 3PW1A 2Z5RA 2OH3A 5J8WA 4RC6B 2WLAA 2YW7A 3RD0A 4DI0A 1JI4A 2BJYA 3WVVA 4AM2A 4DYUA 3AK8A 3QHCA 4KVSA 4CMYV 3BVLA 3RGDA 3F38A 2V2MA 3OGHA 4KVRA 4CVPA 1MFRA 4TOEA 3BVFA 3H7GA 3R2OA 4ETRA 2VZBA 2FHAA 3BVIA 3PWQA 4II4B 2FG8A 3F34A 4RC7A 4TODA 2Z5QA 2YJJA 3KA9A 5FFCA 3GVYA 4ZTTA 4RC6A 4TOGA 3PVYB 1QYBA 3U90A 4Y08A 4ITTA 4PGKA 5FEJA 5JKMA 1AEWA 4CVRA 3EGMA 3HL1A 1BG7A 2ITBA 3SH6A 4EVDA 3RE7A 1O9IA 4Z3BA 4ML5A 1JI5A 3BT5A 2C6RA 1NNQA 3WVWA 3MPSA 3Q4RA 4II4A 3ES3A 2CN7A 1O9RA 1F30A 3PWFA 4MKUA 2D5KA 3O7SA 2BK6A 3PVYA 5LBHA 3KX9A 2CN6A 2V2SA 1HRSA 4ZKXA 1YUXA 3A9QA 3E6SA 4PG0A 1TJOA 3R2MA 3WNWA 1L8IA 3AJPA 2ZG7X 1LKMA 4LPNA 2C2FA 4ITWA 2CIHA 1DPSA 5D8YA 5GU1X 3E1NA 1SQ3A 3IS8A 3BVKA 3F33A 3EZUA 3E2CA 4R42A 1J30A 3Q4QA 2QQYA 1JTSA 4DZ0A 3UOFA 2FKZA 4IXKA 3ERZA 3E1PA 1LB3A 1YUZA 5LG8A 3KA4A 2CLBA 4ZMCA 1S2ZA 1SOFA 5GU0X 1TK6A 4XKUA 4DYXA 1JYBA 1ZUJA 5CMRA 3FVBA 4Z5SA 1BFRA 3NP0X 3R2KA 4MY7A 1JKUA 5HJFA 4AM4A 5FFAA 3GE4A 3KA8A 4ZJKA 2Z6MA 4MN9A 4ZKHA 2BW1A 2IB0A 4EVBA 1Z4AA 5JKMG 1Z6OA 3IQ1A 4MUDA 3AF8X 3BVEA 1RCIA 5GU2X 4RC8A 2UX1A 2V15A 4TOHA 5CZUA 3BKNA 5LS9A 5HJHA 5JKLA 3E1MA 4ZL5A 3SE1A 1NF6A 4LYXA 4CMYA 5E2DA 5ERKA 3FI6A 3T9JA 2OC5A 2XGWA 3E1OA 1VJXA 2C2UA 1JGCA 3EZ0A 3SHXA 3QD8A 3E1JA 2IY4A 1TKPA 4ZLWA 1OTKA 1H96A 2C2JA 5D8SA 2HTNA 4TOCA 2YW6A 2V2JA 1VLGA 4M33A 4RC5B 2V2RA 4CVSA 3WVUA 2VXXA 3ISFA 3F35A 4TO9A 2V2PA 1QGHA 5D8XA 2GYDA 5J9VA 4LQJA 4XGSA 4DE6A 1F33A 4YKHA 3F39A 4LQHA 4REUA 1EUMA 4IWJA 3ISEA 3PVTB 3PW8C 2CEIA 2X170 3AF7X 1ZS3A 2XKQA 1DVBA 4DASA 5JACA 1RYTA 4P18A 1VELA 4IWKA 5E1UA 3UNOA 4CYBA 3R2HA 2RBDA 3PVRB 1KRQA 4EVCA 2FFXJ 3E6RA 3FSEA 3E1LA 4KVQA 2JD80 3PWQC 1JREA 2IU2A 5J93A 1R03A 1VEIA 3KA3A 3AJQA 3A68A 4M34A 2YJKA 4ERUA 3PVTA 1RCDA 4RC7B 4DYYA 2GYQA 3R2SA 3IS7A 2VXIA 4E6KA 1TKOA 2ZA7A 3F36A 2FZFA 3KXUA 4LQVA 3O7RA 5JKLG 2GS4A 4TOAA 5FFDA 4OYNA 3R2RA 3NOZX 3PVRA 3Q4NA 3QHBA 2BKCA 4XKTA 3TA8A 1JKVA 5D8RA 2HR5A 1N1QA 4ZKWA 4QUWA 2ZA8A 5K53A 5D8QA 3F37A 3GHQA 2ZURX 1VEQA 4ZL6A 4CVTA 1YV1A 5GU3X 2Z5PA 5K52A 3HIUA 1GWGA 4MJYA 5FFBA 2FL0A 1RCGA 3KA6A 1DATA 3KWOA 3RAVA 2WLUA 5C6FA 3E1QA 1IESA 5GOUA 2F7NA 1XZ1A 5LG2A 3R2LA 2CLUA 2G4HA 1B71A 3NP2X 4PG1A 2V2LA 2ZA6A 2PYBA 3VNXA 3UOIA 1NF4A 2V2NA 5FFEA 4LPMA 4M32A 3Q4OA 2ZG8X 2Y3QA 4TW3A 2V2OA 1L8HA 5HQOA 1NFVA 1MOJA 2JD60 3AF9X 4U3GA 1S3QA 4M35A 1RCEA 2XJNA 4A25A 1IERA 4PGIA 3RBCA 4LQNA 2CHPA 1BCFA 2XJOA 4ISMA 1UVHA 5AXSA 4LPJA 4XKSA 2Z90A 2FG4A 1XZ3A 2CHIA 2WTLA 3AK9A 5GN8B 1UMNA 2ZG9X 3PW1B 4LYUA 1S30A 3QVDA 4RC5A 4CYAA 2QF9A 2JD70 2C41A 2XJMA 4TOFA 2FJCA 1Z6OM 4AM5A 3AJOA 1FHAA 4ISPA
chains in the Genus database with same CATH superfamily
3OJ5A 5I4JA 3PZAA 3SIDA 2V2IA 5CMQA 5D8OA 1JIGA 3DBYA 5D8PA 5IX6A 1LKOA 2W0OA 1LKPA 3F32A 2CF7A 3QB9A 5ERJA 5J8SA 2MGYA 5GN8A 4DYZA 1RCCA 4TOBA 3QZ3A 3PW8A 4CY9A 4EVEA 3PW1A 2Z5RA 4YXMA 2OH3A 5J8WA 4RC6B 3FRSA 2WLAA 2OKCA 2YW7A 3RD0A 5JDOA 4DI0A 1JI4A 2BJYA 3WVVA 4AM2A 4DYUA 3AK8A 3QHCA 4KVSA 4CMYV 3BVLA 3RGDA 2G38B 3F38A 2V2MA 3OGHA 4KVRA 4CVPA 1MFRA 4TOEA 3BVFA 3H7GA 3R2OA 4ETRA 2VZBA 2FHAA 3BVIA 3PWQA 4II4B 2FG8A 3F34A 4RC7A 4TODA 2Z5QA 2YJJA 3KA9A 5FFCA 3GVYA 4ZTTA 4RC6A 4TOGA 3PVYB 1QYBA 3U90A 4Y08A 4ITTA 4PGKA 5FEJA 5JKMA 1AEWA 4CVRA 3EGMA 3HL1A 1BG7A 2ITBA 3N6OA 3SH6A 4EVDA 3RE7A 1O9IA 4Z3BA 4ML5A 1JI5A 3BT5A 2C6RA 1NNQA 3WVWA 3MPSA 3Q4RA 4II4A 3ES3A 2CN7A 1O9RA 1F30A 3KDQA 3PWFA 4MKUA 2D5KA 3O7SA 2BK6A 2CWLA 3PVYA 5LBHA 3KX9A 2CN6A 2V2SA 1HRSA 4ZKXA 1YUXA 3A9QA 3E6SA 4PG0A 1TJOA 3R2MA 3WNWA 1L8IA 3KHKA 3AJPA 2N02A 2ZG7X 1LKMA 4LPNA 2C2FA 4ITWA 2CIHA 1DPSA 5D8YA 4W4KB 5GU1X 3E1NA 1SQ3A 3IS8A 3BVKA 3F33A 3EZUA 3E2CA 4R42A 1J30A 3Q4QA 2QQYA 1JTSA 2Y44A 4DZ0A 3UOFA 2FKZA 4IXKA 3ERZA 3E1PA 1LB3A 1YUZA 5LG8A 3KA4A 2CLBA 4ZMCA 3C23A 1S2ZA 1SOFA 5GU0X 3C1ZA 1TK6A 4XKUA 4DYXA 3D19A 3W54A 1JYBA 1ZUJA 5CMRA 3FVBA 4Z5SA 1BFRA 3NP0X 3R2KA 4MY7A 1JKUA 2V8TA 5HJFA 4AM4A 5FFAA 3GE4A 3KA8A 4ZJKA 2Z6MA 4MN9A 4ZKHA 3VV9A 2BW1A 2IB0A 4EVBA 1Z4AA 3GGZA 2AR0A 5JKMG 1Z6OA 3IQ1A 4MUDA 3AF8X 3BVEA 1RCIA 5GU2X 4RC8A 4X0JA 2UX1A 2V15A 4TOHA 5CZUA 3BKNA 5LS9A 5HJHA 5JKLA 3E1MA 4ZL5A 3SE1A 1NF6A 4LYXA 3JZAB 4CMYA 5E2DA 5ERKA 3FI6A 3T9JA 2OC5A 2XGWA 3L0MA 3E1OA 1VJXA 2C2UA 1JGCA 3EZ0A 3SHXA 3QD8A 3E1JA 2IY4A 1TKPA 4ZLWA 4YXJA 1OTKA 1H96A 2C2JA 5HU6D 5D8SA 2HTNA 4TOCA 2YW6A 2V2JA 1VLGA 2WWXB 4M33A 4RC5B 2V2RA 4CVSA 3WVUA 2VXXA 3ISFA 3F35A 4TO9A 2V2PA 1QGHA 3M6JA 3LKDA 5D8XA 2GYDA 5J9VA 4LQJA 4XGSA 3JZ9A 4DE6A 1F33A 2V8UA 4YKHA 3F39A 4LQHA 4REUA 3UFBA 1EUMA 4IWJA 3ISEA 3PVTB 3PW8C 2CEIA 2X170 3AF7X 1ZS3A 2XKQA 1DVBA 4DASA 5JACA 1RYTA 4P18A 1VELA 3C1YA 4IWKA 5E1UA 3UNOA 3VVAA 4CYBA 3R2HA 2RBDA 3PVRB 1KRQA 4EVCA 2FFXJ 3E6RA 3FSEA 4KVQA 3E1LA 2JD80 3PWQC 1JREA 2IU2A 5J93A 1R03A 1VEIA 3KA3A 3AJQA 4W4LB 3A68A 4M34A 2YJKA 4ERUA 3PVTA 1RCDA 4RC7B 4WJG4 4DYYA 2GYQA 3R2SA 4E40A 3IS7A 2VXIA 4E6KA 1TKOA 2ZA7A 3F36A 2FZFA 3KXUA 4LQVA 3O7RA 5JKLG 2GS4A 4YVZA 4TOAA 5FFDA 4OYNA 3R2RA 3NOZX 3PVRA 3Q4NA 3QHBA 2BKCA 4XKTA 3TA8A 1JKVA 5D8RA 2HR5A 1N1QA 4ZKWA 4QUWA 2ZA8A 5K53A 5D8QA 3F37A 3GHQA 2ZURX 1VEQA 4ZL6A 4CVTA 1YV1A 5GU3X 2Z5PA 5K52A 3HIUA 1GWGA 3FRRA 4MJYA 5FFBA 2FL0A 1RCGA 3KA6A 1DATA 3KWOA 3RAVA 2WLUA 5C6FA 3E1QA 1IESA 5GOUA 2F7NA 1XZ1A 5LG2A 3R2LA 2CLUA 2G4HA 1B71A 3NP2X 4PG1A 2V2LA 2ZA6A 2PYBA 3VNXA 3UOIA 4MXPA 1NF4A 2V2NA 5FFEA 4LPMA 4M32A 3Q4OA 2ZG8X 2Y3QA 4TW3A 2V2OA 1L8HA 5HQOA 1NFVA 4KXRB 1MOJA 2JD60 3AF9X 4U3GA 1S3QA 4M35A 1RCEA 2XJNA 4A25A 1IERA 4PGIA 3RBCA 4LQNA 2CHPA 1BCFA 2XJOA 4ISMA 1UVHA 5AXSA 3GGYA 4LPJA 4XKSA 2Z90A 2FG4A 1XZ3A 2CHIA 3C21A 2WTLA 3AK9A 5GN8B 1UMNA 2ZG9X 3PW1B 4LYUA 1S30A 3QVDA 4RC5A 4CYAA 2QF9A 2JD70 2C41A 2XJMA 4TOFA 2FJCA 3V3KB 1Z6OM 4AM5A 5JDOB 3AJOA 1FHAA 4ISPA
chains in the Genus database with same CATH topology
3OJ5A 5I4JA 3PZAA 3SIDA 2V2IA 5CMQA 5D8OA 1JIGA 3DBYA 5D8PA 5IX6A 1LKOA 2W0OA 1LKPA 3F32A 2CF7A 3QB9A 5ERJA 5J8SA 2MGYA 5GN8A 4DYZA 1RCCA 4TOBA 3QZ3A 3PW8A 4CY9A 4EVEA 3PW1A 2Z5RA 4YXMA 2OH3A 5J8WA 4RC6B 3FRSA 2WLAA 2OKCA 2YW7A 3RD0A 5JDOA 4DI0A 1JI4A 2BJYA 3WVVA 4AM2A 4DYUA 3AK8A 3QHCA 4KVSA 4CMYV 3BVLA 3RGDA 2G38B 3F38A 2V2MA 3OGHA 4KVRA 4CVPA 1MFRA 4TOEA 3BVFA 3H7GA 3R2OA 4ETRA 2VZBA 2FHAA 3BVIA 3PWQA 4II4B 2FG8A 3F34A 4RC7A 4TODA 2Z5QA 2YJJA 3KA9A 5FFCA 3GVYA 4ZTTA 4RC6A 4TOGA 3PVYB 1QYBA 3U90A 4Y08A 4ITTA 4PGKA 5FEJA 5JKMA 1AEWA 4CVRA 3EGMA 3HL1A 1BG7A 2ITBA 3N6OA 3SH6A 4EVDA 3RE7A 1O9IA 4Z3BA 4ML5A 1JI5A 3BT5A 2C6RA 1NNQA 3WVWA 3MPSA 3Q4RA 4II4A 3ES3A 2CN7A 1O9RA 1F30A 3KDQA 3PWFA 4MKUA 2D5KA 3O7SA 2BK6A 2CWLA 3PVYA 5LBHA 3KX9A 2CN6A 2V2SA 1HRSA 4ZKXA 1YUXA 3A9QA 3E6SA 4PG0A 1TJOA 3R2MA 3WNWA 1L8IA 3KHKA 3AJPA 2N02A 2ZG7X 1LKMA 4LPNA 2C2FA 4ITWA 2CIHA 1DPSA 5D8YA 4W4KB 5GU1X 3E1NA 1SQ3A 3IS8A 3BVKA 3F33A 3EZUA 3E2CA 4R42A 1J30A 3Q4QA 2QQYA 1JTSA 2Y44A 4DZ0A 3UOFA 2FKZA 4IXKA 3ERZA 3E1PA 1LB3A 1YUZA 5LG8A 3KA4A 2CLBA 4ZMCA 3C23A 1S2ZA 1SOFA 5GU0X 3C1ZA 1TK6A 4XKUA 4DYXA 3D19A 3W54A 1JYBA 1ZUJA 5CMRA 3FVBA 4Z5SA 1BFRA 3NP0X 3R2KA 4MY7A 1JKUA 2V8TA 5HJFA 4AM4A 5FFAA 3GE4A 3KA8A 4ZJKA 2Z6MA 4MN9A 4ZKHA 3VV9A 2BW1A 2IB0A 4EVBA 1Z4AA 3GGZA 2AR0A 5JKMG 1Z6OA 3IQ1A 4MUDA 3AF8X 3BVEA 1RCIA 5GU2X 4RC8A 4X0JA 2UX1A 2V15A 4TOHA 5CZUA 3BKNA 5LS9A 5HJHA 5JKLA 3E1MA 4ZL5A 3SE1A 1NF6A 4LYXA 3JZAB 4CMYA 5E2DA 5ERKA 3FI6A 3T9JA 2OC5A 2XGWA 3L0MA 3E1OA 1VJXA 2C2UA 1JGCA 3EZ0A 3SHXA 3QD8A 3E1JA 2IY4A 1TKPA 4ZLWA 4YXJA 1OTKA 1H96A 2C2JA 5HU6D 5D8SA 2HTNA 4TOCA 2YW6A 2V2JA 1VLGA 2WWXB 4M33A 4RC5B 2V2RA 4CVSA 3WVUA 2VXXA 3ISFA 3F35A 4TO9A 2V2PA 1QGHA 3M6JA 3LKDA 5D8XA 2GYDA 5J9VA 4LQJA 4XGSA 3JZ9A 4DE6A 1F33A 2V8UA 4YKHA 3F39A 4LQHA 4REUA 3UFBA 1EUMA 4IWJA 3ISEA 3PVTB 3PW8C 2CEIA 2X170 3AF7X 1ZS3A 2XKQA 1DVBA 4DASA 5JACA 1RYTA 4P18A 1VELA 3C1YA 4IWKA 5E1UA 3UNOA 3VVAA 4CYBA 3R2HA 2RBDA 3PVRB 1KRQA 4EVCA 2FFXJ 3E6RA 3FSEA 4KVQA 3E1LA 2JD80 3PWQC 1JREA 2IU2A 5J93A 1R03A 1VEIA 3KA3A 3AJQA 4W4LB 3A68A 4M34A 2YJKA 4ERUA 3PVTA 1RCDA 4RC7B 4WJG4 4DYYA 2GYQA 3R2SA 4E40A 3IS7A 2VXIA 4E6KA 1TKOA 2ZA7A 3F36A 2FZFA 3KXUA 4LQVA 3O7RA 5JKLG 2GS4A 4YVZA 4TOAA 5FFDA 4OYNA 3R2RA 3NOZX 3PVRA 3Q4NA 3QHBA 2BKCA 4XKTA 3TA8A 1JKVA 5D8RA 2HR5A 1N1QA 4ZKWA 4QUWA 2ZA8A 5K53A 5D8QA 3F37A 3GHQA 2ZURX 1VEQA 4ZL6A 4CVTA 1YV1A 5GU3X 2Z5PA 5K52A 3HIUA 1GWGA 3FRRA 4MJYA 5FFBA 2FL0A 1RCGA 3KA6A 1DATA 3KWOA 3RAVA 2WLUA 5C6FA 3E1QA 1IESA 5GOUA 2F7NA 1XZ1A 5LG2A 3R2LA 2CLUA 2G4HA 1B71A 3NP2X 4PG1A 2V2LA 2ZA6A 2PYBA 3VNXA 3UOIA 4MXPA 1NF4A 2V2NA 5FFEA 4LPMA 4M32A 3Q4OA 2ZG8X 2Y3QA 4TW3A 2V2OA 1L8HA 5HQOA 1NFVA 4KXRB 1MOJA 2JD60 3AF9X 4U3GA 1S3QA 4M35A 1RCEA 2XJNA 4A25A 1IERA 4PGIA 3RBCA 4LQNA 2CHPA 1BCFA 2XJOA 4ISMA 1UVHA 5AXSA 3GGYA 4LPJA 4XKSA 2Z90A 2FG4A 1XZ3A 2CHIA 3C21A 2WTLA 3AK9A 5GN8B 1UMNA 2ZG9X 3PW1B 4LYUA 1S30A 3QVDA 4RC5A 4CYAA 2QF9A 2JD70 2C41A 2XJMA 4TOFA 2FJCA 3V3KB 1Z6OM 4AM5A 5JDOB 3AJOA 1FHAA 4ISPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJ5 A;  5I4J A;  3PZA A;  3SID A;  2V2I A;  5CMQ A;  5D8O A;  1JIG A;  5D8P A;  5IX6 A;  1LKO A;  2W0O A;  1LKP A;  3F32 A;  2CF7 A;  3QB9 A;  5ERJ A;  5J8S A;  5GN8 A;  4DYZ A;  1RCC A;  4TOB A;  3QZ3 A;  3PW8 A;  4CY9 A;  4EVE A;  3PW1 A;  2Z5R A;  2OH3 A;  5J8W A;  4RC6 B;  2WLA A;  2YW7 A;  3RD0 A;  4DI0 A;  1JI4 A;  2BJY A;  3WVV A;  4AM2 A;  4DYU A;  3AK8 A;  3QHC A;  4KVS A;  4CMY V;  3BVL A;  3RGD A;  3F38 A;  2V2M A;  3OGH A;  4KVR A;  4CVP A;  1MFR A;  4TOE A;  3BVF A;  3H7G A;  3R2O A;  4ETR A;  2VZB A;  2FHA A;  3BVI A;  3PWQ A;  4II4 B;  2FG8 A;  3F34 A;  4RC7 A;  4TOD A;  2Z5Q A;  2YJJ A;  3KA9 A;  5FFC A;  3GVY A;  4ZTT A;  4RC6 A;  4TOG A;  3PVY B;  1QYB A;  3U90 A;  4Y08 A;  4ITT A;  4PGK A;  5FEJ A;  5JKM A;  1AEW A;  4CVR A;  3EGM A;  3HL1 A;  1BG7 A;  2ITB A;  3SH6 A;  4EVD A;  3RE7 A;  1O9I A;  4Z3B A;  4ML5 A;  1JI5 A;  3BT5 A;  2C6R A;  1NNQ A;  3WVW A;  3MPS A;  3Q4R A;  4II4 A;  3ES3 A;  2CN7 A;  1O9R A;  1F30 A;  3PWF A;  4MKU A;  2D5K A;  3O7S A;  2BK6 A;  3PVY A;  5LBH A;  3KX9 A;  2CN6 A;  2V2S A;  1HRS A;  4ZKX A;  1YUX A;  3A9Q A;  3E6S A;  4PG0 A;  1TJO A;  3R2M A;  3WNW A;  1L8I A;  3AJP A;  2ZG7 X;  1LKM A;  4LPN A;  2C2F A;  4ITW A;  2CIH A;  1DPS A;  5D8Y A;  5GU1 X;  3E1N A;  1SQ3 A;  3IS8 A;  3BVK A;  3F33 A;  3EZU A;  3E2C A;  4R42 A;  1J30 A;  3Q4Q A;  2QQY A;  1JTS A;  4DZ0 A;  3UOF A;  2FKZ A;  4IXK A;  3ERZ A;  3E1P A;  1LB3 A;  1YUZ A;  5LG8 A;  3KA4 A;  2CLB A;  4ZMC A;  1S2Z A;  1SOF A;  5GU0 X;  1TK6 A;  4XKU A;  4DYX A;  1JYB A;  1ZUJ A;  5CMR A;  3FVB A;  4Z5S A;  1BFR A;  3NP0 X;  3R2K A;  4MY7 A;  1JKU A;  5HJF A;  4AM4 A;  5FFA A;  3GE4 A;  3KA8 A;  4ZJK A;  2Z6M A;  4MN9 A;  4ZKH A;  2BW1 A;  2IB0 A;  4EVB A;  1Z4A A;  5JKM G;  1Z6O A;  3IQ1 A;  4MUD A;  3AF8 X;  3BVE A;  1RCI A;  5GU2 X;  4RC8 A;  2UX1 A;  2V15 A;  4TOH A;  5CZU A;  3BKN A;  5LS9 A;  5HJH A;  5JKL A;  3E1M A;  4ZL5 A;  3SE1 A;  1NF6 A;  4LYX A;  4CMY A;  5E2D A;  5ERK A;  3FI6 A;  3T9J A;  2OC5 A;  2XGW A;  3E1O A;  1VJX A;  2C2U A;  1JGC A;  3EZ0 A;  3SHX A;  3QD8 A;  3E1J A;  2IY4 A;  1TKP A;  4ZLW A;  1OTK A;  1H96 A;  2C2J A;  5D8S A;  2HTN A;  4TOC A;  2YW6 A;  2V2J A;  1VLG A;  4M33 A;  4RC5 B;  2V2R A;  4CVS A;  3WVU A;  2VXX A;  3ISF A;  3F35 A;  4TO9 A;  2V2P A;  1QGH A;  5D8X A;  2GYD A;  5J9V A;  4LQJ A;  4XGS A;  4DE6 A;  1F33 A;  4YKH A;  3F39 A;  4LQH A;  4REU A;  1EUM A;  4IWJ A;  3ISE A;  3PVT B;  3PW8 C;  2CEI A;  2X17 0;  3AF7 X;  1ZS3 A;  2XKQ A;  1DVB A;  4DAS A;  5JAC A;  1RYT A;  4P18 A;  1VEL A;  4IWK A;  5E1U A;  3UNO A;  4CYB A;  3R2H A;  2RBD A;  3PVR B;  1KRQ A;  4EVC A;  2FFX J;  3E6R A;  3FSE A;  3E1L A;  4KVQ A;  2JD8 0;  3PWQ C;  1JRE A;  2IU2 A;  5J93 A;  1R03 A;  1VEI A;  3KA3 A;  3AJQ A;  3A68 A;  4M34 A;  2YJK A;  4ERU A;  3PVT A;  1RCD A;  4RC7 B;  4DYY A;  2GYQ A;  3R2S A;  3IS7 A;  2VXI A;  4E6K A;  1TKO A;  2ZA7 A;  3F36 A;  2FZF A;  3KXU A;  4LQV A;  3O7R A;  5JKL G;  2GS4 A;  4TOA A;  5FFD A;  4OYN A;  3R2R A;  3NOZ X;  3PVR A;  3Q4N A;  3QHB A;  2BKC A;  4XKT A;  3TA8 A;  1JKV A;  5D8R A;  2HR5 A;  1N1Q A;  4ZKW A;  4QUW A;  2ZA8 A;  5K53 A;  5D8Q A;  3F37 A;  3GHQ A;  2ZUR X;  1VEQ A;  4ZL6 A;  4CVT A;  1YV1 A;  5GU3 X;  2Z5P A;  5K52 A;  3HIU A;  1GWG A;  4MJY A;  5FFB A;  2FL0 A;  1RCG A;  3KA6 A;  1DAT A;  3KWO A;  3RAV A;  2WLU A;  5C6F A;  3E1Q A;  1IES A;  5GOU A;  2F7N A;  1XZ1 A;  5LG2 A;  3R2L A;  2CLU A;  2G4H A;  1B71 A;  3NP2 X;  4PG1 A;  2V2L A;  2ZA6 A;  2PYB A;  3VNX A;  3UOI A;  1NF4 A;  2V2N A;  5FFE A;  4LPM A;  4M32 A;  3Q4O A;  2ZG8 X;  2Y3Q A;  4TW3 A;  2V2O A;  1L8H A;  5HQO A;  1NFV A;  1MOJ A;  2JD6 0;  3AF9 X;  4U3G A;  1S3Q A;  4M35 A;  1RCE A;  2XJN A;  4A25 A;  1IER A;  4PGI A;  3RBC A;  4LQN A;  2CHP A;  1BCF A;  2XJO A;  4ISM A;  1UVH A;  5AXS A;  4LPJ A;  4XKS A;  2Z90 A;  2FG4 A;  1XZ3 A;  2CHI A;  2WTL A;  3AK9 A;  5GN8 B;  1UMN A;  2ZG9 X;  3PW1 B;  4LYU A;  1S30 A;  3QVD A;  4RC5 A;  4CYA A;  2QF9 A;  2JD7 0;  2C41 A;  2XJM A;  4TOF A;  2FJC A;  1Z6O M;  4AM5 A;  3AJO A;  1FHA A;  4ISP A; 
#chains in the Genus database with same CATH topology
 3OJ5 A;  5I4J A;  3PZA A;  3SID A;  2V2I A;  5CMQ A;  5D8O A;  1JIG A;  3DBY A;  5D8P A;  5IX6 A;  1LKO A;  2W0O A;  1LKP A;  3F32 A;  2CF7 A;  3QB9 A;  5ERJ A;  5J8S A;  2MGY A;  5GN8 A;  4DYZ A;  1RCC A;  4TOB A;  3QZ3 A;  3PW8 A;  4CY9 A;  4EVE A;  3PW1 A;  2Z5R A;  4YXM A;  2OH3 A;  5J8W A;  4RC6 B;  3FRS A;  2WLA A;  2OKC A;  2YW7 A;  3RD0 A;  5JDO A;  4DI0 A;  1JI4 A;  2BJY A;  3WVV A;  4AM2 A;  4DYU A;  3AK8 A;  3QHC A;  4KVS A;  4CMY V;  3BVL A;  3RGD A;  2G38 B;  3F38 A;  2V2M A;  3OGH A;  4KVR A;  4CVP A;  1MFR A;  4TOE A;  3BVF A;  3H7G A;  3R2O A;  4ETR A;  2VZB A;  2FHA A;  3BVI A;  3PWQ A;  4II4 B;  2FG8 A;  3F34 A;  4RC7 A;  4TOD A;  2Z5Q A;  2YJJ A;  3KA9 A;  5FFC A;  3GVY A;  4ZTT A;  4RC6 A;  4TOG A;  3PVY B;  1QYB A;  3U90 A;  4Y08 A;  4ITT A;  4PGK A;  5FEJ A;  5JKM A;  1AEW A;  4CVR A;  3EGM A;  3HL1 A;  1BG7 A;  2ITB A;  3N6O A;  3SH6 A;  4EVD A;  3RE7 A;  1O9I A;  4Z3B A;  4ML5 A;  1JI5 A;  3BT5 A;  2C6R A;  1NNQ A;  3WVW A;  3MPS A;  3Q4R A;  4II4 A;  3ES3 A;  2CN7 A;  1O9R A;  1F30 A;  3KDQ A;  3PWF A;  4MKU A;  2D5K A;  3O7S A;  2BK6 A;  2CWL A;  3PVY A;  5LBH A;  3KX9 A;  2CN6 A;  2V2S A;  1HRS A;  4ZKX A;  1YUX A;  3A9Q A;  3E6S A;  4PG0 A;  1TJO A;  3R2M A;  3WNW A;  1L8I A;  3KHK A;  3AJP A;  2N02 A;  2ZG7 X;  1LKM A;  4LPN A;  2C2F A;  4ITW A;  2CIH A;  1DPS A;  5D8Y A;  4W4K B;  5GU1 X;  3E1N A;  1SQ3 A;  3IS8 A;  3BVK A;  3F33 A;  3EZU A;  3E2C A;  4R42 A;  1J30 A;  3Q4Q A;  2QQY A;  1JTS A;  2Y44 A;  4DZ0 A;  3UOF A;  2FKZ A;  4IXK A;  3ERZ A;  3E1P A;  1LB3 A;  1YUZ A;  5LG8 A;  3KA4 A;  2CLB A;  4ZMC A;  3C23 A;  1S2Z A;  1SOF A;  5GU0 X;  3C1Z A;  1TK6 A;  4XKU A;  4DYX A;  3D19 A;  3W54 A;  1JYB A;  1ZUJ A;  5CMR A;  3FVB A;  4Z5S A;  1BFR A;  3NP0 X;  3R2K A;  4MY7 A;  1JKU A;  2V8T A;  5HJF A;  4AM4 A;  5FFA A;  3GE4 A;  3KA8 A;  4ZJK A;  2Z6M A;  4MN9 A;  4ZKH A;  3VV9 A;  2BW1 A;  2IB0 A;  4EVB A;  1Z4A A;  3GGZ A;  2AR0 A;  5JKM G;  1Z6O A;  3IQ1 A;  4MUD A;  3AF8 X;  3BVE A;  1RCI A;  5GU2 X;  4RC8 A;  4X0J A;  2UX1 A;  2V15 A;  4TOH A;  5CZU A;  3BKN A;  5LS9 A;  5HJH A;  5JKL A;  3E1M A;  4ZL5 A;  3SE1 A;  1NF6 A;  4LYX A;  3JZA B;  4CMY A;  5E2D A;  5ERK A;  3FI6 A;  3T9J A;  2OC5 A;  2XGW A;  3L0M A;  3E1O A;  1VJX A;  2C2U A;  1JGC A;  3EZ0 A;  3SHX A;  3QD8 A;  3E1J A;  2IY4 A;  1TKP A;  4ZLW A;  4YXJ A;  1OTK A;  1H96 A;  2C2J A;  5HU6 D;  5D8S A;  2HTN A;  4TOC A;  2YW6 A;  2V2J A;  1VLG A;  2WWX B;  4M33 A;  4RC5 B;  2V2R A;  4CVS A;  3WVU A;  2VXX A;  3ISF A;  3F35 A;  4TO9 A;  2V2P A;  1QGH A;  3M6J A;  3LKD A;  5D8X A;  2GYD A;  5J9V A;  4LQJ A;  4XGS A;  3JZ9 A;  4DE6 A;  1F33 A;  2V8U A;  4YKH A;  3F39 A;  4LQH A;  4REU A;  3UFB A;  1EUM A;  4IWJ A;  3ISE A;  3PVT B;  3PW8 C;  2CEI A;  2X17 0;  3AF7 X;  1ZS3 A;  2XKQ A;  1DVB A;  4DAS A;  5JAC A;  1RYT A;  4P18 A;  1VEL A;  3C1Y A;  4IWK A;  5E1U A;  3UNO A;  3VVA A;  4CYB A;  3R2H A;  2RBD A;  3PVR B;  1KRQ A;  4EVC A;  2FFX J;  3E6R A;  3FSE A;  4KVQ A;  3E1L A;  2JD8 0;  3PWQ C;  1JRE A;  2IU2 A;  5J93 A;  1R03 A;  1VEI A;  3KA3 A;  3AJQ A;  4W4L B;  3A68 A;  4M34 A;  2YJK A;  4ERU A;  3PVT A;  1RCD A;  4RC7 B;  4WJG 4;  4DYY A;  2GYQ A;  3R2S A;  4E40 A;  3IS7 A;  2VXI A;  4E6K A;  1TKO A;  2ZA7 A;  3F36 A;  2FZF A;  3KXU A;  4LQV A;  3O7R A;  5JKL G;  2GS4 A;  4YVZ A;  4TOA A;  5FFD A;  4OYN A;  3R2R A;  3NOZ X;  3PVR A;  3Q4N A;  3QHB A;  2BKC A;  4XKT A;  3TA8 A;  1JKV A;  5D8R A;  2HR5 A;  1N1Q A;  4ZKW A;  4QUW A;  2ZA8 A;  5K53 A;  5D8Q A;  3F37 A;  3GHQ A;  2ZUR X;  1VEQ A;  4ZL6 A;  4CVT A;  1YV1 A;  5GU3 X;  2Z5P A;  5K52 A;  3HIU A;  1GWG A;  3FRR A;  4MJY A;  5FFB A;  2FL0 A;  1RCG A;  3KA6 A;  1DAT A;  3KWO A;  3RAV A;  2WLU A;  5C6F A;  3E1Q A;  1IES A;  5GOU A;  2F7N A;  1XZ1 A;  5LG2 A;  3R2L A;  2CLU A;  2G4H A;  1B71 A;  3NP2 X;  4PG1 A;  2V2L A;  2ZA6 A;  2PYB A;  3VNX A;  3UOI A;  4MXP A;  1NF4 A;  2V2N A;  5FFE A;  4LPM A;  4M32 A;  3Q4O A;  2ZG8 X;  2Y3Q A;  4TW3 A;  2V2O A;  1L8H A;  5HQO A;  1NFV A;  4KXR B;  1MOJ A;  2JD6 0;  3AF9 X;  4U3G A;  1S3Q A;  4M35 A;  1RCE A;  2XJN A;  4A25 A;  1IER A;  4PGI A;  3RBC A;  4LQN A;  2CHP A;  1BCF A;  2XJO A;  4ISM A;  1UVH A;  5AXS A;  3GGY A;  4LPJ A;  4XKS A;  2Z90 A;  2FG4 A;  1XZ3 A;  2CHI A;  3C21 A;  2WTL A;  3AK9 A;  5GN8 B;  1UMN A;  2ZG9 X;  3PW1 B;  4LYU A;  1S30 A;  3QVD A;  4RC5 A;  4CYA A;  2QF9 A;  2JD7 0;  2C41 A;  2XJM A;  4TOF A;  2FJC A;  3V3K B;  1Z6O M;  4AM5 A;  5JDO B;  3AJO A;  1FHA A;  4ISP A; 
#chains in the Genus database with same CATH homology
 3OJ5 A;  5I4J A;  3PZA A;  3SID A;  2V2I A;  5CMQ A;  5D8O A;  1JIG A;  3DBY A;  5D8P A;  5IX6 A;  1LKO A;  2W0O A;  1LKP A;  3F32 A;  2CF7 A;  3QB9 A;  5ERJ A;  5J8S A;  2MGY A;  5GN8 A;  4DYZ A;  1RCC A;  4TOB A;  3QZ3 A;  3PW8 A;  4CY9 A;  4EVE A;  3PW1 A;  2Z5R A;  4YXM A;  2OH3 A;  5J8W A;  4RC6 B;  3FRS A;  2WLA A;  2OKC A;  2YW7 A;  3RD0 A;  5JDO A;  4DI0 A;  1JI4 A;  2BJY A;  3WVV A;  4AM2 A;  4DYU A;  3AK8 A;  3QHC A;  4KVS A;  4CMY V;  3BVL A;  3RGD A;  2G38 B;  3F38 A;  2V2M A;  3OGH A;  4KVR A;  4CVP A;  1MFR A;  4TOE A;  3BVF A;  3H7G A;  3R2O A;  4ETR A;  2VZB A;  2FHA A;  3BVI A;  3PWQ A;  4II4 B;  2FG8 A;  3F34 A;  4RC7 A;  4TOD A;  2Z5Q A;  2YJJ A;  3KA9 A;  5FFC A;  3GVY A;  4ZTT A;  4RC6 A;  4TOG A;  3PVY B;  1QYB A;  3U90 A;  4Y08 A;  4ITT A;  4PGK A;  5FEJ A;  5JKM A;  1AEW A;  4CVR A;  3EGM A;  3HL1 A;  1BG7 A;  2ITB A;  3N6O A;  3SH6 A;  4EVD A;  3RE7 A;  1O9I A;  4Z3B A;  4ML5 A;  1JI5 A;  3BT5 A;  2C6R A;  1NNQ A;  3WVW A;  3MPS A;  3Q4R A;  4II4 A;  3ES3 A;  2CN7 A;  1O9R A;  1F30 A;  3KDQ A;  3PWF A;  4MKU A;  2D5K A;  3O7S A;  2BK6 A;  2CWL A;  3PVY A;  5LBH A;  3KX9 A;  2CN6 A;  2V2S A;  1HRS A;  4ZKX A;  1YUX A;  3A9Q A;  3E6S A;  4PG0 A;  1TJO A;  3R2M A;  3WNW A;  1L8I A;  3KHK A;  3AJP A;  2N02 A;  2ZG7 X;  1LKM A;  4LPN A;  2C2F A;  4ITW A;  2CIH A;  1DPS A;  5D8Y A;  4W4K B;  5GU1 X;  3E1N A;  1SQ3 A;  3IS8 A;  3BVK A;  3F33 A;  3EZU A;  3E2C A;  4R42 A;  1J30 A;  3Q4Q A;  2QQY A;  1JTS A;  2Y44 A;  4DZ0 A;  3UOF A;  2FKZ A;  4IXK A;  3ERZ A;  3E1P A;  1LB3 A;  1YUZ A;  5LG8 A;  3KA4 A;  2CLB A;  4ZMC A;  3C23 A;  1S2Z A;  1SOF A;  5GU0 X;  3C1Z A;  1TK6 A;  4XKU A;  4DYX A;  3D19 A;  3W54 A;  1JYB A;  1ZUJ A;  5CMR A;  3FVB A;  4Z5S A;  1BFR A;  3NP0 X;  3R2K A;  4MY7 A;  1JKU A;  2V8T A;  5HJF A;  4AM4 A;  5FFA A;  3GE4 A;  3KA8 A;  4ZJK A;  2Z6M A;  4MN9 A;  4ZKH A;  3VV9 A;  2BW1 A;  2IB0 A;  4EVB A;  1Z4A A;  3GGZ A;  2AR0 A;  5JKM G;  1Z6O A;  3IQ1 A;  4MUD A;  3AF8 X;  3BVE A;  1RCI A;  5GU2 X;  4RC8 A;  4X0J A;  2UX1 A;  2V15 A;  4TOH A;  5CZU A;  3BKN A;  5LS9 A;  5HJH A;  5JKL A;  3E1M A;  4ZL5 A;  3SE1 A;  1NF6 A;  4LYX A;  3JZA B;  4CMY A;  5E2D A;  5ERK A;  3FI6 A;  3T9J A;  2OC5 A;  2XGW A;  3L0M A;  3E1O A;  1VJX A;  2C2U A;  1JGC A;  3EZ0 A;  3SHX A;  3QD8 A;  3E1J A;  2IY4 A;  1TKP A;  4ZLW A;  4YXJ A;  1OTK A;  1H96 A;  2C2J A;  5HU6 D;  5D8S A;  2HTN A;  4TOC A;  2YW6 A;  2V2J A;  1VLG A;  2WWX B;  4M33 A;  4RC5 B;  2V2R A;  4CVS A;  3WVU A;  2VXX A;  3ISF A;  3F35 A;  4TO9 A;  2V2P A;  1QGH A;  3M6J A;  3LKD A;  5D8X A;  2GYD A;  5J9V A;  4LQJ A;  4XGS A;  3JZ9 A;  4DE6 A;  1F33 A;  2V8U A;  4YKH A;  3F39 A;  4LQH A;  4REU A;  3UFB A;  1EUM A;  4IWJ A;  3ISE A;  3PVT B;  3PW8 C;  2CEI A;  2X17 0;  3AF7 X;  1ZS3 A;  2XKQ A;  1DVB A;  4DAS A;  5JAC A;  1RYT A;  4P18 A;  1VEL A;  3C1Y A;  4IWK A;  5E1U A;  3UNO A;  3VVA A;  4CYB A;  3R2H A;  2RBD A;  3PVR B;  1KRQ A;  4EVC A;  2FFX J;  3E6R A;  3FSE A;  4KVQ A;  3E1L A;  2JD8 0;  3PWQ C;  1JRE A;  2IU2 A;  5J93 A;  1R03 A;  1VEI A;  3KA3 A;  3AJQ A;  4W4L B;  3A68 A;  4M34 A;  2YJK A;  4ERU A;  3PVT A;  1RCD A;  4RC7 B;  4WJG 4;  4DYY A;  2GYQ A;  3R2S A;  4E40 A;  3IS7 A;  2VXI A;  4E6K A;  1TKO A;  2ZA7 A;  3F36 A;  2FZF A;  3KXU A;  4LQV A;  3O7R A;  5JKL G;  2GS4 A;  4YVZ A;  4TOA A;  5FFD A;  4OYN A;  3R2R A;  3NOZ X;  3PVR A;  3Q4N A;  3QHB A;  2BKC A;  4XKT A;  3TA8 A;  1JKV A;  5D8R A;  2HR5 A;  1N1Q A;  4ZKW A;  4QUW A;  2ZA8 A;  5K53 A;  5D8Q A;  3F37 A;  3GHQ A;  2ZUR X;  1VEQ A;  4ZL6 A;  4CVT A;  1YV1 A;  5GU3 X;  2Z5P A;  5K52 A;  3HIU A;  1GWG A;  3FRR A;  4MJY A;  5FFB A;  2FL0 A;  1RCG A;  3KA6 A;  1DAT A;  3KWO A;  3RAV A;  2WLU A;  5C6F A;  3E1Q A;  1IES A;  5GOU A;  2F7N A;  1XZ1 A;  5LG2 A;  3R2L A;  2CLU A;  2G4H A;  1B71 A;  3NP2 X;  4PG1 A;  2V2L A;  2ZA6 A;  2PYB A;  3VNX A;  3UOI A;  4MXP A;  1NF4 A;  2V2N A;  5FFE A;  4LPM A;  4M32 A;  3Q4O A;  2ZG8 X;  2Y3Q A;  4TW3 A;  2V2O A;  1L8H A;  5HQO A;  1NFV A;  4KXR B;  1MOJ A;  2JD6 0;  3AF9 X;  4U3G A;  1S3Q A;  4M35 A;  1RCE A;  2XJN A;  4A25 A;  1IER A;  4PGI A;  3RBC A;  4LQN A;  2CHP A;  1BCF A;  2XJO A;  4ISM A;  1UVH A;  5AXS A;  3GGY A;  4LPJ A;  4XKS A;  2Z90 A;  2FG4 A;  1XZ3 A;  2CHI A;  3C21 A;  2WTL A;  3AK9 A;  5GN8 B;  1UMN A;  2ZG9 X;  3PW1 B;  4LYU A;  1S30 A;  3QVD A;  4RC5 A;  4CYA A;  2QF9 A;  2JD7 0;  2C41 A;  2XJM A;  4TOF A;  2FJC A;  3V3K B;  1Z6O M;  4AM5 A;  5JDO B;  3AJO A;  1FHA A;  4ISP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...