2XJNA

Crystal structure of streptococcus suis dpr with copper
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
150
structure length
150
Chain Sequence
ADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title Structural and Thermodynamic Characterization of Metal Ion Binding in Streptococcus Suis Dpr.
pubmed doi rcsb
source organism Streptococcus suis
total genus 66
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.-.-:
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2xjnA00
2IY4A 3HIUA 4LYUA 3SIDA 5GN8B 3SHXA 3BKNA 3F38A 3PW8A 2JD60 1RCEA 1UVHA 3R2HA 3E2CA 5FFEA 4MN9A 5D8XA 4IWJA 1RCIA 2V15A 1N1QA 4YKHA 1L8HA 5JKMG 4AM4A 3PW1B 2V2IA 2YJKA 4EVDA 1DPSA 4U3GA 1BCFA 2ZA7A 4XGSA 3SH6A 3UNOA 4DE6A 2C2JA 1F33A 3HL1A 4DYZA 3R2RA 1HRSA 5GOUA 3R2OA 2X170 2FZFA 2CEIA 3ERZA 3PVYB 4KVQA 4ITTA 3RBCA 2WLAA 4E6KA 1RCDA 1S30A 2CN6A 3KA9A 1JYBA 4ZL5A 1Z4AA 2ZG9X 3AF7X 3VNXA 3PVRA 2C2FA 5GU1X 2V2NA 1VEQA 3AJQA 2CHPA 2XGWA 5HJFA 2XJNA 2GYQA 3NP0X 3RE7A 2ZA6A 4TO9A 1NNQA 5GN8A 4TODA 4ISPA 5JKLA 3F39A 3EGMA 1O9IA 1NF6A 3QB9A 3T9JA 2QF9A 5FFDA 3ISEA 2CLBA 4CMYA 2XJOA 4DI0A 3QVDA 4OYNA 3RD0A 3E6SA 5D8PA 1B71A 5ERJA 3ISFA 2V2MA 5LBHA 5HJHA 5LG8A 4LQNA 2XKQA 2CLUA 3IS8A 2YW7A 4LQJA 3RAVA 2IB0A 1LKMA 2C41A 1YUXA 5E2DA 3PWFA 4ETRA 1VLGA 3AF8X 1QYBA 1O9RA 3BVIA 3KX9A 2OH3A 3Q4RA 3R2KA 4CVRA 4CVPA 2PYBA 2CF7A 3KWOA 1DVBA 3E1PA 2BKCA 1JTSA 4RC8A 3EZUA 1S2ZA 1ZS3A 2V2RA 2Z5PA 3E1MA 3H7GA 4LQVA 2XJMA 2Z5QA 1QGHA 2Z6MA 5FEJA 5J8WA 1RCCA 4PG0A 4TOFA 2G4HA 1LKOA 3IS7A 3GE4A 4LQHA 3R2SA 4ZJKA 1J30A 2RBDA 3E1JA 1LKPA 3PWQA 1JI5A 4ML5A 4PG1A 4ZLWA 4ISMA 2VZBA 3A68A 4TOHA 4CVTA 4TOBA 5ERKA 3U90A 3FI6A 4ITWA 3QHCA 2BJYA 2VXXA 4LYXA 4ZKXA 1JREA 1XZ1A 4AM5A 1RCGA 2FG4A 4ZKWA 1GWGA 3WVWA 2FKZA 3O7SA 5JKMA 4ZTTA 4M35A 4DYXA 1JI4A 3QHBA 2WTLA 2ZA8A 1JKVA 2CIHA 1SOFA 3FVBA 3WNWA 3F35A 4RC5B 4RC6B 5JKLG 2FFXJ 1VEIA 1Z6OM 4REUA 2JD80 2W0OA 2V2OA 4EVBA 3E1LA 2ZG7X 5GU0X 2F7NA 3QD8A 1TKOA 4MUDA 5J9VA 3NP2X 5JACA 2GYDA 3RGDA 3PZAA 3TA8A 2Z5RA 1NFVA 3Q4NA 4KVSA 1XZ3A 2CN7A 1RYTA 5LS9A 3GVYA 1TK6A 3F37A 1SQ3A 3OJ5A 4TOAA 2UX1A 4DYYA 3BVFA 1OTKA 3E6RA 4IXKA 5D8SA 5J8SA 1YV1A 5J93A 4LPNA 3GHQA 1JGCA 2FHAA 2ZURX 4ZL6A 4LPMA 2YW6A 5D8OA 3E1NA 3AK9A 2OC5A 2IU2A 5LG2A 3Q4QA 1AEWA 1Z6OA 2C6RA 4Z3BA 2FG8A 5K52A 3F32A 4RC5A 4RC6A 1MFRA 3PVTB 4Z5SA 5D8RA 3BVKA 3ES3A 3KA8A 3BVEA 1LB3A 3QZ3A 2BW1A 4DZ0A 1KRQA 4II4A 4ERUA 2BK6A 4CVSA 2ITBA 2V2PA 4PGIA 1UMNA 1BFRA 2V2LA 3R2LA 1R03A 3Q4OA 3KA3A 4M33A 3UOFA 2V2JA 4ZKHA 4CMYV 3PW8C 2WLUA 5AXSA 4EVCA 4M32A 3AJPA 3UOIA 4EVEA 3EZ0A 4KVRA 5GU3X 3AJOA 4AM2A 5CMRA 1F30A 4XKUA 5CZUA 5D8YA 1EUMA 1JKUA 2HTNA 3KXUA 4M34A 1L8IA 2FL0A 1DATA 3KA4A 1VJXA 3NOZX 4A25A 2HR5A 1ZUJA 3PWQC 4R42A 3F34A 5HQOA 4Y08A 4PGKA 3PVRB 1BG7A 5C6FA 5K53A 2VXIA 1TJOA 3F33A 3WVVA 3O7RA 1MOJA 1VELA 3A9QA 3PVTA 3KA6A 4CY9A 3FSEA 3SE1A 1NF4A 4II4B 3BVLA 3OGHA 3BT5A 4XKTA 4RC7A 5GU2X 3F36A 2Z90A 3WVUA 3E1QA 5FFBA 4XKSA 4DASA 4DYUA 3AF9X 4MJYA 1FHAA 5IX6A 5CMQA 3AK8A 1H96A 2GS4A 2Y3QA 1YUZA 2JD70 1TKPA 1JIGA 4MKUA 4CYAA 4TOEA 2QQYA 4TOGA 3PW1A 1S3QA 2FJCA 3MPSA 2C2UA 3IQ1A 2ZG8X 2V2SA 4TW3A 2YJJA 3E1OA 5FFCA 1IERA 5I4JA 4LPJA 2D5KA 4P18A 5D8QA 2CHIA 4MY7A 3PVYA 4IWKA 4TOCA 4CYBA 3R2MA 4ZMCA 5E1UA 4RC7B 1IESA 4QUWA 5FFAA
chains in the Genus database with same CATH superfamily
2IY4A 5JDOB 3HIUA 4LYUA 3GGZA 3L0MA 3SIDA 5GN8B 3SHXA 3BKNA 3F38A 3PW8A 2JD60 1RCEA 1UVHA 3R2HA 3E2CA 5FFEA 4MN9A 5D8XA 4IWJA 1RCIA 2V15A 1N1QA 4YKHA 1L8HA 5JKMG 4AM4A 3PW1B 2V2IA 2YJKA 3C23A 4EVDA 1DPSA 4U3GA 1BCFA 2ZA7A 4XGSA 3SH6A 3UNOA 4YXMA 4DE6A 2C2JA 4X0JA 1F33A 3HL1A 4DYZA 3R2RA 1HRSA 5GOUA 3C21A 4QUWA 3R2OA 2X170 2FZFA 2CEIA 3ERZA 3PVYB 4KVQA 4ITTA 3RBCA 2WLAA 4E6KA 1RCDA 3FRRA 1S30A 2CN6A 3KA9A 1JYBA 4ZL5A 3C1YA 1Z4AA 3DBYA 2ZG9X 3AF7X 3VNXA 3PVRA 2C2FA 5GU1X 2V2NA 5JDOA 1VEQA 3AJQA 2CHPA 2XGWA 5HJFA 2XJNA 2GYQA 4MXPA 3NP0X 3RE7A 2ZA6A 4TO9A 1NNQA 5GN8A 4TODA 4ISPA 5JKLA 3F39A 3EGMA 1O9IA 1NF6A 3QB9A 3T9JA 2QF9A 5FFDA 3ISEA 2CLBA 4CMYA 2XJOA 4DI0A 3QVDA 4OYNA 3RD0A 3E6SA 5D8PA 1B71A 5ERJA 3ISFA 2V2MA 5LBHA 5HJHA 5LG8A 4LQNA 2XKQA 2CLUA 3IS8A 2YW7A 4LQJA 2V8UA 3RAVA 2IB0A 1LKMA 2C41A 1YUXA 5E2DA 3PWFA 4W4KB 4ETRA 1VLGA 3AF8X 1QYBA 1O9RA 3BVIA 3KX9A 2OH3A 3Q4RA 3R2KA 4CVRA 4CVPA 2PYBA 2CF7A 3KWOA 1DVBA 3E1PA 2BKCA 1JTSA 4RC8A 3EZUA 3VV9A 1S2ZA 2CWLA 1ZS3A 2V2RA 2Z5PA 3E1MA 3UFBA 3H7GA 4LQVA 2XJMA 2Z5QA 1QGHA 2Z6MA 5FEJA 5J8WA 1RCCA 4PG0A 4TOFA 2G4HA 1LKOA 3IS7A 3GE4A 4LQHA 3R2SA 4ZJKA 1J30A 2RBDA 3N6OA 3VVAA 3JZAB 3E1JA 1LKPA 3PWQA 1JI5A 2MGYA 4ML5A 4PG1A 4ZLWA 4ISMA 2VZBA 3A68A 3JZ9A 4TOHA 4CVTA 4TOBA 5ERKA 3KDQA 3U90A 3FI6A 4ITWA 3QHCA 2BJYA 2VXXA 4LYXA 4ZKXA 1JREA 1XZ1A 4AM5A 1RCGA 2FG4A 4ZKWA 1GWGA 3WVWA 2FKZA 3O7SA 3M6JA 5JKMA 4YVZA 4ZTTA 3KHKA 4M35A 4DYXA 1JI4A 3QHBA 2WTLA 2ZA8A 1JKVA 2CIHA 1SOFA 3FVBA 3WNWA 3F35A 4RC5B 4RC6B 5JKLG 2FFXJ 1VEIA 1Z6OM 2OKCA 4REUA 2JD80 2W0OA 2V2OA 4EVBA 3E1LA 4KXRB 2ZG7X 5GU0X 2F7NA 3QD8A 1TKOA 4MUDA 5J9VA 3NP2X 5JACA 2GYDA 3RGDA 3PZAA 3TA8A 2Z5RA 1NFVA 3Q4NA 3LKDA 4KVSA 1XZ3A 3D19A 2CN7A 1RYTA 5LS9A 3GVYA 1TK6A 3F37A 1SQ3A 3OJ5A 4TOAA 2UX1A 4DYYA 3BVFA 1OTKA 3E6RA 2Y44A 4IXKA 5D8SA 5J8SA 1YV1A 5J93A 3C1ZA 4LPNA 3GHQA 1JGCA 2G38B 2FHAA 2ZURX 4ZL6A 4LPMA 2YW6A 5D8OA 3E1NA 3AK9A 2OC5A 2IU2A 5LG2A 3Q4QA 1AEWA 1Z6OA 2C6RA 4E40A 4Z3BA 2FG8A 5K52A 3F32A 4RC5A 2AR0A 4RC6A 1MFRA 3PVTB 4Z5SA 5D8RA 3BVKA 5HU6D 3ES3A 3KA8A 3BVEA 1LB3A 3QZ3A 2BW1A 4DZ0A 1KRQA 4II4A 4ERUA 2BK6A 4CVSA 2ITBA 2V2PA 4PGIA 1UMNA 3GGYA 1BFRA 2V2LA 3R2LA 1R03A 2WWXB 3Q4OA 3KA3A 4M33A 3UOFA 2V2JA 4ZKHA 4CMYV 3PW8C 2WLUA 5AXSA 4EVCA 4M32A 4YXJA 3AJPA 3UOIA 4EVEA 3EZ0A 4KVRA 5GU3X 3AJOA 4AM2A 5CMRA 1F30A 4XKUA 5CZUA 5D8YA 1EUMA 1JKUA 2HTNA 3KXUA 4M34A 1L8IA 2FL0A 1DATA 3KA4A 1VJXA 3NOZX 4A25A 2N02A 2HR5A 1ZUJA 3PWQC 4R42A 3F34A 3FRSA 5HQOA 3W54A 4Y08A 4PGKA 1BG7A 5C6FA 2V8TA 5K53A 2VXIA 1TJOA 4WJG4 3F33A 3WVVA 3O7RA 1MOJA 1VELA 3A9QA 3PVTA 3KA6A 4CY9A 3FSEA 3SE1A 1NF4A 4II4B 3BVLA 3OGHA 3BT5A 4XKTA 4RC7A 5GU2X 3F36A 2Z90A 3WVUA 3E1QA 5FFBA 4XKSA 3V3KB 4DASA 4DYUA 3AF9X 4MJYA 1FHAA 5IX6A 5CMQA 3AK8A 1H96A 2GS4A 2Y3QA 1YUZA 2JD70 1TKPA 1JIGA 4MKUA 4CYAA 4TOEA 2QQYA 4TOGA 3PW1A 1S3QA 2FJCA 3MPSA 2C2UA 3IQ1A 2ZG8X 2V2SA 4TW3A 2YJJA 3E1OA 5FFCA 1IERA 5I4JA 4LPJA 2D5KA 4P18A 4W4LB 5D8QA 2CHIA 4MY7A 3PVYA 4IWKA 4TOCA 4CYBA 3R2MA 4ZMCA 5E1UA 4RC7B 1IESA 3PVRB 5FFAA
chains in the Genus database with same CATH topology
2IY4A 5JDOB 3HIUA 4LYUA 3GGZA 3L0MA 3SIDA 5GN8B 3SHXA 3BKNA 3F38A 3PW8A 2JD60 1RCEA 1UVHA 3R2HA 3E2CA 5FFEA 4MN9A 5D8XA 4IWJA 1RCIA 2V15A 1N1QA 4YKHA 1L8HA 5JKMG 4AM4A 3PW1B 2V2IA 2YJKA 3C23A 4EVDA 1DPSA 4U3GA 1BCFA 2ZA7A 4XGSA 3SH6A 3UNOA 4YXMA 4DE6A 2C2JA 4X0JA 1F33A 3HL1A 4DYZA 3R2RA 1HRSA 5GOUA 3C21A 4QUWA 3R2OA 2X170 2FZFA 2CEIA 3ERZA 3PVYB 4KVQA 4ITTA 3RBCA 2WLAA 4E6KA 1RCDA 3FRRA 1S30A 2CN6A 3KA9A 1JYBA 4ZL5A 3C1YA 1Z4AA 3DBYA 2ZG9X 3AF7X 3VNXA 3PVRA 2C2FA 5GU1X 2V2NA 5JDOA 1VEQA 3AJQA 2CHPA 2XGWA 5HJFA 2XJNA 2GYQA 4MXPA 3NP0X 3RE7A 2ZA6A 4TO9A 1NNQA 5GN8A 4TODA 4ISPA 5JKLA 3F39A 3EGMA 1O9IA 1NF6A 3QB9A 3T9JA 2QF9A 5FFDA 3ISEA 2CLBA 4CMYA 2XJOA 4DI0A 3QVDA 4OYNA 3RD0A 3E6SA 5D8PA 1B71A 5ERJA 3ISFA 2V2MA 5LBHA 5HJHA 5LG8A 4LQNA 2XKQA 2CLUA 3IS8A 2YW7A 4LQJA 2V8UA 3RAVA 2IB0A 1LKMA 2C41A 1YUXA 5E2DA 3PWFA 4W4KB 4ETRA 1VLGA 3AF8X 1QYBA 1O9RA 3BVIA 3KX9A 2OH3A 3Q4RA 3R2KA 4CVRA 4CVPA 2PYBA 2CF7A 3KWOA 1DVBA 3E1PA 2BKCA 1JTSA 4RC8A 3EZUA 3VV9A 1S2ZA 2CWLA 1ZS3A 2V2RA 2Z5PA 3E1MA 3UFBA 3H7GA 4LQVA 2XJMA 2Z5QA 1QGHA 2Z6MA 5FEJA 5J8WA 1RCCA 4PG0A 4TOFA 2G4HA 1LKOA 3IS7A 3GE4A 4LQHA 3R2SA 4ZJKA 1J30A 2RBDA 3N6OA 3VVAA 3JZAB 3E1JA 1LKPA 3PWQA 1JI5A 2MGYA 4ML5A 4PG1A 4ZLWA 4ISMA 2VZBA 3A68A 3JZ9A 4TOHA 4CVTA 4TOBA 5ERKA 3KDQA 3U90A 3FI6A 4ITWA 3QHCA 2BJYA 2VXXA 4LYXA 4ZKXA 1JREA 1XZ1A 4AM5A 1RCGA 2FG4A 4ZKWA 1GWGA 3WVWA 2FKZA 3O7SA 3M6JA 5JKMA 4YVZA 4ZTTA 3KHKA 4M35A 4DYXA 1JI4A 3QHBA 2WTLA 2ZA8A 1JKVA 2CIHA 1SOFA 3FVBA 3WNWA 3F35A 4RC5B 4RC6B 5JKLG 2FFXJ 1VEIA 1Z6OM 2OKCA 4REUA 2JD80 2W0OA 2V2OA 4EVBA 3E1LA 4KXRB 2ZG7X 5GU0X 2F7NA 3QD8A 1TKOA 4MUDA 5J9VA 3NP2X 5JACA 2GYDA 3RGDA 3PZAA 3TA8A 2Z5RA 1NFVA 3Q4NA 3LKDA 4KVSA 1XZ3A 3D19A 2CN7A 1RYTA 5LS9A 3GVYA 1TK6A 3F37A 1SQ3A 3OJ5A 4TOAA 2UX1A 4DYYA 3BVFA 1OTKA 3E6RA 2Y44A 4IXKA 5D8SA 5J8SA 1YV1A 5J93A 3C1ZA 4LPNA 3GHQA 1JGCA 2G38B 2FHAA 2ZURX 4ZL6A 4LPMA 2YW6A 5D8OA 3E1NA 3AK9A 2OC5A 2IU2A 5LG2A 3Q4QA 1AEWA 1Z6OA 2C6RA 4E40A 4Z3BA 2FG8A 5K52A 3F32A 4RC5A 2AR0A 4RC6A 1MFRA 3PVTB 4Z5SA 5D8RA 3BVKA 5HU6D 3ES3A 3KA8A 3BVEA 1LB3A 3QZ3A 2BW1A 4DZ0A 1KRQA 4II4A 4ERUA 2BK6A 4CVSA 2ITBA 2V2PA 4PGIA 1UMNA 3GGYA 1BFRA 2V2LA 3R2LA 1R03A 2WWXB 3Q4OA 3KA3A 4M33A 3UOFA 2V2JA 4ZKHA 4CMYV 3PW8C 2WLUA 5AXSA 4EVCA 4M32A 4YXJA 3AJPA 3UOIA 4EVEA 3EZ0A 4KVRA 5GU3X 3AJOA 4AM2A 5CMRA 1F30A 4XKUA 5CZUA 5D8YA 1EUMA 1JKUA 2HTNA 3KXUA 4M34A 1L8IA 2FL0A 1DATA 3KA4A 1VJXA 3NOZX 4A25A 2N02A 2HR5A 1ZUJA 3PWQC 4R42A 3F34A 3FRSA 5HQOA 3W54A 4Y08A 4PGKA 1BG7A 5C6FA 2V8TA 5K53A 2VXIA 1TJOA 4WJG4 3F33A 3WVVA 3O7RA 1MOJA 1VELA 3A9QA 3PVTA 3KA6A 4CY9A 3FSEA 3SE1A 1NF4A 4II4B 3BVLA 3OGHA 3BT5A 4XKTA 4RC7A 5GU2X 3F36A 2Z90A 3WVUA 3E1QA 5FFBA 4XKSA 3V3KB 4DASA 4DYUA 3AF9X 4MJYA 1FHAA 5IX6A 5CMQA 3AK8A 1H96A 2GS4A 2Y3QA 1YUZA 2JD70 1TKPA 1JIGA 4MKUA 4CYAA 4TOEA 2QQYA 4TOGA 3PW1A 1S3QA 2FJCA 3MPSA 2C2UA 3IQ1A 2ZG8X 2V2SA 4TW3A 2YJJA 3E1OA 5FFCA 1IERA 5I4JA 4LPJA 2D5KA 4P18A 4W4LB 5D8QA 2CHIA 4MY7A 3PVYA 4IWKA 4TOCA 4CYBA 3R2MA 4ZMCA 5E1UA 4RC7B 1IESA 3PVRB 5FFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY4 A;  3HIU A;  4LYU A;  3SID A;  5GN8 B;  3SHX A;  3BKN A;  3F38 A;  3PW8 A;  2JD6 0;  1RCE A;  1UVH A;  3R2H A;  3E2C A;  5FFE A;  4MN9 A;  5D8X A;  4IWJ A;  1RCI A;  2V15 A;  1N1Q A;  4YKH A;  1L8H A;  5JKM G;  4AM4 A;  3PW1 B;  2V2I A;  2YJK A;  4EVD A;  1DPS A;  4U3G A;  1BCF A;  2ZA7 A;  4XGS A;  3SH6 A;  3UNO A;  4DE6 A;  2C2J A;  1F33 A;  3HL1 A;  4DYZ A;  3R2R A;  1HRS A;  5GOU A;  3R2O A;  2X17 0;  2FZF A;  2CEI A;  3ERZ A;  3PVY B;  4KVQ A;  4ITT A;  3RBC A;  2WLA A;  4E6K A;  1RCD A;  1S30 A;  2CN6 A;  3KA9 A;  1JYB A;  4ZL5 A;  1Z4A A;  2ZG9 X;  3AF7 X;  3VNX A;  3PVR A;  2C2F A;  5GU1 X;  2V2N A;  1VEQ A;  3AJQ A;  2CHP A;  2XGW A;  5HJF A;  2XJN A;  2GYQ A;  3NP0 X;  3RE7 A;  2ZA6 A;  4TO9 A;  1NNQ A;  5GN8 A;  4TOD A;  4ISP A;  5JKL A;  3F39 A;  3EGM A;  1O9I A;  1NF6 A;  3QB9 A;  3T9J A;  2QF9 A;  5FFD A;  3ISE A;  2CLB A;  4CMY A;  2XJO A;  4DI0 A;  3QVD A;  4OYN A;  3RD0 A;  3E6S A;  5D8P A;  1B71 A;  5ERJ A;  3ISF A;  2V2M A;  5LBH A;  5HJH A;  5LG8 A;  4LQN A;  2XKQ A;  2CLU A;  3IS8 A;  2YW7 A;  4LQJ A;  3RAV A;  2IB0 A;  1LKM A;  2C41 A;  1YUX A;  5E2D A;  3PWF A;  4ETR A;  1VLG A;  3AF8 X;  1QYB A;  1O9R A;  3BVI A;  3KX9 A;  2OH3 A;  3Q4R A;  3R2K A;  4CVR A;  4CVP A;  2PYB A;  2CF7 A;  3KWO A;  1DVB A;  3E1P A;  2BKC A;  1JTS A;  4RC8 A;  3EZU A;  1S2Z A;  1ZS3 A;  2V2R A;  2Z5P A;  3E1M A;  3H7G A;  4LQV A;  2XJM A;  2Z5Q A;  1QGH A;  2Z6M A;  5FEJ A;  5J8W A;  1RCC A;  4PG0 A;  4TOF A;  2G4H A;  1LKO A;  3IS7 A;  3GE4 A;  4LQH A;  3R2S A;  4ZJK A;  1J30 A;  2RBD A;  3E1J A;  1LKP A;  3PWQ A;  1JI5 A;  4ML5 A;  4PG1 A;  4ZLW A;  4ISM A;  2VZB A;  3A68 A;  4TOH A;  4CVT A;  4TOB A;  5ERK A;  3U90 A;  3FI6 A;  4ITW A;  3QHC A;  2BJY A;  2VXX A;  4LYX A;  4ZKX A;  1JRE A;  1XZ1 A;  4AM5 A;  1RCG A;  2FG4 A;  4ZKW A;  1GWG A;  3WVW A;  2FKZ A;  3O7S A;  5JKM A;  4ZTT A;  4M35 A;  4DYX A;  1JI4 A;  3QHB A;  2WTL A;  2ZA8 A;  1JKV A;  2CIH A;  1SOF A;  3FVB A;  3WNW A;  3F35 A;  4RC5 B;  4RC6 B;  5JKL G;  2FFX J;  1VEI A;  1Z6O M;  4REU A;  2JD8 0;  2W0O A;  2V2O A;  4EVB A;  3E1L A;  2ZG7 X;  5GU0 X;  2F7N A;  3QD8 A;  1TKO A;  4MUD A;  5J9V A;  3NP2 X;  5JAC A;  2GYD A;  3RGD A;  3PZA A;  3TA8 A;  2Z5R A;  1NFV A;  3Q4N A;  4KVS A;  1XZ3 A;  2CN7 A;  1RYT A;  5LS9 A;  3GVY A;  1TK6 A;  3F37 A;  1SQ3 A;  3OJ5 A;  4TOA A;  2UX1 A;  4DYY A;  3BVF A;  1OTK A;  3E6R A;  4IXK A;  5D8S A;  5J8S A;  1YV1 A;  5J93 A;  4LPN A;  3GHQ A;  1JGC A;  2FHA A;  2ZUR X;  4ZL6 A;  4LPM A;  2YW6 A;  5D8O A;  3E1N A;  3AK9 A;  2OC5 A;  2IU2 A;  5LG2 A;  3Q4Q A;  1AEW A;  1Z6O A;  2C6R A;  4Z3B A;  2FG8 A;  5K52 A;  3F32 A;  4RC5 A;  4RC6 A;  1MFR A;  3PVT B;  4Z5S A;  5D8R A;  3BVK A;  3ES3 A;  3KA8 A;  3BVE A;  1LB3 A;  3QZ3 A;  2BW1 A;  4DZ0 A;  1KRQ A;  4II4 A;  4ERU A;  2BK6 A;  4CVS A;  2ITB A;  2V2P A;  4PGI A;  1UMN A;  1BFR A;  2V2L A;  3R2L A;  1R03 A;  3Q4O A;  3KA3 A;  4M33 A;  3UOF A;  2V2J A;  4ZKH A;  4CMY V;  3PW8 C;  2WLU A;  5AXS A;  4EVC A;  4M32 A;  3AJP A;  3UOI A;  4EVE A;  3EZ0 A;  4KVR A;  5GU3 X;  3AJO A;  4AM2 A;  5CMR A;  1F30 A;  4XKU A;  5CZU A;  5D8Y A;  1EUM A;  1JKU A;  2HTN A;  3KXU A;  4M34 A;  1L8I A;  2FL0 A;  1DAT A;  3KA4 A;  1VJX A;  3NOZ X;  4A25 A;  2HR5 A;  1ZUJ A;  3PWQ C;  4R42 A;  3F34 A;  5HQO A;  4Y08 A;  4PGK A;  3PVR B;  1BG7 A;  5C6F A;  5K53 A;  2VXI A;  1TJO A;  3F33 A;  3WVV A;  3O7R A;  1MOJ A;  1VEL A;  3A9Q A;  3PVT A;  3KA6 A;  4CY9 A;  3FSE A;  3SE1 A;  1NF4 A;  4II4 B;  3BVL A;  3OGH A;  3BT5 A;  4XKT A;  4RC7 A;  5GU2 X;  3F36 A;  2Z90 A;  3WVU A;  3E1Q A;  5FFB A;  4XKS A;  4DAS A;  4DYU A;  3AF9 X;  4MJY A;  1FHA A;  5IX6 A;  5CMQ A;  3AK8 A;  1H96 A;  2GS4 A;  2Y3Q A;  1YUZ A;  2JD7 0;  1TKP A;  1JIG A;  4MKU A;  4CYA A;  4TOE A;  2QQY A;  4TOG A;  3PW1 A;  1S3Q A;  2FJC A;  3MPS A;  2C2U A;  3IQ1 A;  2ZG8 X;  2V2S A;  4TW3 A;  2YJJ A;  3E1O A;  5FFC A;  1IER A;  5I4J A;  4LPJ A;  2D5K A;  4P18 A;  5D8Q A;  2CHI A;  4MY7 A;  3PVY A;  4IWK A;  4TOC A;  4CYB A;  3R2M A;  4ZMC A;  5E1U A;  4RC7 B;  1IES A;  4QUW A;  5FFA A; 
#chains in the Genus database with same CATH topology
 2IY4 A;  5JDO B;  3HIU A;  4LYU A;  3GGZ A;  3L0M A;  3SID A;  5GN8 B;  3SHX A;  3BKN A;  3F38 A;  3PW8 A;  2JD6 0;  1RCE A;  1UVH A;  3R2H A;  3E2C A;  5FFE A;  4MN9 A;  5D8X A;  4IWJ A;  1RCI A;  2V15 A;  1N1Q A;  4YKH A;  1L8H A;  5JKM G;  4AM4 A;  3PW1 B;  2V2I A;  2YJK A;  3C23 A;  4EVD A;  1DPS A;  4U3G A;  1BCF A;  2ZA7 A;  4XGS A;  3SH6 A;  3UNO A;  4YXM A;  4DE6 A;  2C2J A;  4X0J A;  1F33 A;  3HL1 A;  4DYZ A;  3R2R A;  1HRS A;  5GOU A;  3C21 A;  4QUW A;  3R2O A;  2X17 0;  2FZF A;  2CEI A;  3ERZ A;  3PVY B;  4KVQ A;  4ITT A;  3RBC A;  2WLA A;  4E6K A;  1RCD A;  3FRR A;  1S30 A;  2CN6 A;  3KA9 A;  1JYB A;  4ZL5 A;  3C1Y A;  1Z4A A;  3DBY A;  2ZG9 X;  3AF7 X;  3VNX A;  3PVR A;  2C2F A;  5GU1 X;  2V2N A;  5JDO A;  1VEQ A;  3AJQ A;  2CHP A;  2XGW A;  5HJF A;  2XJN A;  2GYQ A;  4MXP A;  3NP0 X;  3RE7 A;  2ZA6 A;  4TO9 A;  1NNQ A;  5GN8 A;  4TOD A;  4ISP A;  5JKL A;  3F39 A;  3EGM A;  1O9I A;  1NF6 A;  3QB9 A;  3T9J A;  2QF9 A;  5FFD A;  3ISE A;  2CLB A;  4CMY A;  2XJO A;  4DI0 A;  3QVD A;  4OYN A;  3RD0 A;  3E6S A;  5D8P A;  1B71 A;  5ERJ A;  3ISF A;  2V2M A;  5LBH A;  5HJH A;  5LG8 A;  4LQN A;  2XKQ A;  2CLU A;  3IS8 A;  2YW7 A;  4LQJ A;  2V8U A;  3RAV A;  2IB0 A;  1LKM A;  2C41 A;  1YUX A;  5E2D A;  3PWF A;  4W4K B;  4ETR A;  1VLG A;  3AF8 X;  1QYB A;  1O9R A;  3BVI A;  3KX9 A;  2OH3 A;  3Q4R A;  3R2K A;  4CVR A;  4CVP A;  2PYB A;  2CF7 A;  3KWO A;  1DVB A;  3E1P A;  2BKC A;  1JTS A;  4RC8 A;  3EZU A;  3VV9 A;  1S2Z A;  2CWL A;  1ZS3 A;  2V2R A;  2Z5P A;  3E1M A;  3UFB A;  3H7G A;  4LQV A;  2XJM A;  2Z5Q A;  1QGH A;  2Z6M A;  5FEJ A;  5J8W A;  1RCC A;  4PG0 A;  4TOF A;  2G4H A;  1LKO A;  3IS7 A;  3GE4 A;  4LQH A;  3R2S A;  4ZJK A;  1J30 A;  2RBD A;  3N6O A;  3VVA A;  3JZA B;  3E1J A;  1LKP A;  3PWQ A;  1JI5 A;  2MGY A;  4ML5 A;  4PG1 A;  4ZLW A;  4ISM A;  2VZB A;  3A68 A;  3JZ9 A;  4TOH A;  4CVT A;  4TOB A;  5ERK A;  3KDQ A;  3U90 A;  3FI6 A;  4ITW A;  3QHC A;  2BJY A;  2VXX A;  4LYX A;  4ZKX A;  1JRE A;  1XZ1 A;  4AM5 A;  1RCG A;  2FG4 A;  4ZKW A;  1GWG A;  3WVW A;  2FKZ A;  3O7S A;  3M6J A;  5JKM A;  4YVZ A;  4ZTT A;  3KHK A;  4M35 A;  4DYX A;  1JI4 A;  3QHB A;  2WTL A;  2ZA8 A;  1JKV A;  2CIH A;  1SOF A;  3FVB A;  3WNW A;  3F35 A;  4RC5 B;  4RC6 B;  5JKL G;  2FFX J;  1VEI A;  1Z6O M;  2OKC A;  4REU A;  2JD8 0;  2W0O A;  2V2O A;  4EVB A;  3E1L A;  4KXR B;  2ZG7 X;  5GU0 X;  2F7N A;  3QD8 A;  1TKO A;  4MUD A;  5J9V A;  3NP2 X;  5JAC A;  2GYD A;  3RGD A;  3PZA A;  3TA8 A;  2Z5R A;  1NFV A;  3Q4N A;  3LKD A;  4KVS A;  1XZ3 A;  3D19 A;  2CN7 A;  1RYT A;  5LS9 A;  3GVY A;  1TK6 A;  3F37 A;  1SQ3 A;  3OJ5 A;  4TOA A;  2UX1 A;  4DYY A;  3BVF A;  1OTK A;  3E6R A;  2Y44 A;  4IXK A;  5D8S A;  5J8S A;  1YV1 A;  5J93 A;  3C1Z A;  4LPN A;  3GHQ A;  1JGC A;  2G38 B;  2FHA A;  2ZUR X;  4ZL6 A;  4LPM A;  2YW6 A;  5D8O A;  3E1N A;  3AK9 A;  2OC5 A;  2IU2 A;  5LG2 A;  3Q4Q A;  1AEW A;  1Z6O A;  2C6R A;  4E40 A;  4Z3B A;  2FG8 A;  5K52 A;  3F32 A;  4RC5 A;  2AR0 A;  4RC6 A;  1MFR A;  3PVT B;  4Z5S A;  5D8R A;  3BVK A;  5HU6 D;  3ES3 A;  3KA8 A;  3BVE A;  1LB3 A;  3QZ3 A;  2BW1 A;  4DZ0 A;  1KRQ A;  4II4 A;  4ERU A;  2BK6 A;  4CVS A;  2ITB A;  2V2P A;  4PGI A;  1UMN A;  3GGY A;  1BFR A;  2V2L A;  3R2L A;  1R03 A;  2WWX B;  3Q4O A;  3KA3 A;  4M33 A;  3UOF A;  2V2J A;  4ZKH A;  4CMY V;  3PW8 C;  2WLU A;  5AXS A;  4EVC A;  4M32 A;  4YXJ A;  3AJP A;  3UOI A;  4EVE A;  3EZ0 A;  4KVR A;  5GU3 X;  3AJO A;  4AM2 A;  5CMR A;  1F30 A;  4XKU A;  5CZU A;  5D8Y A;  1EUM A;  1JKU A;  2HTN A;  3KXU A;  4M34 A;  1L8I A;  2FL0 A;  1DAT A;  3KA4 A;  1VJX A;  3NOZ X;  4A25 A;  2N02 A;  2HR5 A;  1ZUJ A;  3PWQ C;  4R42 A;  3F34 A;  3FRS A;  5HQO A;  3W54 A;  4Y08 A;  4PGK A;  1BG7 A;  5C6F A;  2V8T A;  5K53 A;  2VXI A;  1TJO A;  4WJG 4;  3F33 A;  3WVV A;  3O7R A;  1MOJ A;  1VEL A;  3A9Q A;  3PVT A;  3KA6 A;  4CY9 A;  3FSE A;  3SE1 A;  1NF4 A;  4II4 B;  3BVL A;  3OGH A;  3BT5 A;  4XKT A;  4RC7 A;  5GU2 X;  3F36 A;  2Z90 A;  3WVU A;  3E1Q A;  5FFB A;  4XKS A;  3V3K B;  4DAS A;  4DYU A;  3AF9 X;  4MJY A;  1FHA A;  5IX6 A;  5CMQ A;  3AK8 A;  1H96 A;  2GS4 A;  2Y3Q A;  1YUZ A;  2JD7 0;  1TKP A;  1JIG A;  4MKU A;  4CYA A;  4TOE A;  2QQY A;  4TOG A;  3PW1 A;  1S3Q A;  2FJC A;  3MPS A;  2C2U A;  3IQ1 A;  2ZG8 X;  2V2S A;  4TW3 A;  2YJJ A;  3E1O A;  5FFC A;  1IER A;  5I4J A;  4LPJ A;  2D5K A;  4P18 A;  4W4L B;  5D8Q A;  2CHI A;  4MY7 A;  3PVY A;  4IWK A;  4TOC A;  4CYB A;  3R2M A;  4ZMC A;  5E1U A;  4RC7 B;  1IES A;  3PVR B;  5FFA A; 
#chains in the Genus database with same CATH homology
 2IY4 A;  5JDO B;  3HIU A;  4LYU A;  3GGZ A;  3L0M A;  3SID A;  5GN8 B;  3SHX A;  3BKN A;  3F38 A;  3PW8 A;  2JD6 0;  1RCE A;  1UVH A;  3R2H A;  3E2C A;  5FFE A;  4MN9 A;  5D8X A;  4IWJ A;  1RCI A;  2V15 A;  1N1Q A;  4YKH A;  1L8H A;  5JKM G;  4AM4 A;  3PW1 B;  2V2I A;  2YJK A;  3C23 A;  4EVD A;  1DPS A;  4U3G A;  1BCF A;  2ZA7 A;  4XGS A;  3SH6 A;  3UNO A;  4YXM A;  4DE6 A;  2C2J A;  4X0J A;  1F33 A;  3HL1 A;  4DYZ A;  3R2R A;  1HRS A;  5GOU A;  3C21 A;  4QUW A;  3R2O A;  2X17 0;  2FZF A;  2CEI A;  3ERZ A;  3PVY B;  4KVQ A;  4ITT A;  3RBC A;  2WLA A;  4E6K A;  1RCD A;  3FRR A;  1S30 A;  2CN6 A;  3KA9 A;  1JYB A;  4ZL5 A;  3C1Y A;  1Z4A A;  3DBY A;  2ZG9 X;  3AF7 X;  3VNX A;  3PVR A;  2C2F A;  5GU1 X;  2V2N A;  5JDO A;  1VEQ A;  3AJQ A;  2CHP A;  2XGW A;  5HJF A;  2XJN A;  2GYQ A;  4MXP A;  3NP0 X;  3RE7 A;  2ZA6 A;  4TO9 A;  1NNQ A;  5GN8 A;  4TOD A;  4ISP A;  5JKL A;  3F39 A;  3EGM A;  1O9I A;  1NF6 A;  3QB9 A;  3T9J A;  2QF9 A;  5FFD A;  3ISE A;  2CLB A;  4CMY A;  2XJO A;  4DI0 A;  3QVD A;  4OYN A;  3RD0 A;  3E6S A;  5D8P A;  1B71 A;  5ERJ A;  3ISF A;  2V2M A;  5LBH A;  5HJH A;  5LG8 A;  4LQN A;  2XKQ A;  2CLU A;  3IS8 A;  2YW7 A;  4LQJ A;  2V8U A;  3RAV A;  2IB0 A;  1LKM A;  2C41 A;  1YUX A;  5E2D A;  3PWF A;  4W4K B;  4ETR A;  1VLG A;  3AF8 X;  1QYB A;  1O9R A;  3BVI A;  3KX9 A;  2OH3 A;  3Q4R A;  3R2K A;  4CVR A;  4CVP A;  2PYB A;  2CF7 A;  3KWO A;  1DVB A;  3E1P A;  2BKC A;  1JTS A;  4RC8 A;  3EZU A;  3VV9 A;  1S2Z A;  2CWL A;  1ZS3 A;  2V2R A;  2Z5P A;  3E1M A;  3UFB A;  3H7G A;  4LQV A;  2XJM A;  2Z5Q A;  1QGH A;  2Z6M A;  5FEJ A;  5J8W A;  1RCC A;  4PG0 A;  4TOF A;  2G4H A;  1LKO A;  3IS7 A;  3GE4 A;  4LQH A;  3R2S A;  4ZJK A;  1J30 A;  2RBD A;  3N6O A;  3VVA A;  3JZA B;  3E1J A;  1LKP A;  3PWQ A;  1JI5 A;  2MGY A;  4ML5 A;  4PG1 A;  4ZLW A;  4ISM A;  2VZB A;  3A68 A;  3JZ9 A;  4TOH A;  4CVT A;  4TOB A;  5ERK A;  3KDQ A;  3U90 A;  3FI6 A;  4ITW A;  3QHC A;  2BJY A;  2VXX A;  4LYX A;  4ZKX A;  1JRE A;  1XZ1 A;  4AM5 A;  1RCG A;  2FG4 A;  4ZKW A;  1GWG A;  3WVW A;  2FKZ A;  3O7S A;  3M6J A;  5JKM A;  4YVZ A;  4ZTT A;  3KHK A;  4M35 A;  4DYX A;  1JI4 A;  3QHB A;  2WTL A;  2ZA8 A;  1JKV A;  2CIH A;  1SOF A;  3FVB A;  3WNW A;  3F35 A;  4RC5 B;  4RC6 B;  5JKL G;  2FFX J;  1VEI A;  1Z6O M;  2OKC A;  4REU A;  2JD8 0;  2W0O A;  2V2O A;  4EVB A;  3E1L A;  4KXR B;  2ZG7 X;  5GU0 X;  2F7N A;  3QD8 A;  1TKO A;  4MUD A;  5J9V A;  3NP2 X;  5JAC A;  2GYD A;  3RGD A;  3PZA A;  3TA8 A;  2Z5R A;  1NFV A;  3Q4N A;  3LKD A;  4KVS A;  1XZ3 A;  3D19 A;  2CN7 A;  1RYT A;  5LS9 A;  3GVY A;  1TK6 A;  3F37 A;  1SQ3 A;  3OJ5 A;  4TOA A;  2UX1 A;  4DYY A;  3BVF A;  1OTK A;  3E6R A;  2Y44 A;  4IXK A;  5D8S A;  5J8S A;  1YV1 A;  5J93 A;  3C1Z A;  4LPN A;  3GHQ A;  1JGC A;  2G38 B;  2FHA A;  2ZUR X;  4ZL6 A;  4LPM A;  2YW6 A;  5D8O A;  3E1N A;  3AK9 A;  2OC5 A;  2IU2 A;  5LG2 A;  3Q4Q A;  1AEW A;  1Z6O A;  2C6R A;  4E40 A;  4Z3B A;  2FG8 A;  5K52 A;  3F32 A;  4RC5 A;  2AR0 A;  4RC6 A;  1MFR A;  3PVT B;  4Z5S A;  5D8R A;  3BVK A;  5HU6 D;  3ES3 A;  3KA8 A;  3BVE A;  1LB3 A;  3QZ3 A;  2BW1 A;  4DZ0 A;  1KRQ A;  4II4 A;  4ERU A;  2BK6 A;  4CVS A;  2ITB A;  2V2P A;  4PGI A;  1UMN A;  3GGY A;  1BFR A;  2V2L A;  3R2L A;  1R03 A;  2WWX B;  3Q4O A;  3KA3 A;  4M33 A;  3UOF A;  2V2J A;  4ZKH A;  4CMY V;  3PW8 C;  2WLU A;  5AXS A;  4EVC A;  4M32 A;  4YXJ A;  3AJP A;  3UOI A;  4EVE A;  3EZ0 A;  4KVR A;  5GU3 X;  3AJO A;  4AM2 A;  5CMR A;  1F30 A;  4XKU A;  5CZU A;  5D8Y A;  1EUM A;  1JKU A;  2HTN A;  3KXU A;  4M34 A;  1L8I A;  2FL0 A;  1DAT A;  3KA4 A;  1VJX A;  3NOZ X;  4A25 A;  2N02 A;  2HR5 A;  1ZUJ A;  3PWQ C;  4R42 A;  3F34 A;  3FRS A;  5HQO A;  3W54 A;  4Y08 A;  4PGK A;  1BG7 A;  5C6F A;  2V8T A;  5K53 A;  2VXI A;  1TJO A;  4WJG 4;  3F33 A;  3WVV A;  3O7R A;  1MOJ A;  1VEL A;  3A9Q A;  3PVT A;  3KA6 A;  4CY9 A;  3FSE A;  3SE1 A;  1NF4 A;  4II4 B;  3BVL A;  3OGH A;  3BT5 A;  4XKT A;  4RC7 A;  5GU2 X;  3F36 A;  2Z90 A;  3WVU A;  3E1Q A;  5FFB A;  4XKS A;  3V3K B;  4DAS A;  4DYU A;  3AF9 X;  4MJY A;  1FHA A;  5IX6 A;  5CMQ A;  3AK8 A;  1H96 A;  2GS4 A;  2Y3Q A;  1YUZ A;  2JD7 0;  1TKP A;  1JIG A;  4MKU A;  4CYA A;  4TOE A;  2QQY A;  4TOG A;  3PW1 A;  1S3Q A;  2FJC A;  3MPS A;  2C2U A;  3IQ1 A;  2ZG8 X;  2V2S A;  4TW3 A;  2YJJ A;  3E1O A;  5FFC A;  1IER A;  5I4J A;  4LPJ A;  2D5K A;  4P18 A;  4W4L B;  5D8Q A;  2CHI A;  4MY7 A;  3PVY A;  4IWK A;  4TOC A;  4CYB A;  3R2M A;  4ZMC A;  5E1U A;  4RC7 B;  1IES A;  3PVR B;  5FFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...