3IQ1A

Crystal structure of dps protein from vibrio cholerae o1, a member of a broad superfamily of ferritin-like diiron-carboxylate proteins
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
156
structure length
156
Chain Sequence
MATNLIGLDTTQSQKLANALNNLLANYQVFYMNTRGYHWNIQGKEFFELHAKFEEIYTDLQLKIDELAERILTLSARPMHSFSGYLKAAQIKEHTDSIDGRSSMQGLVDGFSILLHQQRDILELAGETGDEGTSALMSDYIREQEKLVWMLNAWLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords DPS family protein
publication title Crystal structure of DPS protein from Vibrio cholerae O1, a member of a broad superfamily of ferritin-like diiron-carboxylate proteins
rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 64
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3iq1A00
3RGDA 3E1LA 5GN8A 5HQOA 2G4HA 3AF9X 3PWQC 3FI6A 4TW3A 2GYQA 3RAVA 1DATA 4ZKHA 2QQYA 1B71A 1YUXA 1TJOA 4ZLWA 1QYBA 1O9IA 1H96A 1N1QA 1VJXA 1RCEA 2Y3QA 3O7SA 4DYZA 3PVTB 2FFXJ 3F33A 4TOCA 2OH3A 2X170 3PWFA 1VELA 3KWOA 3R2OA 5JACA 1OTKA 1MFRA 2ZG9X 3AF7X 2C2JA 2ZG7X 5CMQA 3GHQA 2YJJA 2ZA7A 5FFCA 1SOFA 3R2RA 3PVYB 5JKLA 1GWGA 3GVYA 3AK8A 3IQ1A 3Q4NA 3PW8A 2WTLA 4KVQA 5I4JA 1VEIA 3PW1B 1LB3A 3WVUA 4PG1A 3F35A 4LYUA 1LKOA 4KVRA 1J30A 3PVTA 4ETRA 1JI4A 1BCFA 3ES3A 2XGWA 3IS7A 3BVIA 1SQ3A 4TOGA 4LPJA 1VEQA 3F32A 3PVRA 5JKMG 2V2IA 3NP2X 3F36A 4IWKA 2CHIA 2HTNA 4E6KA 5J8WA 3HIUA 5D8YA 4ITTA 5GU0X 4ZL6A 3SHXA 3R2MA 2FHAA 2V2JA 5FFBA 4MKUA 2BKCA 4RC6B 2RBDA 2V2OA 3Q4QA 5AXSA 1NF4A 4RC5A 3A9QA 3PW1A 2PYBA 2QF9A 4TOHA 2ITBA 4RC8A 3H7GA 4CVPA 1MOJA 2CLUA 5E1UA 2D5KA 1XZ3A 2YW6A 1NNQA 3E1QA 3R2LA 2ZG8X 4ITWA 4M34A 3E1JA 3E6SA 1F33A 2Z5QA 4PGIA 1IESA 1L8IA 3FSEA 2V2MA 2XJMA 1YV1A 4RC7B 3AJPA 2CHPA 4CMYV 2Z90A 1F30A 3PWQA 1JREA 2CEIA 1UMNA 3F38A 3VNXA 4MY7A 5K53A 5E2DA 4QUWA 3E1NA 1L8HA 1R03A 3AK9A 5FEJA 1BFRA 4CYAA 1FHAA 1HRSA 3AJQA 4IWJA 3BVLA 3R2HA 5J8SA 2C2FA 2C6RA 1JGCA 1EUMA 3BVEA 4EVBA 4KVSA 5C6FA 5ERJA 1JKUA 4EVEA 4ISMA 4TOAA 4LQVA 1JTSA 4M33A 4IXKA 4P18A 3QZ3A 4RC7A 1O9RA 4TOBA 2YW7A 4MN9A 1RCCA 1DVBA 4ZJKA 2VZBA 1JKVA 1BG7A 3KA8A 3UOIA 4DYXA 2ZURX 2CF7A 3T9JA 1RCGA 2Z5RA 1YUZA 4ZL5A 3R2SA 2Z5PA 5D8XA 3QHBA 1QGHA 2VXXA 1S2ZA 3EGMA 1AEWA 4CYBA 1LKMA 1IERA 3AJOA 1ZUJA 2V2PA 3BVFA 4ZKXA 5J9VA 3EZ0A 3Q4OA 3KA9A 2FKZA 4EVDA 3E2CA 4OYNA 3E6RA 3PVYA 1S3QA 4DZ0A 3E1PA 2WLAA 3RE7A 4AM2A 4DYUA 5HJFA 5CMRA 1UVHA 5GU3X 3UNOA 1Z4AA 1RCIA 2Z6MA 3GE4A 3EZUA 4CVSA 3IS8A 3ERZA 2BW1A 2XJNA 2WLUA 3SH6A 2JD60 5JKLG 4MUDA 2FJCA 2UX1A 3RD0A 2CN7A 3E1MA 5J93A 3PZAA 3OGHA 4PGKA 4RC6A 3F34A 5IX6A 4LPNA 5FFAA 1VLGA 3BKNA 1DPSA 3QB9A 4MJYA 5ERKA 2BK6A 1S30A 3BVKA 3QD8A 3ISFA 4M35A 5FFEA 4TOEA 2ZA6A 4II4B 5LG8A 1LKPA 2CN6A 2VXIA 5D8QA 1JI5A 2V2SA 2GS4A 3QHCA 5JKMA 4DYYA 4M32A 4LQHA 1TKPA 2C2UA 5HJHA 3SIDA 2OC5A 2JD80 4A25A 2V2RA 3Q4RA 3KXUA 3KA6A 3U90A 3BT5A 5FFDA 2CIHA 4R42A 4EVCA 5LG2A 3AF8X 4DASA 4TODA 4CVTA 1RYTA 2JD70 4ERUA 3FVBA 3PVRB 3ISEA 3WVWA 4LQJA 4Z5SA 5D8RA 5K52A 3R2KA 1RCDA 4XKTA 4II4A 3QVDA 4ZMCA 3WNWA 4XKUA 4REUA 3UOFA 4Z3BA 1Z6OA 5D8OA 2W0OA 2FZFA 1ZS3A 3E1OA 2YJKA 4AM5A 2V2LA 4TO9A 3O7RA 4DI0A 2BJYA 5D8SA 1TK6A 3SE1A 3PW8C 1JIGA 1NFVA 4RC5B 4TOFA 3MPSA 2HR5A 1JYBA 4XGSA 1NF6A 4CMYA 4Y08A 2XJOA 1TKOA 4ZTTA 2V15A 3F37A 5CZUA 3KA4A 2CLBA 2IB0A 3TA8A 4PG0A 4U3GA 4CVRA 3NOZX 5GU2X 3KX9A 5LBHA 2XKQA 4CY9A 2GYDA 4DE6A 2ZA8A 1Z6OM 2FG8A 5GN8B 4ML5A 3HL1A 4LYXA 4ISPA 5GOUA 4ZKWA 2FG4A 3OJ5A 3WVVA 2IU2A 2F7NA 2C41A 3F39A 4LPMA 2V2NA 4YKHA 3RBCA 5GU1X 1KRQA 4XKSA 1XZ1A 3KA3A 3NP0X 2IY4A 4LQNA 5D8PA 3A68A 5LS9A 2FL0A 4AM4A
chains in the Genus database with same CATH superfamily
3RGDA 3E1LA 5GN8A 5HQOA 2G4HA 4E40A 3AF9X 3PWQC 3FI6A 4TW3A 2GYQA 3RAVA 1DATA 4ZKHA 2QQYA 3M6JA 1B71A 1YUXA 1TJOA 4ZLWA 1QYBA 1O9IA 1H96A 1N1QA 1VJXA 1RCEA 2Y3QA 3O7SA 4DYZA 3PVTB 2FFXJ 3F33A 4TOCA 2OH3A 2X170 3PWFA 1VELA 3KWOA 3R2OA 5JACA 3C1YA 4X0JA 1OTKA 4W4KB 1MFRA 2ZG9X 3AF7X 2C2JA 2ZG7X 5CMQA 4MXPA 3GHQA 2YJJA 2ZA7A 2Y44A 5FFCA 1SOFA 3R2RA 3PVYB 5JKLA 1GWGA 3GVYA 3AK8A 3IQ1A 3Q4NA 3PW8A 2WTLA 4KVQA 5I4JA 1VEIA 3PW1B 1LB3A 3WVUA 4PG1A 3F35A 4LYUA 1LKOA 4KVRA 1J30A 3PVTA 4ETRA 1JI4A 1BCFA 3ES3A 2XGWA 3IS7A 3BVIA 1SQ3A 4TOGA 4LPJA 1VEQA 3F32A 3PVRA 5JKMG 2V2IA 3NP2X 3LKDA 3F36A 4IWKA 3C23A 2CHIA 2HTNA 4E6KA 5J8WA 3HIUA 5D8YA 4ITTA 5GU0X 4ZL6A 3SHXA 3R2MA 2FHAA 2V2JA 5FFBA 4MKUA 2BKCA 4RC6B 2RBDA 2V2OA 3Q4QA 5AXSA 1NF4A 4RC5A 3A9QA 3PW1A 3L0MA 2PYBA 2QF9A 4TOHA 2ITBA 4RC8A 3H7GA 4CVPA 1MOJA 2CLUA 5E1UA 2D5KA 1XZ3A 2CWLA 1NNQA 2YW6A 3E1QA 3R2LA 2ZG8X 4ITWA 4M34A 3E1JA 3E6SA 4YVZA 1F33A 2Z5QA 4PGIA 1IESA 1L8IA 3FSEA 2OKCA 2V2MA 2XJMA 1YV1A 4RC7B 3AJPA 2CHPA 2V8UA 3C1ZA 4CMYV 2Z90A 1F30A 3PWQA 1JREA 2CEIA 1UMNA 3F38A 3VNXA 4MY7A 5K53A 5E2DA 4QUWA 3E1NA 1L8HA 1R03A 3AK9A 5FEJA 1BFRA 4CYAA 1FHAA 1HRSA 3AJQA 4IWJA 3BVLA 3R2HA 5J8SA 2C2FA 2C6RA 4W4LB 1JGCA 1EUMA 3BVEA 4EVBA 4KVSA 3GGYA 5C6FA 5ERJA 1JKUA 4EVEA 4ISMA 3GGZA 4TOAA 3FRSA 4LQVA 1JTSA 4M33A 4IXKA 4P18A 4YXMA 3QZ3A 4RC7A 1O9RA 4TOBA 2YW7A 4MN9A 1RCCA 1DVBA 4ZJKA 2VZBA 1JKVA 1BG7A 3KA8A 3UOIA 4DYXA 2ZURX 2CF7A 3T9JA 1RCGA 2Z5RA 1YUZA 4ZL5A 3R2SA 2Z5PA 5D8XA 3QHBA 1QGHA 2VXXA 1S2ZA 3EGMA 1AEWA 4CYBA 1LKMA 1IERA 3AJOA 1ZUJA 2V2PA 3BVFA 4ZKXA 4WJG4 5J9VA 3EZ0A 3Q4OA 3KA9A 2N02A 2FKZA 4EVDA 3E2CA 4OYNA 3E6RA 3PVYA 1S3QA 4KXRB 3KDQA 4DZ0A 3D19A 3E1PA 2WLAA 3RE7A 4AM2A 4DYUA 5HJFA 3V3KB 5CMRA 1UVHA 5JDOB 5GU3X 3UNOA 1Z4AA 1RCIA 2Z6MA 3GE4A 3EZUA 3VV9A 4CVSA 3IS8A 2G38B 3ERZA 2BW1A 2XJNA 2WLUA 3SH6A 2JD60 2AR0A 5JKLG 4MUDA 2FJCA 2UX1A 3RD0A 2CN7A 3E1MA 5J93A 3PZAA 3OGHA 4PGKA 4RC6A 3F34A 5IX6A 4LPNA 3DBYA 5FFAA 1VLGA 3BKNA 1DPSA 3QB9A 4MJYA 5ERKA 2BK6A 1S30A 3BVKA 3QD8A 3ISFA 2WWXB 5JDOA 4M35A 5FFEA 4TOEA 2ZA6A 4II4B 5LG8A 1LKPA 2CN6A 2VXIA 5D8QA 1JI5A 2V2SA 2GS4A 3QHCA 5JKMA 4DYYA 4M32A 4LQHA 1TKPA 2C2UA 5HJHA 3SIDA 2OC5A 3VVAA 2JD80 4A25A 2V2RA 3Q4RA 3KXUA 3KA6A 3U90A 3BT5A 5FFDA 2CIHA 4R42A 4EVCA 5LG2A 3AF8X 4DASA 4TODA 4CVTA 1RYTA 2JD70 4ERUA 3FVBA 3PVRB 3ISEA 3WVWA 4LQJA 4Z5SA 5D8RA 5K52A 3R2KA 1RCDA 4XKTA 4II4A 3QVDA 4ZMCA 3WNWA 4XKUA 4REUA 3UOFA 4Z3BA 1Z6OA 5D8OA 2W0OA 2FZFA 1ZS3A 3JZ9A 2YJKA 3E1OA 4AM5A 2V2LA 4TO9A 3O7RA 4DI0A 3UFBA 2BJYA 5D8SA 1TK6A 3SE1A 3PW8C 1JIGA 1NFVA 4RC5B 4TOFA 3MPSA 2HR5A 1JYBA 4XGSA 1NF6A 4CMYA 4Y08A 2XJOA 1TKOA 4ZTTA 2V15A 3F37A 5CZUA 3KA4A 2CLBA 2IB0A 3TA8A 2MGYA 4PG0A 4U3GA 4CVRA 3NOZX 3JZAB 5GU2X 3KX9A 3C21A 3W54A 5LBHA 2XKQA 4CY9A 2GYDA 4DE6A 2ZA8A 1Z6OM 3KHKA 2FG8A 5GN8B 4ML5A 3HL1A 2V8TA 4LYXA 4ISPA 3N6OA 5GOUA 4ZKWA 2FG4A 3OJ5A 3WVVA 2IU2A 2F7NA 2C41A 3F39A 4LPMA 3FRRA 4YXJA 2V2NA 4YKHA 3RBCA 5GU1X 1KRQA 4XKSA 1XZ1A 5HU6D 3KA3A 3NP0X 2IY4A 4LQNA 5D8PA 3A68A 5LS9A 2FL0A 4AM4A
chains in the Genus database with same CATH topology
3RGDA 3E1LA 5GN8A 5HQOA 2G4HA 4E40A 3AF9X 3PWQC 3FI6A 4TW3A 2GYQA 3RAVA 1DATA 4ZKHA 2QQYA 3M6JA 1B71A 1YUXA 1TJOA 4ZLWA 1QYBA 1O9IA 1H96A 1N1QA 1VJXA 1RCEA 2Y3QA 3O7SA 4DYZA 3PVTB 2FFXJ 3F33A 4TOCA 2OH3A 2X170 3PWFA 1VELA 3KWOA 3R2OA 5JACA 3C1YA 4X0JA 1OTKA 4W4KB 1MFRA 2ZG9X 3AF7X 2C2JA 2ZG7X 5CMQA 4MXPA 3GHQA 2YJJA 2ZA7A 2Y44A 5FFCA 1SOFA 3R2RA 3PVYB 5JKLA 1GWGA 3GVYA 3AK8A 3IQ1A 3Q4NA 3PW8A 2WTLA 4KVQA 5I4JA 1VEIA 3PW1B 1LB3A 3WVUA 4PG1A 3F35A 4LYUA 1LKOA 4KVRA 1J30A 3PVTA 4ETRA 1JI4A 1BCFA 3ES3A 2XGWA 3IS7A 3BVIA 1SQ3A 4TOGA 4LPJA 1VEQA 3F32A 3PVRA 5JKMG 2V2IA 3NP2X 3LKDA 3F36A 4IWKA 3C23A 2CHIA 2HTNA 4E6KA 5J8WA 3HIUA 5D8YA 4ITTA 5GU0X 4ZL6A 3SHXA 3R2MA 2FHAA 2V2JA 5FFBA 4MKUA 2BKCA 4RC6B 2RBDA 2V2OA 3Q4QA 5AXSA 1NF4A 4RC5A 3A9QA 3PW1A 3L0MA 2PYBA 2QF9A 4TOHA 2ITBA 4RC8A 3H7GA 4CVPA 1MOJA 2CLUA 5E1UA 2D5KA 1XZ3A 2CWLA 1NNQA 2YW6A 3E1QA 3R2LA 2ZG8X 4ITWA 4M34A 3E1JA 3E6SA 4YVZA 1F33A 2Z5QA 4PGIA 1IESA 1L8IA 3FSEA 2OKCA 2V2MA 2XJMA 1YV1A 4RC7B 3AJPA 2CHPA 2V8UA 3C1ZA 4CMYV 2Z90A 1F30A 3PWQA 1JREA 2CEIA 1UMNA 3F38A 3VNXA 4MY7A 5K53A 5E2DA 4QUWA 3E1NA 1L8HA 1R03A 3AK9A 5FEJA 1BFRA 4CYAA 1FHAA 1HRSA 3AJQA 4IWJA 3BVLA 3R2HA 5J8SA 2C2FA 2C6RA 4W4LB 1JGCA 1EUMA 3BVEA 4EVBA 4KVSA 3GGYA 5C6FA 5ERJA 1JKUA 4EVEA 4ISMA 3GGZA 4TOAA 3FRSA 4LQVA 1JTSA 4M33A 4IXKA 4P18A 4YXMA 3QZ3A 4RC7A 1O9RA 4TOBA 2YW7A 4MN9A 1RCCA 1DVBA 4ZJKA 2VZBA 1JKVA 1BG7A 3KA8A 3UOIA 4DYXA 2ZURX 2CF7A 3T9JA 1RCGA 2Z5RA 1YUZA 4ZL5A 3R2SA 2Z5PA 5D8XA 3QHBA 1QGHA 2VXXA 1S2ZA 3EGMA 1AEWA 4CYBA 1LKMA 1IERA 3AJOA 1ZUJA 2V2PA 3BVFA 4ZKXA 4WJG4 5J9VA 3EZ0A 3Q4OA 3KA9A 2N02A 2FKZA 4EVDA 3E2CA 4OYNA 3E6RA 3PVYA 1S3QA 4KXRB 3KDQA 4DZ0A 3D19A 3E1PA 2WLAA 3RE7A 4AM2A 4DYUA 5HJFA 3V3KB 5CMRA 1UVHA 5JDOB 5GU3X 3UNOA 1Z4AA 1RCIA 2Z6MA 3GE4A 3EZUA 3VV9A 4CVSA 3IS8A 2G38B 3ERZA 2BW1A 2XJNA 2WLUA 3SH6A 2JD60 2AR0A 5JKLG 4MUDA 2FJCA 2UX1A 3RD0A 2CN7A 3E1MA 5J93A 3PZAA 3OGHA 4PGKA 4RC6A 3F34A 5IX6A 4LPNA 3DBYA 5FFAA 1VLGA 3BKNA 1DPSA 3QB9A 4MJYA 5ERKA 2BK6A 1S30A 3BVKA 3QD8A 3ISFA 2WWXB 5JDOA 4M35A 5FFEA 4TOEA 2ZA6A 4II4B 5LG8A 1LKPA 2CN6A 2VXIA 5D8QA 1JI5A 2V2SA 2GS4A 3QHCA 5JKMA 4DYYA 4M32A 4LQHA 1TKPA 2C2UA 5HJHA 3SIDA 2OC5A 3VVAA 2JD80 4A25A 2V2RA 3Q4RA 3KXUA 3KA6A 3U90A 3BT5A 5FFDA 2CIHA 4R42A 4EVCA 5LG2A 3AF8X 4DASA 4TODA 4CVTA 1RYTA 2JD70 4ERUA 3FVBA 3PVRB 3ISEA 3WVWA 4LQJA 4Z5SA 5D8RA 5K52A 3R2KA 1RCDA 4XKTA 4II4A 3QVDA 4ZMCA 3WNWA 4XKUA 4REUA 3UOFA 4Z3BA 1Z6OA 5D8OA 2W0OA 2FZFA 1ZS3A 3JZ9A 2YJKA 3E1OA 4AM5A 2V2LA 4TO9A 3O7RA 4DI0A 3UFBA 2BJYA 5D8SA 1TK6A 3SE1A 3PW8C 1JIGA 1NFVA 4RC5B 4TOFA 3MPSA 2HR5A 1JYBA 4XGSA 1NF6A 4CMYA 4Y08A 2XJOA 1TKOA 4ZTTA 2V15A 3F37A 5CZUA 3KA4A 2CLBA 2IB0A 3TA8A 2MGYA 4PG0A 4U3GA 4CVRA 3NOZX 3JZAB 5GU2X 3KX9A 3C21A 3W54A 5LBHA 2XKQA 4CY9A 2GYDA 4DE6A 2ZA8A 1Z6OM 3KHKA 2FG8A 5GN8B 4ML5A 3HL1A 2V8TA 4LYXA 4ISPA 3N6OA 5GOUA 4ZKWA 2FG4A 3OJ5A 3WVVA 2IU2A 2F7NA 2C41A 3F39A 4LPMA 3FRRA 4YXJA 2V2NA 4YKHA 3RBCA 5GU1X 1KRQA 4XKSA 1XZ1A 5HU6D 3KA3A 3NP0X 2IY4A 4LQNA 5D8PA 3A68A 5LS9A 2FL0A 4AM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGD A;  3E1L A;  5GN8 A;  5HQO A;  2G4H A;  3AF9 X;  3PWQ C;  3FI6 A;  4TW3 A;  2GYQ A;  3RAV A;  1DAT A;  4ZKH A;  2QQY A;  1B71 A;  1YUX A;  1TJO A;  4ZLW A;  1QYB A;  1O9I A;  1H96 A;  1N1Q A;  1VJX A;  1RCE A;  2Y3Q A;  3O7S A;  4DYZ A;  3PVT B;  2FFX J;  3F33 A;  4TOC A;  2OH3 A;  2X17 0;  3PWF A;  1VEL A;  3KWO A;  3R2O A;  5JAC A;  1OTK A;  1MFR A;  2ZG9 X;  3AF7 X;  2C2J A;  2ZG7 X;  5CMQ A;  3GHQ A;  2YJJ A;  2ZA7 A;  5FFC A;  1SOF A;  3R2R A;  3PVY B;  5JKL A;  1GWG A;  3GVY A;  3AK8 A;  3IQ1 A;  3Q4N A;  3PW8 A;  2WTL A;  4KVQ A;  5I4J A;  1VEI A;  3PW1 B;  1LB3 A;  3WVU A;  4PG1 A;  3F35 A;  4LYU A;  1LKO A;  4KVR A;  1J30 A;  3PVT A;  4ETR A;  1JI4 A;  1BCF A;  3ES3 A;  2XGW A;  3IS7 A;  3BVI A;  1SQ3 A;  4TOG A;  4LPJ A;  1VEQ A;  3F32 A;  3PVR A;  5JKM G;  2V2I A;  3NP2 X;  3F36 A;  4IWK A;  2CHI A;  2HTN A;  4E6K A;  5J8W A;  3HIU A;  5D8Y A;  4ITT A;  5GU0 X;  4ZL6 A;  3SHX A;  3R2M A;  2FHA A;  2V2J A;  5FFB A;  4MKU A;  2BKC A;  4RC6 B;  2RBD A;  2V2O A;  3Q4Q A;  5AXS A;  1NF4 A;  4RC5 A;  3A9Q A;  3PW1 A;  2PYB A;  2QF9 A;  4TOH A;  2ITB A;  4RC8 A;  3H7G A;  4CVP A;  1MOJ A;  2CLU A;  5E1U A;  2D5K A;  1XZ3 A;  2YW6 A;  1NNQ A;  3E1Q A;  3R2L A;  2ZG8 X;  4ITW A;  4M34 A;  3E1J A;  3E6S A;  1F33 A;  2Z5Q A;  4PGI A;  1IES A;  1L8I A;  3FSE A;  2V2M A;  2XJM A;  1YV1 A;  4RC7 B;  3AJP A;  2CHP A;  4CMY V;  2Z90 A;  1F30 A;  3PWQ A;  1JRE A;  2CEI A;  1UMN A;  3F38 A;  3VNX A;  4MY7 A;  5K53 A;  5E2D A;  4QUW A;  3E1N A;  1L8H A;  1R03 A;  3AK9 A;  5FEJ A;  1BFR A;  4CYA A;  1FHA A;  1HRS A;  3AJQ A;  4IWJ A;  3BVL A;  3R2H A;  5J8S A;  2C2F A;  2C6R A;  1JGC A;  1EUM A;  3BVE A;  4EVB A;  4KVS A;  5C6F A;  5ERJ A;  1JKU A;  4EVE A;  4ISM A;  4TOA A;  4LQV A;  1JTS A;  4M33 A;  4IXK A;  4P18 A;  3QZ3 A;  4RC7 A;  1O9R A;  4TOB A;  2YW7 A;  4MN9 A;  1RCC A;  1DVB A;  4ZJK A;  2VZB A;  1JKV A;  1BG7 A;  3KA8 A;  3UOI A;  4DYX A;  2ZUR X;  2CF7 A;  3T9J A;  1RCG A;  2Z5R A;  1YUZ A;  4ZL5 A;  3R2S A;  2Z5P A;  5D8X A;  3QHB A;  1QGH A;  2VXX A;  1S2Z A;  3EGM A;  1AEW A;  4CYB A;  1LKM A;  1IER A;  3AJO A;  1ZUJ A;  2V2P A;  3BVF A;  4ZKX A;  5J9V A;  3EZ0 A;  3Q4O A;  3KA9 A;  2FKZ A;  4EVD A;  3E2C A;  4OYN A;  3E6R A;  3PVY A;  1S3Q A;  4DZ0 A;  3E1P A;  2WLA A;  3RE7 A;  4AM2 A;  4DYU A;  5HJF A;  5CMR A;  1UVH A;  5GU3 X;  3UNO A;  1Z4A A;  1RCI A;  2Z6M A;  3GE4 A;  3EZU A;  4CVS A;  3IS8 A;  3ERZ A;  2BW1 A;  2XJN A;  2WLU A;  3SH6 A;  2JD6 0;  5JKL G;  4MUD A;  2FJC A;  2UX1 A;  3RD0 A;  2CN7 A;  3E1M A;  5J93 A;  3PZA A;  3OGH A;  4PGK A;  4RC6 A;  3F34 A;  5IX6 A;  4LPN A;  5FFA A;  1VLG A;  3BKN A;  1DPS A;  3QB9 A;  4MJY A;  5ERK A;  2BK6 A;  1S30 A;  3BVK A;  3QD8 A;  3ISF A;  4M35 A;  5FFE A;  4TOE A;  2ZA6 A;  4II4 B;  5LG8 A;  1LKP A;  2CN6 A;  2VXI A;  5D8Q A;  1JI5 A;  2V2S A;  2GS4 A;  3QHC A;  5JKM A;  4DYY A;  4M32 A;  4LQH A;  1TKP A;  2C2U A;  5HJH A;  3SID A;  2OC5 A;  2JD8 0;  4A25 A;  2V2R A;  3Q4R A;  3KXU A;  3KA6 A;  3U90 A;  3BT5 A;  5FFD A;  2CIH A;  4R42 A;  4EVC A;  5LG2 A;  3AF8 X;  4DAS A;  4TOD A;  4CVT A;  1RYT A;  2JD7 0;  4ERU A;  3FVB A;  3PVR B;  3ISE A;  3WVW A;  4LQJ A;  4Z5S A;  5D8R A;  5K52 A;  3R2K A;  1RCD A;  4XKT A;  4II4 A;  3QVD A;  4ZMC A;  3WNW A;  4XKU A;  4REU A;  3UOF A;  4Z3B A;  1Z6O A;  5D8O A;  2W0O A;  2FZF A;  1ZS3 A;  3E1O A;  2YJK A;  4AM5 A;  2V2L A;  4TO9 A;  3O7R A;  4DI0 A;  2BJY A;  5D8S A;  1TK6 A;  3SE1 A;  3PW8 C;  1JIG A;  1NFV A;  4RC5 B;  4TOF A;  3MPS A;  2HR5 A;  1JYB A;  4XGS A;  1NF6 A;  4CMY A;  4Y08 A;  2XJO A;  1TKO A;  4ZTT A;  2V15 A;  3F37 A;  5CZU A;  3KA4 A;  2CLB A;  2IB0 A;  3TA8 A;  4PG0 A;  4U3G A;  4CVR A;  3NOZ X;  5GU2 X;  3KX9 A;  5LBH A;  2XKQ A;  4CY9 A;  2GYD A;  4DE6 A;  2ZA8 A;  1Z6O M;  2FG8 A;  5GN8 B;  4ML5 A;  3HL1 A;  4LYX A;  4ISP A;  5GOU A;  4ZKW A;  2FG4 A;  3OJ5 A;  3WVV A;  2IU2 A;  2F7N A;  2C41 A;  3F39 A;  4LPM A;  2V2N A;  4YKH A;  3RBC A;  5GU1 X;  1KRQ A;  4XKS A;  1XZ1 A;  3KA3 A;  3NP0 X;  2IY4 A;  4LQN A;  5D8P A;  3A68 A;  5LS9 A;  2FL0 A;  4AM4 A; 
#chains in the Genus database with same CATH topology
 3RGD A;  3E1L A;  5GN8 A;  5HQO A;  2G4H A;  4E40 A;  3AF9 X;  3PWQ C;  3FI6 A;  4TW3 A;  2GYQ A;  3RAV A;  1DAT A;  4ZKH A;  2QQY A;  3M6J A;  1B71 A;  1YUX A;  1TJO A;  4ZLW A;  1QYB A;  1O9I A;  1H96 A;  1N1Q A;  1VJX A;  1RCE A;  2Y3Q A;  3O7S A;  4DYZ A;  3PVT B;  2FFX J;  3F33 A;  4TOC A;  2OH3 A;  2X17 0;  3PWF A;  1VEL A;  3KWO A;  3R2O A;  5JAC A;  3C1Y A;  4X0J A;  1OTK A;  4W4K B;  1MFR A;  2ZG9 X;  3AF7 X;  2C2J A;  2ZG7 X;  5CMQ A;  4MXP A;  3GHQ A;  2YJJ A;  2ZA7 A;  2Y44 A;  5FFC A;  1SOF A;  3R2R A;  3PVY B;  5JKL A;  1GWG A;  3GVY A;  3AK8 A;  3IQ1 A;  3Q4N A;  3PW8 A;  2WTL A;  4KVQ A;  5I4J A;  1VEI A;  3PW1 B;  1LB3 A;  3WVU A;  4PG1 A;  3F35 A;  4LYU A;  1LKO A;  4KVR A;  1J30 A;  3PVT A;  4ETR A;  1JI4 A;  1BCF A;  3ES3 A;  2XGW A;  3IS7 A;  3BVI A;  1SQ3 A;  4TOG A;  4LPJ A;  1VEQ A;  3F32 A;  3PVR A;  5JKM G;  2V2I A;  3NP2 X;  3LKD A;  3F36 A;  4IWK A;  3C23 A;  2CHI A;  2HTN A;  4E6K A;  5J8W A;  3HIU A;  5D8Y A;  4ITT A;  5GU0 X;  4ZL6 A;  3SHX A;  3R2M A;  2FHA A;  2V2J A;  5FFB A;  4MKU A;  2BKC A;  4RC6 B;  2RBD A;  2V2O A;  3Q4Q A;  5AXS A;  1NF4 A;  4RC5 A;  3A9Q A;  3PW1 A;  3L0M A;  2PYB A;  2QF9 A;  4TOH A;  2ITB A;  4RC8 A;  3H7G A;  4CVP A;  1MOJ A;  2CLU A;  5E1U A;  2D5K A;  1XZ3 A;  2CWL A;  1NNQ A;  2YW6 A;  3E1Q A;  3R2L A;  2ZG8 X;  4ITW A;  4M34 A;  3E1J A;  3E6S A;  4YVZ A;  1F33 A;  2Z5Q A;  4PGI A;  1IES A;  1L8I A;  3FSE A;  2OKC A;  2V2M A;  2XJM A;  1YV1 A;  4RC7 B;  3AJP A;  2CHP A;  2V8U A;  3C1Z A;  4CMY V;  2Z90 A;  1F30 A;  3PWQ A;  1JRE A;  2CEI A;  1UMN A;  3F38 A;  3VNX A;  4MY7 A;  5K53 A;  5E2D A;  4QUW A;  3E1N A;  1L8H A;  1R03 A;  3AK9 A;  5FEJ A;  1BFR A;  4CYA A;  1FHA A;  1HRS A;  3AJQ A;  4IWJ A;  3BVL A;  3R2H A;  5J8S A;  2C2F A;  2C6R A;  4W4L B;  1JGC A;  1EUM A;  3BVE A;  4EVB A;  4KVS A;  3GGY A;  5C6F A;  5ERJ A;  1JKU A;  4EVE A;  4ISM A;  3GGZ A;  4TOA A;  3FRS A;  4LQV A;  1JTS A;  4M33 A;  4IXK A;  4P18 A;  4YXM A;  3QZ3 A;  4RC7 A;  1O9R A;  4TOB A;  2YW7 A;  4MN9 A;  1RCC A;  1DVB A;  4ZJK A;  2VZB A;  1JKV A;  1BG7 A;  3KA8 A;  3UOI A;  4DYX A;  2ZUR X;  2CF7 A;  3T9J A;  1RCG A;  2Z5R A;  1YUZ A;  4ZL5 A;  3R2S A;  2Z5P A;  5D8X A;  3QHB A;  1QGH A;  2VXX A;  1S2Z A;  3EGM A;  1AEW A;  4CYB A;  1LKM A;  1IER A;  3AJO A;  1ZUJ A;  2V2P A;  3BVF A;  4ZKX A;  4WJG 4;  5J9V A;  3EZ0 A;  3Q4O A;  3KA9 A;  2N02 A;  2FKZ A;  4EVD A;  3E2C A;  4OYN A;  3E6R A;  3PVY A;  1S3Q A;  4KXR B;  3KDQ A;  4DZ0 A;  3D19 A;  3E1P A;  2WLA A;  3RE7 A;  4AM2 A;  4DYU A;  5HJF A;  3V3K B;  5CMR A;  1UVH A;  5JDO B;  5GU3 X;  3UNO A;  1Z4A A;  1RCI A;  2Z6M A;  3GE4 A;  3EZU A;  3VV9 A;  4CVS A;  3IS8 A;  2G38 B;  3ERZ A;  2BW1 A;  2XJN A;  2WLU A;  3SH6 A;  2JD6 0;  2AR0 A;  5JKL G;  4MUD A;  2FJC A;  2UX1 A;  3RD0 A;  2CN7 A;  3E1M A;  5J93 A;  3PZA A;  3OGH A;  4PGK A;  4RC6 A;  3F34 A;  5IX6 A;  4LPN A;  3DBY A;  5FFA A;  1VLG A;  3BKN A;  1DPS A;  3QB9 A;  4MJY A;  5ERK A;  2BK6 A;  1S30 A;  3BVK A;  3QD8 A;  3ISF A;  2WWX B;  5JDO A;  4M35 A;  5FFE A;  4TOE A;  2ZA6 A;  4II4 B;  5LG8 A;  1LKP A;  2CN6 A;  2VXI A;  5D8Q A;  1JI5 A;  2V2S A;  2GS4 A;  3QHC A;  5JKM A;  4DYY A;  4M32 A;  4LQH A;  1TKP A;  2C2U A;  5HJH A;  3SID A;  2OC5 A;  3VVA A;  2JD8 0;  4A25 A;  2V2R A;  3Q4R A;  3KXU A;  3KA6 A;  3U90 A;  3BT5 A;  5FFD A;  2CIH A;  4R42 A;  4EVC A;  5LG2 A;  3AF8 X;  4DAS A;  4TOD A;  4CVT A;  1RYT A;  2JD7 0;  4ERU A;  3FVB A;  3PVR B;  3ISE A;  3WVW A;  4LQJ A;  4Z5S A;  5D8R A;  5K52 A;  3R2K A;  1RCD A;  4XKT A;  4II4 A;  3QVD A;  4ZMC A;  3WNW A;  4XKU A;  4REU A;  3UOF A;  4Z3B A;  1Z6O A;  5D8O A;  2W0O A;  2FZF A;  1ZS3 A;  3JZ9 A;  2YJK A;  3E1O A;  4AM5 A;  2V2L A;  4TO9 A;  3O7R A;  4DI0 A;  3UFB A;  2BJY A;  5D8S A;  1TK6 A;  3SE1 A;  3PW8 C;  1JIG A;  1NFV A;  4RC5 B;  4TOF A;  3MPS A;  2HR5 A;  1JYB A;  4XGS A;  1NF6 A;  4CMY A;  4Y08 A;  2XJO A;  1TKO A;  4ZTT A;  2V15 A;  3F37 A;  5CZU A;  3KA4 A;  2CLB A;  2IB0 A;  3TA8 A;  2MGY A;  4PG0 A;  4U3G A;  4CVR A;  3NOZ X;  3JZA B;  5GU2 X;  3KX9 A;  3C21 A;  3W54 A;  5LBH A;  2XKQ A;  4CY9 A;  2GYD A;  4DE6 A;  2ZA8 A;  1Z6O M;  3KHK A;  2FG8 A;  5GN8 B;  4ML5 A;  3HL1 A;  2V8T A;  4LYX A;  4ISP A;  3N6O A;  5GOU A;  4ZKW A;  2FG4 A;  3OJ5 A;  3WVV A;  2IU2 A;  2F7N A;  2C41 A;  3F39 A;  4LPM A;  3FRR A;  4YXJ A;  2V2N A;  4YKH A;  3RBC A;  5GU1 X;  1KRQ A;  4XKS A;  1XZ1 A;  5HU6 D;  3KA3 A;  3NP0 X;  2IY4 A;  4LQN A;  5D8P A;  3A68 A;  5LS9 A;  2FL0 A;  4AM4 A; 
#chains in the Genus database with same CATH homology
 3RGD A;  3E1L A;  5GN8 A;  5HQO A;  2G4H A;  4E40 A;  3AF9 X;  3PWQ C;  3FI6 A;  4TW3 A;  2GYQ A;  3RAV A;  1DAT A;  4ZKH A;  2QQY A;  3M6J A;  1B71 A;  1YUX A;  1TJO A;  4ZLW A;  1QYB A;  1O9I A;  1H96 A;  1N1Q A;  1VJX A;  1RCE A;  2Y3Q A;  3O7S A;  4DYZ A;  3PVT B;  2FFX J;  3F33 A;  4TOC A;  2OH3 A;  2X17 0;  3PWF A;  1VEL A;  3KWO A;  3R2O A;  5JAC A;  3C1Y A;  4X0J A;  1OTK A;  4W4K B;  1MFR A;  2ZG9 X;  3AF7 X;  2C2J A;  2ZG7 X;  5CMQ A;  4MXP A;  3GHQ A;  2YJJ A;  2ZA7 A;  2Y44 A;  5FFC A;  1SOF A;  3R2R A;  3PVY B;  5JKL A;  1GWG A;  3GVY A;  3AK8 A;  3IQ1 A;  3Q4N A;  3PW8 A;  2WTL A;  4KVQ A;  5I4J A;  1VEI A;  3PW1 B;  1LB3 A;  3WVU A;  4PG1 A;  3F35 A;  4LYU A;  1LKO A;  4KVR A;  1J30 A;  3PVT A;  4ETR A;  1JI4 A;  1BCF A;  3ES3 A;  2XGW A;  3IS7 A;  3BVI A;  1SQ3 A;  4TOG A;  4LPJ A;  1VEQ A;  3F32 A;  3PVR A;  5JKM G;  2V2I A;  3NP2 X;  3LKD A;  3F36 A;  4IWK A;  3C23 A;  2CHI A;  2HTN A;  4E6K A;  5J8W A;  3HIU A;  5D8Y A;  4ITT A;  5GU0 X;  4ZL6 A;  3SHX A;  3R2M A;  2FHA A;  2V2J A;  5FFB A;  4MKU A;  2BKC A;  4RC6 B;  2RBD A;  2V2O A;  3Q4Q A;  5AXS A;  1NF4 A;  4RC5 A;  3A9Q A;  3PW1 A;  3L0M A;  2PYB A;  2QF9 A;  4TOH A;  2ITB A;  4RC8 A;  3H7G A;  4CVP A;  1MOJ A;  2CLU A;  5E1U A;  2D5K A;  1XZ3 A;  2CWL A;  1NNQ A;  2YW6 A;  3E1Q A;  3R2L A;  2ZG8 X;  4ITW A;  4M34 A;  3E1J A;  3E6S A;  4YVZ A;  1F33 A;  2Z5Q A;  4PGI A;  1IES A;  1L8I A;  3FSE A;  2OKC A;  2V2M A;  2XJM A;  1YV1 A;  4RC7 B;  3AJP A;  2CHP A;  2V8U A;  3C1Z A;  4CMY V;  2Z90 A;  1F30 A;  3PWQ A;  1JRE A;  2CEI A;  1UMN A;  3F38 A;  3VNX A;  4MY7 A;  5K53 A;  5E2D A;  4QUW A;  3E1N A;  1L8H A;  1R03 A;  3AK9 A;  5FEJ A;  1BFR A;  4CYA A;  1FHA A;  1HRS A;  3AJQ A;  4IWJ A;  3BVL A;  3R2H A;  5J8S A;  2C2F A;  2C6R A;  4W4L B;  1JGC A;  1EUM A;  3BVE A;  4EVB A;  4KVS A;  3GGY A;  5C6F A;  5ERJ A;  1JKU A;  4EVE A;  4ISM A;  3GGZ A;  4TOA A;  3FRS A;  4LQV A;  1JTS A;  4M33 A;  4IXK A;  4P18 A;  4YXM A;  3QZ3 A;  4RC7 A;  1O9R A;  4TOB A;  2YW7 A;  4MN9 A;  1RCC A;  1DVB A;  4ZJK A;  2VZB A;  1JKV A;  1BG7 A;  3KA8 A;  3UOI A;  4DYX A;  2ZUR X;  2CF7 A;  3T9J A;  1RCG A;  2Z5R A;  1YUZ A;  4ZL5 A;  3R2S A;  2Z5P A;  5D8X A;  3QHB A;  1QGH A;  2VXX A;  1S2Z A;  3EGM A;  1AEW A;  4CYB A;  1LKM A;  1IER A;  3AJO A;  1ZUJ A;  2V2P A;  3BVF A;  4ZKX A;  4WJG 4;  5J9V A;  3EZ0 A;  3Q4O A;  3KA9 A;  2N02 A;  2FKZ A;  4EVD A;  3E2C A;  4OYN A;  3E6R A;  3PVY A;  1S3Q A;  4KXR B;  3KDQ A;  4DZ0 A;  3D19 A;  3E1P A;  2WLA A;  3RE7 A;  4AM2 A;  4DYU A;  5HJF A;  3V3K B;  5CMR A;  1UVH A;  5JDO B;  5GU3 X;  3UNO A;  1Z4A A;  1RCI A;  2Z6M A;  3GE4 A;  3EZU A;  3VV9 A;  4CVS A;  3IS8 A;  2G38 B;  3ERZ A;  2BW1 A;  2XJN A;  2WLU A;  3SH6 A;  2JD6 0;  2AR0 A;  5JKL G;  4MUD A;  2FJC A;  2UX1 A;  3RD0 A;  2CN7 A;  3E1M A;  5J93 A;  3PZA A;  3OGH A;  4PGK A;  4RC6 A;  3F34 A;  5IX6 A;  4LPN A;  3DBY A;  5FFA A;  1VLG A;  3BKN A;  1DPS A;  3QB9 A;  4MJY A;  5ERK A;  2BK6 A;  1S30 A;  3BVK A;  3QD8 A;  3ISF A;  2WWX B;  5JDO A;  4M35 A;  5FFE A;  4TOE A;  2ZA6 A;  4II4 B;  5LG8 A;  1LKP A;  2CN6 A;  2VXI A;  5D8Q A;  1JI5 A;  2V2S A;  2GS4 A;  3QHC A;  5JKM A;  4DYY A;  4M32 A;  4LQH A;  1TKP A;  2C2U A;  5HJH A;  3SID A;  2OC5 A;  3VVA A;  2JD8 0;  4A25 A;  2V2R A;  3Q4R A;  3KXU A;  3KA6 A;  3U90 A;  3BT5 A;  5FFD A;  2CIH A;  4R42 A;  4EVC A;  5LG2 A;  3AF8 X;  4DAS A;  4TOD A;  4CVT A;  1RYT A;  2JD7 0;  4ERU A;  3FVB A;  3PVR B;  3ISE A;  3WVW A;  4LQJ A;  4Z5S A;  5D8R A;  5K52 A;  3R2K A;  1RCD A;  4XKT A;  4II4 A;  3QVD A;  4ZMC A;  3WNW A;  4XKU A;  4REU A;  3UOF A;  4Z3B A;  1Z6O A;  5D8O A;  2W0O A;  2FZF A;  1ZS3 A;  3JZ9 A;  2YJK A;  3E1O A;  4AM5 A;  2V2L A;  4TO9 A;  3O7R A;  4DI0 A;  3UFB A;  2BJY A;  5D8S A;  1TK6 A;  3SE1 A;  3PW8 C;  1JIG A;  1NFV A;  4RC5 B;  4TOF A;  3MPS A;  2HR5 A;  1JYB A;  4XGS A;  1NF6 A;  4CMY A;  4Y08 A;  2XJO A;  1TKO A;  4ZTT A;  2V15 A;  3F37 A;  5CZU A;  3KA4 A;  2CLB A;  2IB0 A;  3TA8 A;  2MGY A;  4PG0 A;  4U3G A;  4CVR A;  3NOZ X;  3JZA B;  5GU2 X;  3KX9 A;  3C21 A;  3W54 A;  5LBH A;  2XKQ A;  4CY9 A;  2GYD A;  4DE6 A;  2ZA8 A;  1Z6O M;  3KHK A;  2FG8 A;  5GN8 B;  4ML5 A;  3HL1 A;  2V8T A;  4LYX A;  4ISP A;  3N6O A;  5GOU A;  4ZKW A;  2FG4 A;  3OJ5 A;  3WVV A;  2IU2 A;  2F7N A;  2C41 A;  3F39 A;  4LPM A;  3FRR A;  4YXJ A;  2V2N A;  4YKH A;  3RBC A;  5GU1 X;  1KRQ A;  4XKS A;  1XZ1 A;  5HU6 D;  3KA3 A;  3NP0 X;  2IY4 A;  4LQN A;  5D8P A;  3A68 A;  5LS9 A;  2FL0 A;  4AM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...