1VEQA

Mycobacterium smegmatis dps hexagonal form
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
158
structure length
158
Chain Sequence
SFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQWFVRAHLESAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords starvation-induced DNA protecting protein
publication title X-ray analysis of Mycobacterium smegmatis Dps and a comparative study involving other Dps and Dps-like molecules
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 64
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2004-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1veqA00
4LYXA 5HJFA 1QGHA 2Y3QA 3AK9A 4RC5A 1B71A 4ZTTA 1TKOA 5LG2A 3ISFA 5CZUA 1VELA 3RBCA 3PVTA 3F39A 2QF9A 3FSEA 2Z90A 4ZKHA 1BG7A 3R2RA 2HR5A 1JREA 3R2MA 5CMRA 1YV1A 4LYUA 5E2DA 4LQJA 4ML5A 2X170 5GU3X 2CLUA 2V15A 3PW1B 4REUA 2YJJA 2Z5RA 2OH3A 3E1JA 2IB0A 3H7GA 4KVRA 5I4JA 2FG4A 3ISEA 5D8SA 2CLBA 2XKQA 1DVBA 1KRQA 1F33A 2Z5PA 4MY7A 4U3GA 2FZFA 4ZJKA 3F32A 2FL0A 3RD0A 2ZA6A 3F33A 4CY9A 3E6RA 3HL1A 5D8QA 3AF9X 4DYXA 1QYBA 4LQVA 1MFRA 5JKLG 3PVRA 4DZ0A 3AF8X 3R2LA 3QZ3A 3WNWA 4CMYV 5JACA 4TODA 1S2ZA 3BKNA 5LBHA 3QVDA 1OTKA 3R2OA 3R2HA 5FEJA 3Q4RA 1JGCA 3GHQA 1JI4A 4CMYA 5GN8B 4TOEA 4M35A 3QHCA 1JI5A 2JD60 3VNXA 4M33A 3NP0X 1LB3A 4TOFA 4XGSA 5GU0X 1EUMA 1JKUA 2FJCA 1L8HA 2ZURX 1Z6OM 3E1MA 2C2JA 2ITBA 1GWGA 2QQYA 2VXXA 1SOFA 3E6SA 1DATA 2Z6MA 3GE4A 1RCCA 4CYAA 4P18A 1N1QA 1UMNA 3AJQA 2JD80 4M32A 3F34A 3UOIA 5CMQA 4KVSA 3AJPA 4ETRA 1NFVA 3QD8A 5HQOA 4XKUA 3PWFA 5FFDA 2YW6A 4LQNA 1O9RA 2CN6A 4PG1A 4IWJA 2CHIA 4PG0A 1RCEA 5JKMA 3WVWA 3PW1A 4CVRA 4YKHA 4RC6A 2V2LA 1SQ3A 3RAVA 1F30A 3TA8A 1VEQA 1ZS3A 4EVBA 1LKOA 2V2JA 4XKTA 4ISPA 4RC6B 2V2NA 2XGWA 1FHAA 3KA8A 1MOJA 2JD70 3Q4NA 4OYNA 1RCIA 2Z5QA 3PW8C 5J8WA 1IERA 4TOGA 5IX6A 2YJKA 1RCGA 1VEIA 4DYZA 2FFXJ 2BW1A 5AXSA 5C6FA 3R2KA 4ZL5A 1YUXA 5FFCA 3AJOA 1JIGA 3Q4QA 4ZMCA 1LKMA 5D8RA 2C2FA 3GVYA 5K52A 2PYBA 3R2SA 2V2MA 3OGHA 4TO9A 4AM4A 4M34A 3WVUA 1UVHA 4QUWA 4ZKWA 3OJ5A 1Z4AA 4TOBA 2BJYA 5GN8A 2BKCA 3KXUA 1Z6OA 3PZAA 2C2UA 5JKMG 1IESA 2D5KA 2ZG7X 2WTLA 1HRSA 3FI6A 4RC7B 2GYQA 2ZG8X 3AF7X 2V2PA 1S3QA 2BK6A 3BVLA 3UOFA 2V2RA 3U90A 2XJNA 1JYBA 3A68A 3HIUA 5HJHA 3MPSA 3PVYB 4DYYA 4ERUA 2OC5A 3SIDA 4II4B 5D8OA 2ZA8A 5J8SA 4CYBA 4KVQA 4Z3BA 2ZA7A 1TK6A 4Z5SA 2CF7A 2FHAA 3BVEA 5LG8A 1NF4A 4PGKA 2G4HA 4MN9A 2CHPA 1O9IA 3EGMA 3O7RA 5FFAA 4LPMA 2GYDA 2GS4A 4EVEA 1VJXA 4TOAA 3SHXA 5ERKA 5FFBA 1JKVA 5GU1X 2IY4A 5JKLA 3KA9A 1RYTA 2C6RA 4XKSA 3EZUA 3NOZX 2W0OA 4LPJA 3EZ0A 3KA4A 3E1LA 4TOCA 4DYUA 4DE6A 4R42A 3IS7A 4RC5B 4CVTA 3E2CA 3BT5A 3F36A 3KX9A 4EVDA 3KA3A 3F38A 3PVTB 4DASA 3E1NA 5E1UA 2IU2A 2F7NA 1DPSA 1BCFA 2XJMA 2UX1A 5GU2X 3BVFA 1NF6A 2WLUA 3WVVA 1J30A 3PWQA 3F35A 2CN7A 4ITTA 3F37A 3A9QA 2WLAA 4CVSA 3UNOA 4ZL6A 4TW3A 3KA6A 2RBDA 5GOUA 5LS9A 4CVPA 5K53A 2ZG9X 1LKPA 4EVCA 2V2SA 3ERZA 5ERJA 4MJYA 1BFRA 4Y08A 4RC7A 3Q4OA 5FFEA 3QB9A 5D8PA 1R03A 4ITWA 3E1PA 2CEIA 2XJOA 4ISMA 3RGDA 1TKPA 5D8YA 3BVIA 3PVRB 3IQ1A 1XZ1A 4TOHA 2V2IA 3PVYA 2YW7A 3BVKA 3FVBA 3SH6A 1RCDA 4II4A 2FKZA 3QHBA 4A25A 3KWOA 4LQHA 4AM5A 4E6KA 4AM2A 2VZBA 3PWQC 3ES3A 2HTNA 3O7SA 5J93A 1S30A 4IXKA 1XZ3A 1JTSA 4MKUA 4PGIA 2VXIA 1L8IA 2C41A 1YUZA 4RC8A 4DI0A 3PW8A 3NP2X 1H96A 4ZKXA 2V2OA 3E1OA 3T9JA 4ZLWA 2CIHA 5J9VA 3RE7A 3E1QA 3SE1A 5D8XA 4LPNA 1TJOA 3IS8A 3AK8A 1AEWA 4IWKA 1NNQA 1VLGA 2FG8A 1ZUJA 4MUDA
chains in the Genus database with same CATH superfamily
4LYXA 5HJFA 1QGHA 2Y3QA 3AK9A 4RC5A 1B71A 4ZTTA 1TKOA 5LG2A 3ISFA 5CZUA 1VELA 3RBCA 3PVTA 3F39A 2QF9A 3FSEA 2Z90A 3N6OA 4ZKHA 1BG7A 3R2RA 2HR5A 1JREA 3R2MA 5CMRA 1YV1A 4LYUA 5E2DA 4LQJA 4ML5A 5JDOA 2X170 5GU3X 2CLUA 2V15A 3PW1B 4REUA 2YJJA 2Z5RA 2OH3A 3E1JA 2IB0A 3H7GA 2AR0A 4KVRA 5I4JA 2G38B 2FG4A 3ISEA 5D8SA 2CLBA 2XKQA 1DVBA 1KRQA 1F33A 2Z5PA 4MY7A 4U3GA 2FZFA 4ZJKA 3F32A 2FL0A 3RD0A 2ZA6A 3F33A 4CY9A 3E6RA 3HL1A 5D8QA 3AF9X 4DYXA 1QYBA 4LQVA 1MFRA 5JKLG 3PVRA 2MGYA 2V8TA 4DZ0A 3L0MA 3AF8X 3R2LA 3QZ3A 3C1ZA 4MXPA 3WNWA 4CMYV 3FRRA 5JACA 4TODA 1S2ZA 3BKNA 5LBHA 3QVDA 1OTKA 3R2OA 3R2HA 5FEJA 3Q4RA 1JGCA 3GHQA 1JI4A 4CMYA 5GN8B 4TOEA 4M35A 3QHCA 1JI5A 2JD60 3VNXA 4M33A 3NP0X 1LB3A 4TOFA 4XGSA 5GU0X 1EUMA 1JKUA 2FJCA 1L8HA 2ZURX 4WJG4 1Z6OM 3E1MA 2C2JA 2ITBA 1GWGA 2QQYA 2VXXA 1SOFA 3E6SA 1DATA 2Z6MA 3GE4A 1RCCA 3FRSA 4CYAA 4P18A 1N1QA 1UMNA 3AJQA 2JD80 4M32A 3F34A 3UOIA 5CMQA 4KVSA 3AJPA 4ETRA 1NFVA 3QD8A 5HQOA 4XKUA 3PWFA 5FFDA 2Y44A 2YW6A 4LQNA 1O9RA 2CN6A 4PG1A 3KDQA 4IWJA 2CHIA 4PG0A 1RCEA 5JKMA 3WVWA 3PW1A 4CVRA 4YKHA 4RC6A 2V2LA 1SQ3A 3RAVA 1F30A 3TA8A 1VEQA 1ZS3A 4EVBA 1LKOA 3M6JA 2V2JA 4XKTA 4ISPA 4RC6B 2V2NA 2V8UA 1FHAA 2XGWA 3KA8A 1MOJA 2JD70 3Q4NA 4OYNA 1RCIA 2Z5QA 3PW8C 5J8WA 1IERA 4TOGA 5IX6A 2YJKA 1RCGA 3C23A 1VEIA 4DYZA 3GGZA 2FFXJ 2BW1A 5AXSA 5C6FA 3R2KA 4ZL5A 1YUXA 5FFCA 3AJOA 1JIGA 3Q4QA 4ZMCA 1LKMA 4W4KB 5D8RA 2C2FA 3GVYA 5K52A 2PYBA 3R2SA 2V2MA 3OGHA 4TO9A 4AM4A 4M34A 3WVUA 1UVHA 4QUWA 4ZKWA 3OJ5A 1Z4AA 4TOBA 2BJYA 5GN8A 3VV9A 2BKCA 3KXUA 1Z6OA 3PZAA 2C2UA 4YXMA 5JKMG 1IESA 2D5KA 2ZG7X 2WTLA 1HRSA 3FI6A 4RC7B 2GYQA 2ZG8X 3AF7X 2V2PA 2CWLA 1S3QA 2BK6A 3BVLA 3UOFA 2V2RA 3U90A 2XJNA 1JYBA 3A68A 3HIUA 5HJHA 3MPSA 3PVYB 4DYYA 4ERUA 2OC5A 3SIDA 4II4B 5D8OA 2ZA8A 5J8SA 4CYBA 3LKDA 4KVQA 3D19A 4Z3BA 2ZA7A 1TK6A 4Z5SA 2CF7A 2FHAA 4W4LB 3BVEA 5LG8A 1NF4A 4PGKA 2G4HA 4MN9A 2CHPA 1O9IA 3EGMA 3O7RA 5FFAA 4LPMA 2GYDA 2GS4A 4EVEA 1VJXA 4TOAA 3SHXA 5ERKA 4X0JA 5FFBA 1JKVA 5GU1X 2IY4A 5JKLA 3KA9A 1RYTA 3JZ9A 2C6RA 4XKSA 3EZUA 3NOZX 3UFBA 2W0OA 4LPJA 3EZ0A 4YVZA 3KA4A 3E1LA 4TOCA 4DYUA 4DE6A 4R42A 3IS7A 4RC5B 4CVTA 3E2CA 3BT5A 3F36A 3KX9A 4EVDA 3KA3A 3F38A 3PVTB 4DASA 3E1NA 3C21A 5E1UA 2IU2A 2F7NA 3V3KB 1DPSA 1BCFA 2XJMA 2UX1A 5GU2X 3BVFA 1NF6A 2WLUA 3VVAA 3WVVA 1J30A 3PWQA 3F35A 2CN7A 2WWXB 4ITTA 3W54A 3F37A 3A9QA 5JDOB 2WLAA 4CVSA 3UNOA 4ZL6A 4TW3A 3KA6A 2RBDA 5GOUA 5LS9A 4CVPA 5K53A 3KHKA 2N02A 2ZG9X 1LKPA 4EVCA 2V2SA 3ERZA 5ERJA 4MJYA 3GGYA 1BFRA 4Y08A 4RC7A 3Q4OA 5FFEA 3QB9A 4YXJA 5D8PA 1R03A 4ITWA 3E1PA 2CEIA 2XJOA 4ISMA 3RGDA 1TKPA 5D8YA 3BVIA 3PVRB 3IQ1A 1XZ1A 4TOHA 2V2IA 3PVYA 2YW7A 3BVKA 3FVBA 4E40A 3SH6A 1RCDA 4II4A 2FKZA 3QHBA 4A25A 3KWOA 4LQHA 4AM5A 4E6KA 4AM2A 2VZBA 3PWQC 3ES3A 3JZAB 2HTNA 3O7SA 5J93A 1S30A 4IXKA 1XZ3A 1JTSA 4MKUA 4PGIA 2VXIA 1L8IA 2C41A 1YUZA 3DBYA 4RC8A 4DI0A 3PW8A 3NP2X 1H96A 3C1YA 4ZKXA 2V2OA 3E1OA 5HU6D 3T9JA 4ZLWA 2CIHA 5J9VA 3RE7A 3E1QA 3SE1A 5D8XA 4LPNA 1TJOA 3IS8A 3AK8A 1AEWA 4IWKA 4KXRB 1NNQA 2OKCA 1VLGA 2FG8A 1ZUJA 4MUDA
chains in the Genus database with same CATH topology
4LYXA 5HJFA 1QGHA 2Y3QA 3AK9A 4RC5A 1B71A 4ZTTA 1TKOA 5LG2A 3ISFA 5CZUA 1VELA 3RBCA 3PVTA 3F39A 2QF9A 3FSEA 2Z90A 3N6OA 4ZKHA 1BG7A 3R2RA 2HR5A 1JREA 3R2MA 5CMRA 1YV1A 4LYUA 5E2DA 4LQJA 4ML5A 5JDOA 2X170 5GU3X 2CLUA 2V15A 3PW1B 4REUA 2YJJA 2Z5RA 2OH3A 3E1JA 2IB0A 3H7GA 2AR0A 4KVRA 5I4JA 2G38B 2FG4A 3ISEA 5D8SA 2CLBA 2XKQA 1DVBA 1KRQA 1F33A 2Z5PA 4MY7A 4U3GA 2FZFA 4ZJKA 3F32A 2FL0A 3RD0A 2ZA6A 3F33A 4CY9A 3E6RA 3HL1A 5D8QA 3AF9X 4DYXA 1QYBA 4LQVA 1MFRA 5JKLG 3PVRA 2MGYA 2V8TA 4DZ0A 3L0MA 3AF8X 3R2LA 3QZ3A 3C1ZA 4MXPA 3WNWA 4CMYV 3FRRA 5JACA 4TODA 1S2ZA 3BKNA 5LBHA 3QVDA 1OTKA 3R2OA 3R2HA 5FEJA 3Q4RA 1JGCA 3GHQA 1JI4A 4CMYA 5GN8B 4TOEA 4M35A 3QHCA 1JI5A 2JD60 3VNXA 4M33A 3NP0X 1LB3A 4TOFA 4XGSA 5GU0X 1EUMA 1JKUA 2FJCA 1L8HA 2ZURX 4WJG4 1Z6OM 3E1MA 2C2JA 2ITBA 1GWGA 2QQYA 2VXXA 1SOFA 3E6SA 1DATA 2Z6MA 3GE4A 1RCCA 3FRSA 4CYAA 4P18A 1N1QA 1UMNA 3AJQA 2JD80 4M32A 3F34A 3UOIA 5CMQA 4KVSA 3AJPA 4ETRA 1NFVA 3QD8A 5HQOA 4XKUA 3PWFA 5FFDA 2Y44A 2YW6A 4LQNA 1O9RA 2CN6A 4PG1A 3KDQA 4IWJA 2CHIA 4PG0A 1RCEA 5JKMA 3WVWA 3PW1A 4CVRA 4YKHA 4RC6A 2V2LA 1SQ3A 3RAVA 1F30A 3TA8A 1VEQA 1ZS3A 4EVBA 1LKOA 3M6JA 2V2JA 4XKTA 4ISPA 4RC6B 2V2NA 2V8UA 1FHAA 2XGWA 3KA8A 1MOJA 2JD70 3Q4NA 4OYNA 1RCIA 2Z5QA 3PW8C 5J8WA 1IERA 4TOGA 5IX6A 2YJKA 1RCGA 3C23A 1VEIA 4DYZA 3GGZA 2FFXJ 2BW1A 5AXSA 5C6FA 3R2KA 4ZL5A 1YUXA 5FFCA 3AJOA 1JIGA 3Q4QA 4ZMCA 1LKMA 4W4KB 5D8RA 2C2FA 3GVYA 5K52A 2PYBA 3R2SA 2V2MA 3OGHA 4TO9A 4AM4A 4M34A 3WVUA 1UVHA 4QUWA 4ZKWA 3OJ5A 1Z4AA 4TOBA 2BJYA 5GN8A 3VV9A 2BKCA 3KXUA 1Z6OA 3PZAA 2C2UA 4YXMA 5JKMG 1IESA 2D5KA 2ZG7X 2WTLA 1HRSA 3FI6A 4RC7B 2GYQA 2ZG8X 3AF7X 2V2PA 2CWLA 1S3QA 2BK6A 3BVLA 3UOFA 2V2RA 3U90A 2XJNA 1JYBA 3A68A 3HIUA 5HJHA 3MPSA 3PVYB 4DYYA 4ERUA 2OC5A 3SIDA 4II4B 5D8OA 2ZA8A 5J8SA 4CYBA 3LKDA 4KVQA 3D19A 4Z3BA 2ZA7A 1TK6A 4Z5SA 2CF7A 2FHAA 4W4LB 3BVEA 5LG8A 1NF4A 4PGKA 2G4HA 4MN9A 2CHPA 1O9IA 3EGMA 3O7RA 5FFAA 4LPMA 2GYDA 2GS4A 4EVEA 1VJXA 4TOAA 3SHXA 5ERKA 4X0JA 5FFBA 1JKVA 5GU1X 2IY4A 5JKLA 3KA9A 1RYTA 3JZ9A 2C6RA 4XKSA 3EZUA 3NOZX 3UFBA 2W0OA 4LPJA 3EZ0A 4YVZA 3KA4A 3E1LA 4TOCA 4DYUA 4DE6A 4R42A 3IS7A 4RC5B 4CVTA 3E2CA 3BT5A 3F36A 3KX9A 4EVDA 3KA3A 3F38A 3PVTB 4DASA 3E1NA 3C21A 5E1UA 2IU2A 2F7NA 3V3KB 1DPSA 1BCFA 2XJMA 2UX1A 5GU2X 3BVFA 1NF6A 2WLUA 3VVAA 3WVVA 1J30A 3PWQA 3F35A 2CN7A 2WWXB 4ITTA 3W54A 3F37A 3A9QA 5JDOB 2WLAA 4CVSA 3UNOA 4ZL6A 4TW3A 3KA6A 2RBDA 5GOUA 5LS9A 4CVPA 5K53A 3KHKA 2N02A 2ZG9X 1LKPA 4EVCA 2V2SA 3ERZA 5ERJA 4MJYA 3GGYA 1BFRA 4Y08A 4RC7A 3Q4OA 5FFEA 3QB9A 4YXJA 5D8PA 1R03A 4ITWA 3E1PA 2CEIA 2XJOA 4ISMA 3RGDA 1TKPA 5D8YA 3BVIA 3PVRB 3IQ1A 1XZ1A 4TOHA 2V2IA 3PVYA 2YW7A 3BVKA 3FVBA 4E40A 3SH6A 1RCDA 4II4A 2FKZA 3QHBA 4A25A 3KWOA 4LQHA 4AM5A 4E6KA 4AM2A 2VZBA 3PWQC 3ES3A 3JZAB 2HTNA 3O7SA 5J93A 1S30A 4IXKA 1XZ3A 1JTSA 4MKUA 4PGIA 2VXIA 1L8IA 2C41A 1YUZA 3DBYA 4RC8A 4DI0A 3PW8A 3NP2X 1H96A 3C1YA 4ZKXA 2V2OA 3E1OA 5HU6D 3T9JA 4ZLWA 2CIHA 5J9VA 3RE7A 3E1QA 3SE1A 5D8XA 4LPNA 1TJOA 3IS8A 3AK8A 1AEWA 4IWKA 4KXRB 1NNQA 2OKCA 1VLGA 2FG8A 1ZUJA 4MUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LYX A;  5HJF A;  1QGH A;  2Y3Q A;  3AK9 A;  4RC5 A;  1B71 A;  4ZTT A;  1TKO A;  5LG2 A;  3ISF A;  5CZU A;  1VEL A;  3RBC A;  3PVT A;  3F39 A;  2QF9 A;  3FSE A;  2Z90 A;  4ZKH A;  1BG7 A;  3R2R A;  2HR5 A;  1JRE A;  3R2M A;  5CMR A;  1YV1 A;  4LYU A;  5E2D A;  4LQJ A;  4ML5 A;  2X17 0;  5GU3 X;  2CLU A;  2V15 A;  3PW1 B;  4REU A;  2YJJ A;  2Z5R A;  2OH3 A;  3E1J A;  2IB0 A;  3H7G A;  4KVR A;  5I4J A;  2FG4 A;  3ISE A;  5D8S A;  2CLB A;  2XKQ A;  1DVB A;  1KRQ A;  1F33 A;  2Z5P A;  4MY7 A;  4U3G A;  2FZF A;  4ZJK A;  3F32 A;  2FL0 A;  3RD0 A;  2ZA6 A;  3F33 A;  4CY9 A;  3E6R A;  3HL1 A;  5D8Q A;  3AF9 X;  4DYX A;  1QYB A;  4LQV A;  1MFR A;  5JKL G;  3PVR A;  4DZ0 A;  3AF8 X;  3R2L A;  3QZ3 A;  3WNW A;  4CMY V;  5JAC A;  4TOD A;  1S2Z A;  3BKN A;  5LBH A;  3QVD A;  1OTK A;  3R2O A;  3R2H A;  5FEJ A;  3Q4R A;  1JGC A;  3GHQ A;  1JI4 A;  4CMY A;  5GN8 B;  4TOE A;  4M35 A;  3QHC A;  1JI5 A;  2JD6 0;  3VNX A;  4M33 A;  3NP0 X;  1LB3 A;  4TOF A;  4XGS A;  5GU0 X;  1EUM A;  1JKU A;  2FJC A;  1L8H A;  2ZUR X;  1Z6O M;  3E1M A;  2C2J A;  2ITB A;  1GWG A;  2QQY A;  2VXX A;  1SOF A;  3E6S A;  1DAT A;  2Z6M A;  3GE4 A;  1RCC A;  4CYA A;  4P18 A;  1N1Q A;  1UMN A;  3AJQ A;  2JD8 0;  4M32 A;  3F34 A;  3UOI A;  5CMQ A;  4KVS A;  3AJP A;  4ETR A;  1NFV A;  3QD8 A;  5HQO A;  4XKU A;  3PWF A;  5FFD A;  2YW6 A;  4LQN A;  1O9R A;  2CN6 A;  4PG1 A;  4IWJ A;  2CHI A;  4PG0 A;  1RCE A;  5JKM A;  3WVW A;  3PW1 A;  4CVR A;  4YKH A;  4RC6 A;  2V2L A;  1SQ3 A;  3RAV A;  1F30 A;  3TA8 A;  1VEQ A;  1ZS3 A;  4EVB A;  1LKO A;  2V2J A;  4XKT A;  4ISP A;  4RC6 B;  2V2N A;  2XGW A;  1FHA A;  3KA8 A;  1MOJ A;  2JD7 0;  3Q4N A;  4OYN A;  1RCI A;  2Z5Q A;  3PW8 C;  5J8W A;  1IER A;  4TOG A;  5IX6 A;  2YJK A;  1RCG A;  1VEI A;  4DYZ A;  2FFX J;  2BW1 A;  5AXS A;  5C6F A;  3R2K A;  4ZL5 A;  1YUX A;  5FFC A;  3AJO A;  1JIG A;  3Q4Q A;  4ZMC A;  1LKM A;  5D8R A;  2C2F A;  3GVY A;  5K52 A;  2PYB A;  3R2S A;  2V2M A;  3OGH A;  4TO9 A;  4AM4 A;  4M34 A;  3WVU A;  1UVH A;  4QUW A;  4ZKW A;  3OJ5 A;  1Z4A A;  4TOB A;  2BJY A;  5GN8 A;  2BKC A;  3KXU A;  1Z6O A;  3PZA A;  2C2U A;  5JKM G;  1IES A;  2D5K A;  2ZG7 X;  2WTL A;  1HRS A;  3FI6 A;  4RC7 B;  2GYQ A;  2ZG8 X;  3AF7 X;  2V2P A;  1S3Q A;  2BK6 A;  3BVL A;  3UOF A;  2V2R A;  3U90 A;  2XJN A;  1JYB A;  3A68 A;  3HIU A;  5HJH A;  3MPS A;  3PVY B;  4DYY A;  4ERU A;  2OC5 A;  3SID A;  4II4 B;  5D8O A;  2ZA8 A;  5J8S A;  4CYB A;  4KVQ A;  4Z3B A;  2ZA7 A;  1TK6 A;  4Z5S A;  2CF7 A;  2FHA A;  3BVE A;  5LG8 A;  1NF4 A;  4PGK A;  2G4H A;  4MN9 A;  2CHP A;  1O9I A;  3EGM A;  3O7R A;  5FFA A;  4LPM A;  2GYD A;  2GS4 A;  4EVE A;  1VJX A;  4TOA A;  3SHX A;  5ERK A;  5FFB A;  1JKV A;  5GU1 X;  2IY4 A;  5JKL A;  3KA9 A;  1RYT A;  2C6R A;  4XKS A;  3EZU A;  3NOZ X;  2W0O A;  4LPJ A;  3EZ0 A;  3KA4 A;  3E1L A;  4TOC A;  4DYU A;  4DE6 A;  4R42 A;  3IS7 A;  4RC5 B;  4CVT A;  3E2C A;  3BT5 A;  3F36 A;  3KX9 A;  4EVD A;  3KA3 A;  3F38 A;  3PVT B;  4DAS A;  3E1N A;  5E1U A;  2IU2 A;  2F7N A;  1DPS A;  1BCF A;  2XJM A;  2UX1 A;  5GU2 X;  3BVF A;  1NF6 A;  2WLU A;  3WVV A;  1J30 A;  3PWQ A;  3F35 A;  2CN7 A;  4ITT A;  3F37 A;  3A9Q A;  2WLA A;  4CVS A;  3UNO A;  4ZL6 A;  4TW3 A;  3KA6 A;  2RBD A;  5GOU A;  5LS9 A;  4CVP A;  5K53 A;  2ZG9 X;  1LKP A;  4EVC A;  2V2S A;  3ERZ A;  5ERJ A;  4MJY A;  1BFR A;  4Y08 A;  4RC7 A;  3Q4O A;  5FFE A;  3QB9 A;  5D8P A;  1R03 A;  4ITW A;  3E1P A;  2CEI A;  2XJO A;  4ISM A;  3RGD A;  1TKP A;  5D8Y A;  3BVI A;  3PVR B;  3IQ1 A;  1XZ1 A;  4TOH A;  2V2I A;  3PVY A;  2YW7 A;  3BVK A;  3FVB A;  3SH6 A;  1RCD A;  4II4 A;  2FKZ A;  3QHB A;  4A25 A;  3KWO A;  4LQH A;  4AM5 A;  4E6K A;  4AM2 A;  2VZB A;  3PWQ C;  3ES3 A;  2HTN A;  3O7S A;  5J93 A;  1S30 A;  4IXK A;  1XZ3 A;  1JTS A;  4MKU A;  4PGI A;  2VXI A;  1L8I A;  2C41 A;  1YUZ A;  4RC8 A;  4DI0 A;  3PW8 A;  3NP2 X;  1H96 A;  4ZKX A;  2V2O A;  3E1O A;  3T9J A;  4ZLW A;  2CIH A;  5J9V A;  3RE7 A;  3E1Q A;  3SE1 A;  5D8X A;  4LPN A;  1TJO A;  3IS8 A;  3AK8 A;  1AEW A;  4IWK A;  1NNQ A;  1VLG A;  2FG8 A;  1ZUJ A;  4MUD A; 
#chains in the Genus database with same CATH topology
 4LYX A;  5HJF A;  1QGH A;  2Y3Q A;  3AK9 A;  4RC5 A;  1B71 A;  4ZTT A;  1TKO A;  5LG2 A;  3ISF A;  5CZU A;  1VEL A;  3RBC A;  3PVT A;  3F39 A;  2QF9 A;  3FSE A;  2Z90 A;  3N6O A;  4ZKH A;  1BG7 A;  3R2R A;  2HR5 A;  1JRE A;  3R2M A;  5CMR A;  1YV1 A;  4LYU A;  5E2D A;  4LQJ A;  4ML5 A;  5JDO A;  2X17 0;  5GU3 X;  2CLU A;  2V15 A;  3PW1 B;  4REU A;  2YJJ A;  2Z5R A;  2OH3 A;  3E1J A;  2IB0 A;  3H7G A;  2AR0 A;  4KVR A;  5I4J A;  2G38 B;  2FG4 A;  3ISE A;  5D8S A;  2CLB A;  2XKQ A;  1DVB A;  1KRQ A;  1F33 A;  2Z5P A;  4MY7 A;  4U3G A;  2FZF A;  4ZJK A;  3F32 A;  2FL0 A;  3RD0 A;  2ZA6 A;  3F33 A;  4CY9 A;  3E6R A;  3HL1 A;  5D8Q A;  3AF9 X;  4DYX A;  1QYB A;  4LQV A;  1MFR A;  5JKL G;  3PVR A;  2MGY A;  2V8T A;  4DZ0 A;  3L0M A;  3AF8 X;  3R2L A;  3QZ3 A;  3C1Z A;  4MXP A;  3WNW A;  4CMY V;  3FRR A;  5JAC A;  4TOD A;  1S2Z A;  3BKN A;  5LBH A;  3QVD A;  1OTK A;  3R2O A;  3R2H A;  5FEJ A;  3Q4R A;  1JGC A;  3GHQ A;  1JI4 A;  4CMY A;  5GN8 B;  4TOE A;  4M35 A;  3QHC A;  1JI5 A;  2JD6 0;  3VNX A;  4M33 A;  3NP0 X;  1LB3 A;  4TOF A;  4XGS A;  5GU0 X;  1EUM A;  1JKU A;  2FJC A;  1L8H A;  2ZUR X;  4WJG 4;  1Z6O M;  3E1M A;  2C2J A;  2ITB A;  1GWG A;  2QQY A;  2VXX A;  1SOF A;  3E6S A;  1DAT A;  2Z6M A;  3GE4 A;  1RCC A;  3FRS A;  4CYA A;  4P18 A;  1N1Q A;  1UMN A;  3AJQ A;  2JD8 0;  4M32 A;  3F34 A;  3UOI A;  5CMQ A;  4KVS A;  3AJP A;  4ETR A;  1NFV A;  3QD8 A;  5HQO A;  4XKU A;  3PWF A;  5FFD A;  2Y44 A;  2YW6 A;  4LQN A;  1O9R A;  2CN6 A;  4PG1 A;  3KDQ A;  4IWJ A;  2CHI A;  4PG0 A;  1RCE A;  5JKM A;  3WVW A;  3PW1 A;  4CVR A;  4YKH A;  4RC6 A;  2V2L A;  1SQ3 A;  3RAV A;  1F30 A;  3TA8 A;  1VEQ A;  1ZS3 A;  4EVB A;  1LKO A;  3M6J A;  2V2J A;  4XKT A;  4ISP A;  4RC6 B;  2V2N A;  2V8U A;  1FHA A;  2XGW A;  3KA8 A;  1MOJ A;  2JD7 0;  3Q4N A;  4OYN A;  1RCI A;  2Z5Q A;  3PW8 C;  5J8W A;  1IER A;  4TOG A;  5IX6 A;  2YJK A;  1RCG A;  3C23 A;  1VEI A;  4DYZ A;  3GGZ A;  2FFX J;  2BW1 A;  5AXS A;  5C6F A;  3R2K A;  4ZL5 A;  1YUX A;  5FFC A;  3AJO A;  1JIG A;  3Q4Q A;  4ZMC A;  1LKM A;  4W4K B;  5D8R A;  2C2F A;  3GVY A;  5K52 A;  2PYB A;  3R2S A;  2V2M A;  3OGH A;  4TO9 A;  4AM4 A;  4M34 A;  3WVU A;  1UVH A;  4QUW A;  4ZKW A;  3OJ5 A;  1Z4A A;  4TOB A;  2BJY A;  5GN8 A;  3VV9 A;  2BKC A;  3KXU A;  1Z6O A;  3PZA A;  2C2U A;  4YXM A;  5JKM G;  1IES A;  2D5K A;  2ZG7 X;  2WTL A;  1HRS A;  3FI6 A;  4RC7 B;  2GYQ A;  2ZG8 X;  3AF7 X;  2V2P A;  2CWL A;  1S3Q A;  2BK6 A;  3BVL A;  3UOF A;  2V2R A;  3U90 A;  2XJN A;  1JYB A;  3A68 A;  3HIU A;  5HJH A;  3MPS A;  3PVY B;  4DYY A;  4ERU A;  2OC5 A;  3SID A;  4II4 B;  5D8O A;  2ZA8 A;  5J8S A;  4CYB A;  3LKD A;  4KVQ A;  3D19 A;  4Z3B A;  2ZA7 A;  1TK6 A;  4Z5S A;  2CF7 A;  2FHA A;  4W4L B;  3BVE A;  5LG8 A;  1NF4 A;  4PGK A;  2G4H A;  4MN9 A;  2CHP A;  1O9I A;  3EGM A;  3O7R A;  5FFA A;  4LPM A;  2GYD A;  2GS4 A;  4EVE A;  1VJX A;  4TOA A;  3SHX A;  5ERK A;  4X0J A;  5FFB A;  1JKV A;  5GU1 X;  2IY4 A;  5JKL A;  3KA9 A;  1RYT A;  3JZ9 A;  2C6R A;  4XKS A;  3EZU A;  3NOZ X;  3UFB A;  2W0O A;  4LPJ A;  3EZ0 A;  4YVZ A;  3KA4 A;  3E1L A;  4TOC A;  4DYU A;  4DE6 A;  4R42 A;  3IS7 A;  4RC5 B;  4CVT A;  3E2C A;  3BT5 A;  3F36 A;  3KX9 A;  4EVD A;  3KA3 A;  3F38 A;  3PVT B;  4DAS A;  3E1N A;  3C21 A;  5E1U A;  2IU2 A;  2F7N A;  3V3K B;  1DPS A;  1BCF A;  2XJM A;  2UX1 A;  5GU2 X;  3BVF A;  1NF6 A;  2WLU A;  3VVA A;  3WVV A;  1J30 A;  3PWQ A;  3F35 A;  2CN7 A;  2WWX B;  4ITT A;  3W54 A;  3F37 A;  3A9Q A;  5JDO B;  2WLA A;  4CVS A;  3UNO A;  4ZL6 A;  4TW3 A;  3KA6 A;  2RBD A;  5GOU A;  5LS9 A;  4CVP A;  5K53 A;  3KHK A;  2N02 A;  2ZG9 X;  1LKP A;  4EVC A;  2V2S A;  3ERZ A;  5ERJ A;  4MJY A;  3GGY A;  1BFR A;  4Y08 A;  4RC7 A;  3Q4O A;  5FFE A;  3QB9 A;  4YXJ A;  5D8P A;  1R03 A;  4ITW A;  3E1P A;  2CEI A;  2XJO A;  4ISM A;  3RGD A;  1TKP A;  5D8Y A;  3BVI A;  3PVR B;  3IQ1 A;  1XZ1 A;  4TOH A;  2V2I A;  3PVY A;  2YW7 A;  3BVK A;  3FVB A;  4E40 A;  3SH6 A;  1RCD A;  4II4 A;  2FKZ A;  3QHB A;  4A25 A;  3KWO A;  4LQH A;  4AM5 A;  4E6K A;  4AM2 A;  2VZB A;  3PWQ C;  3ES3 A;  3JZA B;  2HTN A;  3O7S A;  5J93 A;  1S30 A;  4IXK A;  1XZ3 A;  1JTS A;  4MKU A;  4PGI A;  2VXI A;  1L8I A;  2C41 A;  1YUZ A;  3DBY A;  4RC8 A;  4DI0 A;  3PW8 A;  3NP2 X;  1H96 A;  3C1Y A;  4ZKX A;  2V2O A;  3E1O A;  5HU6 D;  3T9J A;  4ZLW A;  2CIH A;  5J9V A;  3RE7 A;  3E1Q A;  3SE1 A;  5D8X A;  4LPN A;  1TJO A;  3IS8 A;  3AK8 A;  1AEW A;  4IWK A;  4KXR B;  1NNQ A;  2OKC A;  1VLG A;  2FG8 A;  1ZUJ A;  4MUD A; 
#chains in the Genus database with same CATH homology
 4LYX A;  5HJF A;  1QGH A;  2Y3Q A;  3AK9 A;  4RC5 A;  1B71 A;  4ZTT A;  1TKO A;  5LG2 A;  3ISF A;  5CZU A;  1VEL A;  3RBC A;  3PVT A;  3F39 A;  2QF9 A;  3FSE A;  2Z90 A;  3N6O A;  4ZKH A;  1BG7 A;  3R2R A;  2HR5 A;  1JRE A;  3R2M A;  5CMR A;  1YV1 A;  4LYU A;  5E2D A;  4LQJ A;  4ML5 A;  5JDO A;  2X17 0;  5GU3 X;  2CLU A;  2V15 A;  3PW1 B;  4REU A;  2YJJ A;  2Z5R A;  2OH3 A;  3E1J A;  2IB0 A;  3H7G A;  2AR0 A;  4KVR A;  5I4J A;  2G38 B;  2FG4 A;  3ISE A;  5D8S A;  2CLB A;  2XKQ A;  1DVB A;  1KRQ A;  1F33 A;  2Z5P A;  4MY7 A;  4U3G A;  2FZF A;  4ZJK A;  3F32 A;  2FL0 A;  3RD0 A;  2ZA6 A;  3F33 A;  4CY9 A;  3E6R A;  3HL1 A;  5D8Q A;  3AF9 X;  4DYX A;  1QYB A;  4LQV A;  1MFR A;  5JKL G;  3PVR A;  2MGY A;  2V8T A;  4DZ0 A;  3L0M A;  3AF8 X;  3R2L A;  3QZ3 A;  3C1Z A;  4MXP A;  3WNW A;  4CMY V;  3FRR A;  5JAC A;  4TOD A;  1S2Z A;  3BKN A;  5LBH A;  3QVD A;  1OTK A;  3R2O A;  3R2H A;  5FEJ A;  3Q4R A;  1JGC A;  3GHQ A;  1JI4 A;  4CMY A;  5GN8 B;  4TOE A;  4M35 A;  3QHC A;  1JI5 A;  2JD6 0;  3VNX A;  4M33 A;  3NP0 X;  1LB3 A;  4TOF A;  4XGS A;  5GU0 X;  1EUM A;  1JKU A;  2FJC A;  1L8H A;  2ZUR X;  4WJG 4;  1Z6O M;  3E1M A;  2C2J A;  2ITB A;  1GWG A;  2QQY A;  2VXX A;  1SOF A;  3E6S A;  1DAT A;  2Z6M A;  3GE4 A;  1RCC A;  3FRS A;  4CYA A;  4P18 A;  1N1Q A;  1UMN A;  3AJQ A;  2JD8 0;  4M32 A;  3F34 A;  3UOI A;  5CMQ A;  4KVS A;  3AJP A;  4ETR A;  1NFV A;  3QD8 A;  5HQO A;  4XKU A;  3PWF A;  5FFD A;  2Y44 A;  2YW6 A;  4LQN A;  1O9R A;  2CN6 A;  4PG1 A;  3KDQ A;  4IWJ A;  2CHI A;  4PG0 A;  1RCE A;  5JKM A;  3WVW A;  3PW1 A;  4CVR A;  4YKH A;  4RC6 A;  2V2L A;  1SQ3 A;  3RAV A;  1F30 A;  3TA8 A;  1VEQ A;  1ZS3 A;  4EVB A;  1LKO A;  3M6J A;  2V2J A;  4XKT A;  4ISP A;  4RC6 B;  2V2N A;  2V8U A;  1FHA A;  2XGW A;  3KA8 A;  1MOJ A;  2JD7 0;  3Q4N A;  4OYN A;  1RCI A;  2Z5Q A;  3PW8 C;  5J8W A;  1IER A;  4TOG A;  5IX6 A;  2YJK A;  1RCG A;  3C23 A;  1VEI A;  4DYZ A;  3GGZ A;  2FFX J;  2BW1 A;  5AXS A;  5C6F A;  3R2K A;  4ZL5 A;  1YUX A;  5FFC A;  3AJO A;  1JIG A;  3Q4Q A;  4ZMC A;  1LKM A;  4W4K B;  5D8R A;  2C2F A;  3GVY A;  5K52 A;  2PYB A;  3R2S A;  2V2M A;  3OGH A;  4TO9 A;  4AM4 A;  4M34 A;  3WVU A;  1UVH A;  4QUW A;  4ZKW A;  3OJ5 A;  1Z4A A;  4TOB A;  2BJY A;  5GN8 A;  3VV9 A;  2BKC A;  3KXU A;  1Z6O A;  3PZA A;  2C2U A;  4YXM A;  5JKM G;  1IES A;  2D5K A;  2ZG7 X;  2WTL A;  1HRS A;  3FI6 A;  4RC7 B;  2GYQ A;  2ZG8 X;  3AF7 X;  2V2P A;  2CWL A;  1S3Q A;  2BK6 A;  3BVL A;  3UOF A;  2V2R A;  3U90 A;  2XJN A;  1JYB A;  3A68 A;  3HIU A;  5HJH A;  3MPS A;  3PVY B;  4DYY A;  4ERU A;  2OC5 A;  3SID A;  4II4 B;  5D8O A;  2ZA8 A;  5J8S A;  4CYB A;  3LKD A;  4KVQ A;  3D19 A;  4Z3B A;  2ZA7 A;  1TK6 A;  4Z5S A;  2CF7 A;  2FHA A;  4W4L B;  3BVE A;  5LG8 A;  1NF4 A;  4PGK A;  2G4H A;  4MN9 A;  2CHP A;  1O9I A;  3EGM A;  3O7R A;  5FFA A;  4LPM A;  2GYD A;  2GS4 A;  4EVE A;  1VJX A;  4TOA A;  3SHX A;  5ERK A;  4X0J A;  5FFB A;  1JKV A;  5GU1 X;  2IY4 A;  5JKL A;  3KA9 A;  1RYT A;  3JZ9 A;  2C6R A;  4XKS A;  3EZU A;  3NOZ X;  3UFB A;  2W0O A;  4LPJ A;  3EZ0 A;  4YVZ A;  3KA4 A;  3E1L A;  4TOC A;  4DYU A;  4DE6 A;  4R42 A;  3IS7 A;  4RC5 B;  4CVT A;  3E2C A;  3BT5 A;  3F36 A;  3KX9 A;  4EVD A;  3KA3 A;  3F38 A;  3PVT B;  4DAS A;  3E1N A;  3C21 A;  5E1U A;  2IU2 A;  2F7N A;  3V3K B;  1DPS A;  1BCF A;  2XJM A;  2UX1 A;  5GU2 X;  3BVF A;  1NF6 A;  2WLU A;  3VVA A;  3WVV A;  1J30 A;  3PWQ A;  3F35 A;  2CN7 A;  2WWX B;  4ITT A;  3W54 A;  3F37 A;  3A9Q A;  5JDO B;  2WLA A;  4CVS A;  3UNO A;  4ZL6 A;  4TW3 A;  3KA6 A;  2RBD A;  5GOU A;  5LS9 A;  4CVP A;  5K53 A;  3KHK A;  2N02 A;  2ZG9 X;  1LKP A;  4EVC A;  2V2S A;  3ERZ A;  5ERJ A;  4MJY A;  3GGY A;  1BFR A;  4Y08 A;  4RC7 A;  3Q4O A;  5FFE A;  3QB9 A;  4YXJ A;  5D8P A;  1R03 A;  4ITW A;  3E1P A;  2CEI A;  2XJO A;  4ISM A;  3RGD A;  1TKP A;  5D8Y A;  3BVI A;  3PVR B;  3IQ1 A;  1XZ1 A;  4TOH A;  2V2I A;  3PVY A;  2YW7 A;  3BVK A;  3FVB A;  4E40 A;  3SH6 A;  1RCD A;  4II4 A;  2FKZ A;  3QHB A;  4A25 A;  3KWO A;  4LQH A;  4AM5 A;  4E6K A;  4AM2 A;  2VZB A;  3PWQ C;  3ES3 A;  3JZA B;  2HTN A;  3O7S A;  5J93 A;  1S30 A;  4IXK A;  1XZ3 A;  1JTS A;  4MKU A;  4PGI A;  2VXI A;  1L8I A;  2C41 A;  1YUZ A;  3DBY A;  4RC8 A;  4DI0 A;  3PW8 A;  3NP2 X;  1H96 A;  3C1Y A;  4ZKX A;  2V2O A;  3E1O A;  5HU6 D;  3T9J A;  4ZLW A;  2CIH A;  5J9V A;  3RE7 A;  3E1Q A;  3SE1 A;  5D8X A;  4LPN A;  1TJO A;  3IS8 A;  3AK8 A;  1AEW A;  4IWK A;  4KXR B;  1NNQ A;  2OKC A;  1VLG A;  2FG8 A;  1ZUJ A;  4MUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...