3E1OA

Crystal structure of e. coli bacterioferritin (bfr) with two zn(ii) ion sites at the ferroxidase centre (zn-bfr).
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
156
structure length
156
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords BACTERIOFERRITIN
publication title Structural basis for iron mineralization by bacterioferritin
pubmed doi rcsb
source organism Escherichia coli
total genus 71
structure length 156
sequence length 156
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3e1oA00
4CMYA 4PGIA 2WLUA 2Z6MA 2GYDA 1VLGA 2CEIA 3E6SA 2UX1A 5JKMA 2FFXJ 5K52A 5ERKA 2Z5RA 3ISEA 3OGHA 2Z5QA 2CHPA 2CIHA 3F35A 1TK6A 3F39A 1YUZA 4MUDA 1H96A 1L8HA 3PW1A 1JI5A 4ZL5A 2ZA7A 4DYZA 3PW8A 4PGKA 3SE1A 1S3QA 4KVRA 3A9QA 3PVYA 1ZUJA 1IESA 4Y08A 3Q4NA 3QZ3A 3R2LA 3MPSA 1N1QA 2C2FA 2JD70 1SOFA 3GE4A 1SQ3A 3RD0A 5FEJA 4LQHA 4CVTA 4M33A 4R42A 4XKTA 5E1UA 4II4B 1RCDA 3A68A 5D8YA 2JD60 4ZKXA 3RBCA 1NFVA 3E1NA 2IY4A 3KA4A 5FFAA 1DVBA 1FHAA 5J8SA 4CVSA 3SIDA 3F33A 1JGCA 1YUXA 2V2NA 4ITWA 2V2IA 3R2KA 1VJXA 2W0OA 3AF8X 2IU2A 1JREA 2CF7A 4OYNA 2YW7A 3BVKA 3R2OA 3AK9A 4XGSA 3BVLA 4LYUA 5GU2X 3ES3A 5AXSA 1BFRA 5CZUA 3BVFA 1DATA 4ZMCA 4EVDA 2C2UA 2FG8A 2ZA6A 5FFCA 1DPSA 2BW1A 4II4A 4XKSA 4TOAA 3ERZA 3SHXA 3PZAA 3AF7X 1NNQA 3F38A 2VXXA 3QHCA 2FZFA 3WNWA 1XZ3A 5FFDA 2CN6A 3Q4OA 4LQVA 3U90A 4ISMA 4CMYV 3E6RA 4DI0A 1YV1A 2ZG9X 3H7GA 5JKLG 4EVEA 4TODA 2V2PA 3E2CA 4REUA 2XJOA 4KVQA 3PW8C 3SH6A 2IB0A 2FJCA 5CMQA 1MOJA 3NP0X 3T9JA 3WVUA 3HIUA 4MKUA 5HJHA 3O7RA 3GHQA 5JACA 1S30A 4LQNA 4YKHA 5D8SA 1J30A 3PWFA 2ZG7X 4M32A 3QD8A 4LPMA 1VEIA 2GS4A 3AJQA 3R2HA 1S2ZA 4ZKHA 2ZG8X 4TOCA 5GN8B 4CVRA 5CMRA 3KA9A 1TKOA 1VELA 5GU0X 1RCEA 4MY7A 2CLUA 1EUMA 1NF4A 3QHBA 1O9IA 3F34A 5D8PA 2CHIA 2PYBA 2XJMA 1JYBA 1Z6OM 3Q4RA 3KXUA 4RC7B 4ITTA 3UOFA 3QB9A 1HRSA 1JIGA 3E1LA 5LS9A 3IS8A 1LB3A 3AF9X 4A25A 1UMNA 2V2LA 3FSEA 4TOFA 3UOIA 4AM5A 2WTLA 4EVBA 4TOGA 3E1PA 3R2RA 4ZLWA 5FFBA 1Z4AA 4E6KA 5GN8A 1AEWA 1O9RA 2BJYA 5HJFA 1LKPA 2WLAA 4IWKA 2Z5PA 2Z90A 2X170 5D8QA 4LPJA 2HTNA 1RCIA 5J93A 3F36A 2HR5A 4RC6A 4DE6A 4PG0A 2FHAA 3PVRB 2QQYA 3PVTB 1TKPA 4RC7A 2YW6A 1R03A 3RE7A 2V2MA 3PWQA 3R2MA 4CVPA 4M35A 3RAVA 2OH3A 4P18A 1ZS3A 3KX9A 2V2JA 4MJYA 3EZUA 2F7NA 3BVEA 4TO9A 5I4JA 1VEQA 1UVHA 1QYBA 4AM4A 2FG4A 4TW3A 4TOHA 3AK8A 3E1MA 4ZL6A 3OJ5A 4ML5A 3FVBA 3HL1A 3FI6A 3E1OA 2JD80 1LKOA 1F33A 3NOZX 4EVCA 3PVRA 3BVIA 3PVTA 5GU3X 2XGWA 2BK6A 3Q4QA 5D8RA 3EZ0A 5D8OA 4ZJKA 3KWOA 5HQOA 1JKVA 3F32A 4ISPA 4DYUA 4U3GA 2YJKA 4Z3BA 5K53A 3RGDA 4ZKWA 1JI4A 4KVSA 3BKNA 3IQ1A 1KRQA 3NP2X 2CLBA 1GWGA 3AJOA 1TJOA 2YJJA 4RC5B 4RC6B 4DZ0A 1BCFA 2ZURX 3KA3A 4ETRA 1NF6A 4TOEA 1B71A 2C41A 5GOUA 4LYXA 5JKMG 5FFEA 1RCCA 1QGHA 3TA8A 1LKMA 3EGMA 5E2DA 5J9VA 2ZA8A 3PWQC 4M34A 4CYAA 4XKUA 4QUWA 3QVDA 1F30A 2CN7A 1JTSA 1RCGA 4IWJA 5JKLA 2V2RA 4RC5A 3AJPA 4LQJA 3GVYA 2V2OA 4MN9A 2V15A 2RBDA 2G4HA 4CYBA 2FKZA 4IXKA 4DASA 2V2SA 2XJNA 1Z6OA 2OC5A 5J8WA 3E1QA 4RC8A 5IX6A 3O7SA 1OTKA 1BG7A 2GYQA 4Z5SA 5ERJA 4ERUA 2BKCA 5D8XA 3KA8A 2FL0A 3WVVA 1XZ1A 4PG1A 2C6RA 4TOBA 2Y3QA 4AM2A 3UNOA 5GU1X 4DYYA 2QF9A 4DYXA 2XKQA 3VNXA 1JKUA 3PW1B 1MFRA 3R2SA 4ZTTA 3IS7A 2D5KA 1IERA 3PVYB 5LG8A 3BT5A 2C2JA 3E1JA 3F37A 4LPNA 1L8IA 3ISFA 1RYTA 2ITBA 4CY9A 5LBHA 5C6FA 3WVWA 5LG2A 2VXIA 3KA6A 2VZBA
chains in the Genus database with same CATH superfamily
4CMYA 4PGIA 2WLUA 2V8UA 2Z6MA 2GYDA 1VLGA 2CEIA 3E6SA 2UX1A 5JKMA 2FFXJ 5K52A 5ERKA 2Z5RA 3ISEA 3OGHA 2Z5QA 2CHPA 2CIHA 3F35A 3JZAB 1TK6A 3F39A 1YUZA 4MUDA 1H96A 1L8HA 3PW1A 4X0JA 1JI5A 4ZL5A 2ZA7A 4DYZA 3PW8A 4PGKA 3SE1A 1S3QA 4KVRA 3A9QA 3PVYA 1ZUJA 1IESA 4Y08A 3Q4NA 3QZ3A 3R2LA 3MPSA 1N1QA 2C2FA 2JD70 1SOFA 3GE4A 1SQ3A 3RD0A 5FEJA 4LQHA 4CVTA 4M33A 4R42A 4XKTA 3JZ9A 5E1UA 4II4B 1RCDA 3A68A 5D8YA 2JD60 3FRSA 4ZKXA 3RBCA 1NFVA 3E1NA 2IY4A 3KA4A 5FFAA 1DVBA 1FHAA 5J8SA 4CVSA 3SIDA 3F33A 1JGCA 1YUXA 2V2NA 4ITWA 2V2IA 3R2KA 4YVZA 1VJXA 2W0OA 3AF8X 2IU2A 1JREA 2CF7A 4OYNA 2YW7A 3BVKA 3R2OA 3AK9A 3C23A 3BVLA 4XGSA 4LYUA 2WWXB 5GU2X 3ES3A 5AXSA 1BFRA 5CZUA 3BVFA 1DATA 4ZMCA 4EVDA 2C2UA 2FG8A 2ZA6A 5FFCA 1DPSA 2BW1A 4II4A 4XKSA 4TOAA 3ERZA 3SHXA 3PZAA 3AF7X 1NNQA 3F38A 2VXXA 3QHCA 2FZFA 3WNWA 1XZ3A 5FFDA 2CN6A 3Q4OA 4LQVA 3U90A 4ISMA 4CMYV 3D19A 3E6RA 5HU6D 4DI0A 1YV1A 2ZG9X 3H7GA 2AR0A 3DBYA 3C1YA 5JKLG 4EVEA 4TODA 4WJG4 2V2PA 3E2CA 4REUA 2XJOA 4KVQA 3PW8C 3SH6A 2IB0A 2FJCA 5CMQA 1MOJA 3NP0X 3T9JA 3WVUA 3HIUA 5JDOB 4MKUA 5HJHA 3O7RA 3C21A 3GHQA 5JACA 1S30A 4LQNA 4YKHA 5D8SA 1J30A 3PWFA 2ZG7X 4M32A 3QD8A 1VEIA 3AJQA 2GS4A 3R2HA 4LPMA 3LKDA 1S2ZA 4ZKHA 2ZG8X 3V3KB 4TOCA 5GN8B 4CVRA 5CMRA 2Y44A 3KA9A 1TKOA 3VV9A 1VELA 5GU0X 1RCEA 4MY7A 2CLUA 1EUMA 1NF4A 3QHBA 1O9IA 3F34A 5D8PA 2CHIA 2PYBA 2XJMA 1JYBA 1Z6OM 3Q4RA 3KXUA 4RC7B 3N6OA 4ITTA 3UOFA 3QB9A 2N02A 1HRSA 5JDOA 1JIGA 3E1LA 5LS9A 3IS8A 1LB3A 2OKCA 2G38B 3AF9X 4A25A 1UMNA 2V2LA 3FSEA 4TOFA 3UOIA 3L0MA 4AM5A 2WTLA 4EVBA 4TOGA 3E1PA 3R2RA 4ZLWA 5FFBA 1Z4AA 4E6KA 5GN8A 1AEWA 1O9RA 2BJYA 5HJFA 1LKPA 2WLAA 4IWKA 2Z5PA 2Z90A 2X170 5D8QA 4LPJA 2HTNA 1RCIA 5J93A 3F36A 2HR5A 4RC6A 4DE6A 4PG0A 2FHAA 3PVRB 2QQYA 3PVTB 1TKPA 4RC7A 2YW6A 1R03A 3RE7A 2V2MA 3PWQA 3R2MA 4CVPA 4M35A 3RAVA 2OH3A 4P18A 1ZS3A 3KX9A 2V2JA 4MJYA 3EZUA 2F7NA 3BVEA 4W4KB 4TO9A 5I4JA 1VEQA 3FRRA 3W54A 1UVHA 1QYBA 4AM4A 2FG4A 4TW3A 4TOHA 3AK8A 3E1MA 4ZL6A 3VVAA 3OJ5A 4ML5A 3FVBA 3HL1A 4E40A 3FI6A 3E1OA 3GGYA 2JD80 1LKOA 1F33A 3NOZX 4EVCA 3PVRA 3BVIA 3PVTA 5GU3X 2XGWA 2BK6A 3Q4QA 5D8RA 3EZ0A 5D8OA 4ZJKA 3KWOA 5HQOA 1JKVA 3F32A 4ISPA 3KHKA 4DYUA 4U3GA 3C1ZA 2YJKA 4Z3BA 5K53A 3RGDA 4ZKWA 1JI4A 4KVSA 3BKNA 3IQ1A 1KRQA 3NP2X 2CLBA 1GWGA 3AJOA 1TJOA 2YJJA 4RC5B 4RC6B 4DZ0A 1BCFA 2ZURX 3KA3A 3M6JA 4ETRA 4W4LB 1NF6A 2MGYA 4TOEA 1B71A 2C41A 5GOUA 3UFBA 4LYXA 5JKMG 5FFEA 1RCCA 1QGHA 3TA8A 1LKMA 3EGMA 5E2DA 5J9VA 2ZA8A 3PWQC 4M34A 4CYAA 4XKUA 4QUWA 3QVDA 1F30A 2CN7A 1JTSA 1RCGA 4IWJA 5JKLA 2V2RA 4RC5A 3AJPA 4LQJA 3GVYA 2V2OA 4MN9A 2V15A 2RBDA 2G4HA 4YXMA 4CYBA 2FKZA 4IXKA 4DASA 2V2SA 2V8TA 1Z6OA 2OC5A 2XJNA 5J8WA 4MXPA 3KDQA 3E1QA 4RC8A 5IX6A 3O7SA 1OTKA 1BG7A 2GYQA 4Z5SA 5ERJA 4ERUA 2CWLA 2BKCA 5D8XA 3KA8A 2FL0A 3WVVA 1XZ1A 4PG1A 2C6RA 4TOBA 2Y3QA 4AM2A 3UNOA 5GU1X 4DYYA 2QF9A 4DYXA 2XKQA 3VNXA 1JKUA 3PW1B 1MFRA 3R2SA 4ZTTA 3IS7A 2D5KA 4KXRB 1IERA 3PVYB 5LG8A 3BT5A 2C2JA 3E1JA 3F37A 4LPNA 1L8IA 3ISFA 1RYTA 2ITBA 4CY9A 3GGZA 4YXJA 5LBHA 5C6FA 3WVWA 5LG2A 2VXIA 3KA6A 2VZBA
chains in the Genus database with same CATH topology
4CMYA 4PGIA 2WLUA 2V8UA 2Z6MA 2GYDA 1VLGA 2CEIA 3E6SA 2UX1A 5JKMA 2FFXJ 5K52A 5ERKA 2Z5RA 3ISEA 3OGHA 2Z5QA 2CHPA 2CIHA 3F35A 3JZAB 1TK6A 3F39A 1YUZA 4MUDA 1H96A 1L8HA 3PW1A 4X0JA 1JI5A 4ZL5A 2ZA7A 4DYZA 3PW8A 4PGKA 3SE1A 1S3QA 4KVRA 3A9QA 3PVYA 1ZUJA 1IESA 4Y08A 3Q4NA 3QZ3A 3R2LA 3MPSA 1N1QA 2C2FA 2JD70 1SOFA 3GE4A 1SQ3A 3RD0A 5FEJA 4LQHA 4CVTA 4M33A 4R42A 4XKTA 3JZ9A 5E1UA 4II4B 1RCDA 3A68A 5D8YA 2JD60 3FRSA 4ZKXA 3RBCA 1NFVA 3E1NA 2IY4A 3KA4A 5FFAA 1DVBA 1FHAA 5J8SA 4CVSA 3SIDA 3F33A 1JGCA 1YUXA 2V2NA 4ITWA 2V2IA 3R2KA 4YVZA 1VJXA 2W0OA 3AF8X 2IU2A 1JREA 2CF7A 4OYNA 2YW7A 3BVKA 3R2OA 3AK9A 3C23A 3BVLA 4XGSA 4LYUA 2WWXB 5GU2X 3ES3A 5AXSA 1BFRA 5CZUA 3BVFA 1DATA 4ZMCA 4EVDA 2C2UA 2FG8A 2ZA6A 5FFCA 1DPSA 2BW1A 4II4A 4XKSA 4TOAA 3ERZA 3SHXA 3PZAA 3AF7X 1NNQA 3F38A 2VXXA 3QHCA 2FZFA 3WNWA 1XZ3A 5FFDA 2CN6A 3Q4OA 4LQVA 3U90A 4ISMA 4CMYV 3D19A 3E6RA 5HU6D 4DI0A 1YV1A 2ZG9X 3H7GA 2AR0A 3DBYA 3C1YA 5JKLG 4EVEA 4TODA 4WJG4 2V2PA 3E2CA 4REUA 2XJOA 4KVQA 3PW8C 3SH6A 2IB0A 2FJCA 5CMQA 1MOJA 3NP0X 3T9JA 3WVUA 3HIUA 5JDOB 4MKUA 5HJHA 3O7RA 3C21A 3GHQA 5JACA 1S30A 4LQNA 4YKHA 5D8SA 1J30A 3PWFA 2ZG7X 4M32A 3QD8A 1VEIA 3AJQA 2GS4A 3R2HA 4LPMA 3LKDA 1S2ZA 4ZKHA 2ZG8X 3V3KB 4TOCA 5GN8B 4CVRA 5CMRA 2Y44A 3KA9A 1TKOA 3VV9A 1VELA 5GU0X 1RCEA 4MY7A 2CLUA 1EUMA 1NF4A 3QHBA 1O9IA 3F34A 5D8PA 2CHIA 2PYBA 2XJMA 1JYBA 1Z6OM 3Q4RA 3KXUA 4RC7B 3N6OA 4ITTA 3UOFA 3QB9A 2N02A 1HRSA 5JDOA 1JIGA 3E1LA 5LS9A 3IS8A 1LB3A 2OKCA 2G38B 3AF9X 4A25A 1UMNA 2V2LA 3FSEA 4TOFA 3UOIA 3L0MA 4AM5A 2WTLA 4EVBA 4TOGA 3E1PA 3R2RA 4ZLWA 5FFBA 1Z4AA 4E6KA 5GN8A 1AEWA 1O9RA 2BJYA 5HJFA 1LKPA 2WLAA 4IWKA 2Z5PA 2Z90A 2X170 5D8QA 4LPJA 2HTNA 1RCIA 5J93A 3F36A 2HR5A 4RC6A 4DE6A 4PG0A 2FHAA 3PVRB 2QQYA 3PVTB 1TKPA 4RC7A 2YW6A 1R03A 3RE7A 2V2MA 3PWQA 3R2MA 4CVPA 4M35A 3RAVA 2OH3A 4P18A 1ZS3A 3KX9A 2V2JA 4MJYA 3EZUA 2F7NA 3BVEA 4W4KB 4TO9A 5I4JA 1VEQA 3FRRA 3W54A 1UVHA 1QYBA 4AM4A 2FG4A 4TW3A 4TOHA 3AK8A 3E1MA 4ZL6A 3VVAA 3OJ5A 4ML5A 3FVBA 3HL1A 4E40A 3FI6A 3E1OA 3GGYA 2JD80 1LKOA 1F33A 3NOZX 4EVCA 3PVRA 3BVIA 3PVTA 5GU3X 2XGWA 2BK6A 3Q4QA 5D8RA 3EZ0A 5D8OA 4ZJKA 3KWOA 5HQOA 1JKVA 3F32A 4ISPA 3KHKA 4DYUA 4U3GA 3C1ZA 2YJKA 4Z3BA 5K53A 3RGDA 4ZKWA 1JI4A 4KVSA 3BKNA 3IQ1A 1KRQA 3NP2X 2CLBA 1GWGA 3AJOA 1TJOA 2YJJA 4RC5B 4RC6B 4DZ0A 1BCFA 2ZURX 3KA3A 3M6JA 4ETRA 4W4LB 1NF6A 2MGYA 4TOEA 1B71A 2C41A 5GOUA 3UFBA 4LYXA 5JKMG 5FFEA 1RCCA 1QGHA 3TA8A 1LKMA 3EGMA 5E2DA 5J9VA 2ZA8A 3PWQC 4M34A 4CYAA 4XKUA 4QUWA 3QVDA 1F30A 2CN7A 1JTSA 1RCGA 4IWJA 5JKLA 2V2RA 4RC5A 3AJPA 4LQJA 3GVYA 2V2OA 4MN9A 2V15A 2RBDA 2G4HA 4YXMA 4CYBA 2FKZA 4IXKA 4DASA 2V2SA 2V8TA 1Z6OA 2OC5A 2XJNA 5J8WA 4MXPA 3KDQA 3E1QA 4RC8A 5IX6A 3O7SA 1OTKA 1BG7A 2GYQA 4Z5SA 5ERJA 4ERUA 2CWLA 2BKCA 5D8XA 3KA8A 2FL0A 3WVVA 1XZ1A 4PG1A 2C6RA 4TOBA 2Y3QA 4AM2A 3UNOA 5GU1X 4DYYA 2QF9A 4DYXA 2XKQA 3VNXA 1JKUA 3PW1B 1MFRA 3R2SA 4ZTTA 3IS7A 2D5KA 4KXRB 1IERA 3PVYB 5LG8A 3BT5A 2C2JA 3E1JA 3F37A 4LPNA 1L8IA 3ISFA 1RYTA 2ITBA 4CY9A 3GGZA 4YXJA 5LBHA 5C6FA 3WVWA 5LG2A 2VXIA 3KA6A 2VZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CMY A;  4PGI A;  2WLU A;  2Z6M A;  2GYD A;  1VLG A;  2CEI A;  3E6S A;  2UX1 A;  5JKM A;  2FFX J;  5K52 A;  5ERK A;  2Z5R A;  3ISE A;  3OGH A;  2Z5Q A;  2CHP A;  2CIH A;  3F35 A;  1TK6 A;  3F39 A;  1YUZ A;  4MUD A;  1H96 A;  1L8H A;  3PW1 A;  1JI5 A;  4ZL5 A;  2ZA7 A;  4DYZ A;  3PW8 A;  4PGK A;  3SE1 A;  1S3Q A;  4KVR A;  3A9Q A;  3PVY A;  1ZUJ A;  1IES A;  4Y08 A;  3Q4N A;  3QZ3 A;  3R2L A;  3MPS A;  1N1Q A;  2C2F A;  2JD7 0;  1SOF A;  3GE4 A;  1SQ3 A;  3RD0 A;  5FEJ A;  4LQH A;  4CVT A;  4M33 A;  4R42 A;  4XKT A;  5E1U A;  4II4 B;  1RCD A;  3A68 A;  5D8Y A;  2JD6 0;  4ZKX A;  3RBC A;  1NFV A;  3E1N A;  2IY4 A;  3KA4 A;  5FFA A;  1DVB A;  1FHA A;  5J8S A;  4CVS A;  3SID A;  3F33 A;  1JGC A;  1YUX A;  2V2N A;  4ITW A;  2V2I A;  3R2K A;  1VJX A;  2W0O A;  3AF8 X;  2IU2 A;  1JRE A;  2CF7 A;  4OYN A;  2YW7 A;  3BVK A;  3R2O A;  3AK9 A;  4XGS A;  3BVL A;  4LYU A;  5GU2 X;  3ES3 A;  5AXS A;  1BFR A;  5CZU A;  3BVF A;  1DAT A;  4ZMC A;  4EVD A;  2C2U A;  2FG8 A;  2ZA6 A;  5FFC A;  1DPS A;  2BW1 A;  4II4 A;  4XKS A;  4TOA A;  3ERZ A;  3SHX A;  3PZA A;  3AF7 X;  1NNQ A;  3F38 A;  2VXX A;  3QHC A;  2FZF A;  3WNW A;  1XZ3 A;  5FFD A;  2CN6 A;  3Q4O A;  4LQV A;  3U90 A;  4ISM A;  4CMY V;  3E6R A;  4DI0 A;  1YV1 A;  2ZG9 X;  3H7G A;  5JKL G;  4EVE A;  4TOD A;  2V2P A;  3E2C A;  4REU A;  2XJO A;  4KVQ A;  3PW8 C;  3SH6 A;  2IB0 A;  2FJC A;  5CMQ A;  1MOJ A;  3NP0 X;  3T9J A;  3WVU A;  3HIU A;  4MKU A;  5HJH A;  3O7R A;  3GHQ A;  5JAC A;  1S30 A;  4LQN A;  4YKH A;  5D8S A;  1J30 A;  3PWF A;  2ZG7 X;  4M32 A;  3QD8 A;  4LPM A;  1VEI A;  2GS4 A;  3AJQ A;  3R2H A;  1S2Z A;  4ZKH A;  2ZG8 X;  4TOC A;  5GN8 B;  4CVR A;  5CMR A;  3KA9 A;  1TKO A;  1VEL A;  5GU0 X;  1RCE A;  4MY7 A;  2CLU A;  1EUM A;  1NF4 A;  3QHB A;  1O9I A;  3F34 A;  5D8P A;  2CHI A;  2PYB A;  2XJM A;  1JYB A;  1Z6O M;  3Q4R A;  3KXU A;  4RC7 B;  4ITT A;  3UOF A;  3QB9 A;  1HRS A;  1JIG A;  3E1L A;  5LS9 A;  3IS8 A;  1LB3 A;  3AF9 X;  4A25 A;  1UMN A;  2V2L A;  3FSE A;  4TOF A;  3UOI A;  4AM5 A;  2WTL A;  4EVB A;  4TOG A;  3E1P A;  3R2R A;  4ZLW A;  5FFB A;  1Z4A A;  4E6K A;  5GN8 A;  1AEW A;  1O9R A;  2BJY A;  5HJF A;  1LKP A;  2WLA A;  4IWK A;  2Z5P A;  2Z90 A;  2X17 0;  5D8Q A;  4LPJ A;  2HTN A;  1RCI A;  5J93 A;  3F36 A;  2HR5 A;  4RC6 A;  4DE6 A;  4PG0 A;  2FHA A;  3PVR B;  2QQY A;  3PVT B;  1TKP A;  4RC7 A;  2YW6 A;  1R03 A;  3RE7 A;  2V2M A;  3PWQ A;  3R2M A;  4CVP A;  4M35 A;  3RAV A;  2OH3 A;  4P18 A;  1ZS3 A;  3KX9 A;  2V2J A;  4MJY A;  3EZU A;  2F7N A;  3BVE A;  4TO9 A;  5I4J A;  1VEQ A;  1UVH A;  1QYB A;  4AM4 A;  2FG4 A;  4TW3 A;  4TOH A;  3AK8 A;  3E1M A;  4ZL6 A;  3OJ5 A;  4ML5 A;  3FVB A;  3HL1 A;  3FI6 A;  3E1O A;  2JD8 0;  1LKO A;  1F33 A;  3NOZ X;  4EVC A;  3PVR A;  3BVI A;  3PVT A;  5GU3 X;  2XGW A;  2BK6 A;  3Q4Q A;  5D8R A;  3EZ0 A;  5D8O A;  4ZJK A;  3KWO A;  5HQO A;  1JKV A;  3F32 A;  4ISP A;  4DYU A;  4U3G A;  2YJK A;  4Z3B A;  5K53 A;  3RGD A;  4ZKW A;  1JI4 A;  4KVS A;  3BKN A;  3IQ1 A;  1KRQ A;  3NP2 X;  2CLB A;  1GWG A;  3AJO A;  1TJO A;  2YJJ A;  4RC5 B;  4RC6 B;  4DZ0 A;  1BCF A;  2ZUR X;  3KA3 A;  4ETR A;  1NF6 A;  4TOE A;  1B71 A;  2C41 A;  5GOU A;  4LYX A;  5JKM G;  5FFE A;  1RCC A;  1QGH A;  3TA8 A;  1LKM A;  3EGM A;  5E2D A;  5J9V A;  2ZA8 A;  3PWQ C;  4M34 A;  4CYA A;  4XKU A;  4QUW A;  3QVD A;  1F30 A;  2CN7 A;  1JTS A;  1RCG A;  4IWJ A;  5JKL A;  2V2R A;  4RC5 A;  3AJP A;  4LQJ A;  3GVY A;  2V2O A;  4MN9 A;  2V15 A;  2RBD A;  2G4H A;  4CYB A;  2FKZ A;  4IXK A;  4DAS A;  2V2S A;  2XJN A;  1Z6O A;  2OC5 A;  5J8W A;  3E1Q A;  4RC8 A;  5IX6 A;  3O7S A;  1OTK A;  1BG7 A;  2GYQ A;  4Z5S A;  5ERJ A;  4ERU A;  2BKC A;  5D8X A;  3KA8 A;  2FL0 A;  3WVV A;  1XZ1 A;  4PG1 A;  2C6R A;  4TOB A;  2Y3Q A;  4AM2 A;  3UNO A;  5GU1 X;  4DYY A;  2QF9 A;  4DYX A;  2XKQ A;  3VNX A;  1JKU A;  3PW1 B;  1MFR A;  3R2S A;  4ZTT A;  3IS7 A;  2D5K A;  1IER A;  3PVY B;  5LG8 A;  3BT5 A;  2C2J A;  3E1J A;  3F37 A;  4LPN A;  1L8I A;  3ISF A;  1RYT A;  2ITB A;  4CY9 A;  5LBH A;  5C6F A;  3WVW A;  5LG2 A;  2VXI A;  3KA6 A;  2VZB A; 
#chains in the Genus database with same CATH topology
 4CMY A;  4PGI A;  2WLU A;  2V8U A;  2Z6M A;  2GYD A;  1VLG A;  2CEI A;  3E6S A;  2UX1 A;  5JKM A;  2FFX J;  5K52 A;  5ERK A;  2Z5R A;  3ISE A;  3OGH A;  2Z5Q A;  2CHP A;  2CIH A;  3F35 A;  3JZA B;  1TK6 A;  3F39 A;  1YUZ A;  4MUD A;  1H96 A;  1L8H A;  3PW1 A;  4X0J A;  1JI5 A;  4ZL5 A;  2ZA7 A;  4DYZ A;  3PW8 A;  4PGK A;  3SE1 A;  1S3Q A;  4KVR A;  3A9Q A;  3PVY A;  1ZUJ A;  1IES A;  4Y08 A;  3Q4N A;  3QZ3 A;  3R2L A;  3MPS A;  1N1Q A;  2C2F A;  2JD7 0;  1SOF A;  3GE4 A;  1SQ3 A;  3RD0 A;  5FEJ A;  4LQH A;  4CVT A;  4M33 A;  4R42 A;  4XKT A;  3JZ9 A;  5E1U A;  4II4 B;  1RCD A;  3A68 A;  5D8Y A;  2JD6 0;  3FRS A;  4ZKX A;  3RBC A;  1NFV A;  3E1N A;  2IY4 A;  3KA4 A;  5FFA A;  1DVB A;  1FHA A;  5J8S A;  4CVS A;  3SID A;  3F33 A;  1JGC A;  1YUX A;  2V2N A;  4ITW A;  2V2I A;  3R2K A;  4YVZ A;  1VJX A;  2W0O A;  3AF8 X;  2IU2 A;  1JRE A;  2CF7 A;  4OYN A;  2YW7 A;  3BVK A;  3R2O A;  3AK9 A;  3C23 A;  3BVL A;  4XGS A;  4LYU A;  2WWX B;  5GU2 X;  3ES3 A;  5AXS A;  1BFR A;  5CZU A;  3BVF A;  1DAT A;  4ZMC A;  4EVD A;  2C2U A;  2FG8 A;  2ZA6 A;  5FFC A;  1DPS A;  2BW1 A;  4II4 A;  4XKS A;  4TOA A;  3ERZ A;  3SHX A;  3PZA A;  3AF7 X;  1NNQ A;  3F38 A;  2VXX A;  3QHC A;  2FZF A;  3WNW A;  1XZ3 A;  5FFD A;  2CN6 A;  3Q4O A;  4LQV A;  3U90 A;  4ISM A;  4CMY V;  3D19 A;  3E6R A;  5HU6 D;  4DI0 A;  1YV1 A;  2ZG9 X;  3H7G A;  2AR0 A;  3DBY A;  3C1Y A;  5JKL G;  4EVE A;  4TOD A;  4WJG 4;  2V2P A;  3E2C A;  4REU A;  2XJO A;  4KVQ A;  3PW8 C;  3SH6 A;  2IB0 A;  2FJC A;  5CMQ A;  1MOJ A;  3NP0 X;  3T9J A;  3WVU A;  3HIU A;  5JDO B;  4MKU A;  5HJH A;  3O7R A;  3C21 A;  3GHQ A;  5JAC A;  1S30 A;  4LQN A;  4YKH A;  5D8S A;  1J30 A;  3PWF A;  2ZG7 X;  4M32 A;  3QD8 A;  1VEI A;  3AJQ A;  2GS4 A;  3R2H A;  4LPM A;  3LKD A;  1S2Z A;  4ZKH A;  2ZG8 X;  3V3K B;  4TOC A;  5GN8 B;  4CVR A;  5CMR A;  2Y44 A;  3KA9 A;  1TKO A;  3VV9 A;  1VEL A;  5GU0 X;  1RCE A;  4MY7 A;  2CLU A;  1EUM A;  1NF4 A;  3QHB A;  1O9I A;  3F34 A;  5D8P A;  2CHI A;  2PYB A;  2XJM A;  1JYB A;  1Z6O M;  3Q4R A;  3KXU A;  4RC7 B;  3N6O A;  4ITT A;  3UOF A;  3QB9 A;  2N02 A;  1HRS A;  5JDO A;  1JIG A;  3E1L A;  5LS9 A;  3IS8 A;  1LB3 A;  2OKC A;  2G38 B;  3AF9 X;  4A25 A;  1UMN A;  2V2L A;  3FSE A;  4TOF A;  3UOI A;  3L0M A;  4AM5 A;  2WTL A;  4EVB A;  4TOG A;  3E1P A;  3R2R A;  4ZLW A;  5FFB A;  1Z4A A;  4E6K A;  5GN8 A;  1AEW A;  1O9R A;  2BJY A;  5HJF A;  1LKP A;  2WLA A;  4IWK A;  2Z5P A;  2Z90 A;  2X17 0;  5D8Q A;  4LPJ A;  2HTN A;  1RCI A;  5J93 A;  3F36 A;  2HR5 A;  4RC6 A;  4DE6 A;  4PG0 A;  2FHA A;  3PVR B;  2QQY A;  3PVT B;  1TKP A;  4RC7 A;  2YW6 A;  1R03 A;  3RE7 A;  2V2M A;  3PWQ A;  3R2M A;  4CVP A;  4M35 A;  3RAV A;  2OH3 A;  4P18 A;  1ZS3 A;  3KX9 A;  2V2J A;  4MJY A;  3EZU A;  2F7N A;  3BVE A;  4W4K B;  4TO9 A;  5I4J A;  1VEQ A;  3FRR A;  3W54 A;  1UVH A;  1QYB A;  4AM4 A;  2FG4 A;  4TW3 A;  4TOH A;  3AK8 A;  3E1M A;  4ZL6 A;  3VVA A;  3OJ5 A;  4ML5 A;  3FVB A;  3HL1 A;  4E40 A;  3FI6 A;  3E1O A;  3GGY A;  2JD8 0;  1LKO A;  1F33 A;  3NOZ X;  4EVC A;  3PVR A;  3BVI A;  3PVT A;  5GU3 X;  2XGW A;  2BK6 A;  3Q4Q A;  5D8R A;  3EZ0 A;  5D8O A;  4ZJK A;  3KWO A;  5HQO A;  1JKV A;  3F32 A;  4ISP A;  3KHK A;  4DYU A;  4U3G A;  3C1Z A;  2YJK A;  4Z3B A;  5K53 A;  3RGD A;  4ZKW A;  1JI4 A;  4KVS A;  3BKN A;  3IQ1 A;  1KRQ A;  3NP2 X;  2CLB A;  1GWG A;  3AJO A;  1TJO A;  2YJJ A;  4RC5 B;  4RC6 B;  4DZ0 A;  1BCF A;  2ZUR X;  3KA3 A;  3M6J A;  4ETR A;  4W4L B;  1NF6 A;  2MGY A;  4TOE A;  1B71 A;  2C41 A;  5GOU A;  3UFB A;  4LYX A;  5JKM G;  5FFE A;  1RCC A;  1QGH A;  3TA8 A;  1LKM A;  3EGM A;  5E2D A;  5J9V A;  2ZA8 A;  3PWQ C;  4M34 A;  4CYA A;  4XKU A;  4QUW A;  3QVD A;  1F30 A;  2CN7 A;  1JTS A;  1RCG A;  4IWJ A;  5JKL A;  2V2R A;  4RC5 A;  3AJP A;  4LQJ A;  3GVY A;  2V2O A;  4MN9 A;  2V15 A;  2RBD A;  2G4H A;  4YXM A;  4CYB A;  2FKZ A;  4IXK A;  4DAS A;  2V2S A;  2V8T A;  1Z6O A;  2OC5 A;  2XJN A;  5J8W A;  4MXP A;  3KDQ A;  3E1Q A;  4RC8 A;  5IX6 A;  3O7S A;  1OTK A;  1BG7 A;  2GYQ A;  4Z5S A;  5ERJ A;  4ERU A;  2CWL A;  2BKC A;  5D8X A;  3KA8 A;  2FL0 A;  3WVV A;  1XZ1 A;  4PG1 A;  2C6R A;  4TOB A;  2Y3Q A;  4AM2 A;  3UNO A;  5GU1 X;  4DYY A;  2QF9 A;  4DYX A;  2XKQ A;  3VNX A;  1JKU A;  3PW1 B;  1MFR A;  3R2S A;  4ZTT A;  3IS7 A;  2D5K A;  4KXR B;  1IER A;  3PVY B;  5LG8 A;  3BT5 A;  2C2J A;  3E1J A;  3F37 A;  4LPN A;  1L8I A;  3ISF A;  1RYT A;  2ITB A;  4CY9 A;  3GGZ A;  4YXJ A;  5LBH A;  5C6F A;  3WVW A;  5LG2 A;  2VXI A;  3KA6 A;  2VZB A; 
#chains in the Genus database with same CATH homology
 4CMY A;  4PGI A;  2WLU A;  2V8U A;  2Z6M A;  2GYD A;  1VLG A;  2CEI A;  3E6S A;  2UX1 A;  5JKM A;  2FFX J;  5K52 A;  5ERK A;  2Z5R A;  3ISE A;  3OGH A;  2Z5Q A;  2CHP A;  2CIH A;  3F35 A;  3JZA B;  1TK6 A;  3F39 A;  1YUZ A;  4MUD A;  1H96 A;  1L8H A;  3PW1 A;  4X0J A;  1JI5 A;  4ZL5 A;  2ZA7 A;  4DYZ A;  3PW8 A;  4PGK A;  3SE1 A;  1S3Q A;  4KVR A;  3A9Q A;  3PVY A;  1ZUJ A;  1IES A;  4Y08 A;  3Q4N A;  3QZ3 A;  3R2L A;  3MPS A;  1N1Q A;  2C2F A;  2JD7 0;  1SOF A;  3GE4 A;  1SQ3 A;  3RD0 A;  5FEJ A;  4LQH A;  4CVT A;  4M33 A;  4R42 A;  4XKT A;  3JZ9 A;  5E1U A;  4II4 B;  1RCD A;  3A68 A;  5D8Y A;  2JD6 0;  3FRS A;  4ZKX A;  3RBC A;  1NFV A;  3E1N A;  2IY4 A;  3KA4 A;  5FFA A;  1DVB A;  1FHA A;  5J8S A;  4CVS A;  3SID A;  3F33 A;  1JGC A;  1YUX A;  2V2N A;  4ITW A;  2V2I A;  3R2K A;  4YVZ A;  1VJX A;  2W0O A;  3AF8 X;  2IU2 A;  1JRE A;  2CF7 A;  4OYN A;  2YW7 A;  3BVK A;  3R2O A;  3AK9 A;  3C23 A;  3BVL A;  4XGS A;  4LYU A;  2WWX B;  5GU2 X;  3ES3 A;  5AXS A;  1BFR A;  5CZU A;  3BVF A;  1DAT A;  4ZMC A;  4EVD A;  2C2U A;  2FG8 A;  2ZA6 A;  5FFC A;  1DPS A;  2BW1 A;  4II4 A;  4XKS A;  4TOA A;  3ERZ A;  3SHX A;  3PZA A;  3AF7 X;  1NNQ A;  3F38 A;  2VXX A;  3QHC A;  2FZF A;  3WNW A;  1XZ3 A;  5FFD A;  2CN6 A;  3Q4O A;  4LQV A;  3U90 A;  4ISM A;  4CMY V;  3D19 A;  3E6R A;  5HU6 D;  4DI0 A;  1YV1 A;  2ZG9 X;  3H7G A;  2AR0 A;  3DBY A;  3C1Y A;  5JKL G;  4EVE A;  4TOD A;  4WJG 4;  2V2P A;  3E2C A;  4REU A;  2XJO A;  4KVQ A;  3PW8 C;  3SH6 A;  2IB0 A;  2FJC A;  5CMQ A;  1MOJ A;  3NP0 X;  3T9J A;  3WVU A;  3HIU A;  5JDO B;  4MKU A;  5HJH A;  3O7R A;  3C21 A;  3GHQ A;  5JAC A;  1S30 A;  4LQN A;  4YKH A;  5D8S A;  1J30 A;  3PWF A;  2ZG7 X;  4M32 A;  3QD8 A;  1VEI A;  3AJQ A;  2GS4 A;  3R2H A;  4LPM A;  3LKD A;  1S2Z A;  4ZKH A;  2ZG8 X;  3V3K B;  4TOC A;  5GN8 B;  4CVR A;  5CMR A;  2Y44 A;  3KA9 A;  1TKO A;  3VV9 A;  1VEL A;  5GU0 X;  1RCE A;  4MY7 A;  2CLU A;  1EUM A;  1NF4 A;  3QHB A;  1O9I A;  3F34 A;  5D8P A;  2CHI A;  2PYB A;  2XJM A;  1JYB A;  1Z6O M;  3Q4R A;  3KXU A;  4RC7 B;  3N6O A;  4ITT A;  3UOF A;  3QB9 A;  2N02 A;  1HRS A;  5JDO A;  1JIG A;  3E1L A;  5LS9 A;  3IS8 A;  1LB3 A;  2OKC A;  2G38 B;  3AF9 X;  4A25 A;  1UMN A;  2V2L A;  3FSE A;  4TOF A;  3UOI A;  3L0M A;  4AM5 A;  2WTL A;  4EVB A;  4TOG A;  3E1P A;  3R2R A;  4ZLW A;  5FFB A;  1Z4A A;  4E6K A;  5GN8 A;  1AEW A;  1O9R A;  2BJY A;  5HJF A;  1LKP A;  2WLA A;  4IWK A;  2Z5P A;  2Z90 A;  2X17 0;  5D8Q A;  4LPJ A;  2HTN A;  1RCI A;  5J93 A;  3F36 A;  2HR5 A;  4RC6 A;  4DE6 A;  4PG0 A;  2FHA A;  3PVR B;  2QQY A;  3PVT B;  1TKP A;  4RC7 A;  2YW6 A;  1R03 A;  3RE7 A;  2V2M A;  3PWQ A;  3R2M A;  4CVP A;  4M35 A;  3RAV A;  2OH3 A;  4P18 A;  1ZS3 A;  3KX9 A;  2V2J A;  4MJY A;  3EZU A;  2F7N A;  3BVE A;  4W4K B;  4TO9 A;  5I4J A;  1VEQ A;  3FRR A;  3W54 A;  1UVH A;  1QYB A;  4AM4 A;  2FG4 A;  4TW3 A;  4TOH A;  3AK8 A;  3E1M A;  4ZL6 A;  3VVA A;  3OJ5 A;  4ML5 A;  3FVB A;  3HL1 A;  4E40 A;  3FI6 A;  3E1O A;  3GGY A;  2JD8 0;  1LKO A;  1F33 A;  3NOZ X;  4EVC A;  3PVR A;  3BVI A;  3PVT A;  5GU3 X;  2XGW A;  2BK6 A;  3Q4Q A;  5D8R A;  3EZ0 A;  5D8O A;  4ZJK A;  3KWO A;  5HQO A;  1JKV A;  3F32 A;  4ISP A;  3KHK A;  4DYU A;  4U3G A;  3C1Z A;  2YJK A;  4Z3B A;  5K53 A;  3RGD A;  4ZKW A;  1JI4 A;  4KVS A;  3BKN A;  3IQ1 A;  1KRQ A;  3NP2 X;  2CLB A;  1GWG A;  3AJO A;  1TJO A;  2YJJ A;  4RC5 B;  4RC6 B;  4DZ0 A;  1BCF A;  2ZUR X;  3KA3 A;  3M6J A;  4ETR A;  4W4L B;  1NF6 A;  2MGY A;  4TOE A;  1B71 A;  2C41 A;  5GOU A;  3UFB A;  4LYX A;  5JKM G;  5FFE A;  1RCC A;  1QGH A;  3TA8 A;  1LKM A;  3EGM A;  5E2D A;  5J9V A;  2ZA8 A;  3PWQ C;  4M34 A;  4CYA A;  4XKU A;  4QUW A;  3QVD A;  1F30 A;  2CN7 A;  1JTS A;  1RCG A;  4IWJ A;  5JKL A;  2V2R A;  4RC5 A;  3AJP A;  4LQJ A;  3GVY A;  2V2O A;  4MN9 A;  2V15 A;  2RBD A;  2G4H A;  4YXM A;  4CYB A;  2FKZ A;  4IXK A;  4DAS A;  2V2S A;  2V8T A;  1Z6O A;  2OC5 A;  2XJN A;  5J8W A;  4MXP A;  3KDQ A;  3E1Q A;  4RC8 A;  5IX6 A;  3O7S A;  1OTK A;  1BG7 A;  2GYQ A;  4Z5S A;  5ERJ A;  4ERU A;  2CWL A;  2BKC A;  5D8X A;  3KA8 A;  2FL0 A;  3WVV A;  1XZ1 A;  4PG1 A;  2C6R A;  4TOB A;  2Y3Q A;  4AM2 A;  3UNO A;  5GU1 X;  4DYY A;  2QF9 A;  4DYX A;  2XKQ A;  3VNX A;  1JKU A;  3PW1 B;  1MFR A;  3R2S A;  4ZTT A;  3IS7 A;  2D5K A;  4KXR B;  1IER A;  3PVY B;  5LG8 A;  3BT5 A;  2C2J A;  3E1J A;  3F37 A;  4LPN A;  1L8I A;  3ISF A;  1RYT A;  2ITB A;  4CY9 A;  3GGZ A;  4YXJ A;  5LBH A;  5C6F A;  3WVW A;  5LG2 A;  2VXI A;  3KA6 A;  2VZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...