3EZUA

Crystal structure of multidomain protein of unknown function with ggdef-domain (np_951600.1) from geobacter sulfurreducens at 1.95 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
342
structure length
336
Chain Sequence
b'GMSGDILNDIVAACLELERKASSVFKMFAAHAGSDEARRFWETVADETRHHSAVYERLQERGGRENLPIIIYKPAETLEELEMIGKSIDEQVERYTEAPSSEAACLLGFRLQLYLLHPAFASLCRLTRDASEDLPDIGYGRYLRRFIDGIGSCGLATAETELLGEALFRLWNEARQLAAQSHFDALTGVMTRAGFFKTVGSLAYAAQRSGSNVGIMLIDLDYFKLVGQTGDRILQLVAETITSHLRRSDVVGRYDGDEFVVYLSPVEPASLRTVAENLRRSIEEESARMVPVTASIGVAQGILGTDVDGGIEELVRLADECLMQAKYTGKNKVVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GGDEF domain protein
publication title Crystal structure of multidomain protein of unknown function with GGDEF-domain (NP_951600.1) from GEOBACTER SULFURREDUCENS at 1.95 A resolution
rcsb
source organism Geobacter sulfurreducens
molecule tags Signaling protein
total genus 133
structure length 336
sequence length 342
ec nomenclature
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ezuA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ezuA02
4O44A 2Z5PA 4CY9A 4ZPAA 3M8QB 3ISNC 1CSJA 2WTLA 2FLPA 3PW0A 4CVSA 1S1TA 4Q0BA 4TQSA 2W7PA 2XC9A 3AF8X 2AX1A 4PG1A 2JC0A 1FHAA 1JIHA 2OPRB 1S1UA 3E1OA 2B6AA 3GIKA 2WRMA 5KFTA 4JV1A 2CJQA 4ZHRA 3RB0A 3BQ2A 4KKOA 1JKUA 1JLFA 4ZLWA 1C0TB 3NP0X 1S97A 4IRKA 1N5YA 4TO9A 3CDWA 4MN9A 1S9GB 4M35A 4J9KA 3I0RA 4OL8A 3PR5B 3OL9A 2QF9A 5LS9A 5C24A 3MR2A 3GIMA 3T9JA 4IQXA 2FKZA 4NRTA 2ZE2B 2C6RA 5J2NA 2W0OA 1QAJA 2C2JA 4TYBA 2G4HA 4XKUA 5KG5A 5DQIA 4KVQA 1VEQA 4Y2CA 3E6SA 1FKOB 3CDUA 3EZ0A 1RT4A 3FI6A 2IMWP 5J93A 1S1XA 3IGVA 1LWFA 2D5KA 1IKYB 5EWGA 2W9BA 3F36A 1SH0A 2EC0A 1T03B 1DVBA 4ML5A 5C25B 3DRRB 4LYUA 4I7FB 4IG3A 3QZ7A 4JV2A 1DTQA 3PW1A 3UPFA 2ZG9X 3H7GA 1RT1B 4NCGA 1VRUA 3NAIA 3T19A 3MF5A 3IG1A 5EDWA 5KFWA 1JLQB 1EP4A 4QW9A 3SE1A 2IB0A 1IKXB 4Y2AA 4O3OA 1JLAA 3KMQA 1TKOA 5JACA 3H2LA 4R8UA 2D7SA 1S6QA 4I2PA 4MK7A 3KLEA 1RCEA 5F8GA 3C6TA 3CJ0A 5F9LA 3E6RA 2ZA7A 4RNHA 2W8KA 1S1WA 4ITTA 2XGPA 1HMVB 4ECUA 4I2QB 4F50A 3UDLA 3GILA 4CVRA 2XJMA 2AX0A 4ETRA 2WK4A 3E1LA 1HPZA 2CHPA 1J5OA 2X170 5C5JA 1EUMA 1IESA 4F4ZA 2YKNB 4TYAA 4LQHA 2VG7B 2OPQA 1UVHA 2E9RX 5E1UA 4NLYA 3BJYA 2VG6B 1O9RA 4LQVA 4ECYA 4KO0A 4ID5B 1RT6A 5KT7A 4II4B 3QZ8A 5HP1B 3BGRB 3KA6A 3RB3A 2V4QA 3SIDA 3SHXA 3SFUA 3FSIA 4F4YA 1HYSB 2VG5B 1ZS3A 2R8HA 4NLTA 3H40A 4O44B 2BQUA 3LP0B 3CJ4A 4KV8A 3AK9A 5AXSA 2V0NA 4LPJA 5FFAA 5HLFB 1RCIA 2JEGA 2Z5RA 4RW9B 4PWDA 4YR3A 4MFBA 2HR5A 3FVBA 2IAJA 4IH6A 3E01B 5L1KA 5JUMA 3RE7A 4KKOB 5CYMB 1KHWA 1DTTA 1JLFB 4RNNA 1WNEA 3JYTA 1N5YB 2VXIA 5FDLB 1LW2A 3MECA 3AF7X 3DLEB 4KBIA 4ZVEA 4LSLB 3I0RB 3BT5A 3PZAA 4DL7A 5C24B 2YNIB 2RF2A 3IS9A 4DL6A 3DRPA 1N1QA 2C2EA 2W9CA 1C0UA 5J2QA 3BSNA 3OLBA 3TAMA 4CMYA 2B5JA 4MIBA 4ZPDA 2R2UA 4KAIA 3KLGA 1IKVA 1QAIA 1VEIA 3IN5A 4B3OB 2GS4A 3FFIA 3LANA 5JXSA 3IS7A 5KT6A 1S1XB 3PW4A 5J8SA 2W9BB 3KK2A 3TQ1A 3PW8C 4ECQA 1R03A 1QUVA 4NLSA 4IG3B 3PJWA 3DOKA 3R2LA 3DOLB 4IWKA 1TKXA 4ZMCA 4DL2A 1JTSA 3FSEA 5GN8A 2D3UA 5KFJA 4NCGB 3GYNA 4K4VA 2YNGA 3RB4A 3KA4A 3IG1B 1JYBA 5K14A 3LP2A 4ZKHA 3QGHA 1N6QB 1S6PB 3H5UA 3AJPA 1TKTA 5F8MA 3E1JA 1S6QB 4ED3A 2IC3B 3E2CA 2E9ZA 4XKSA 2R8JA 3KLEB 1JLGA 2XWYA 1S1WB 3HKWA 2YNFB 2YNHA 2CN6A 4IWJA 2Z90A 1VJXA 3Q8PB 2I5JB 1BCFA 4WFYA 4RC7B 3WVWA 4ZPBA 2JD70 4RNOA 2GYQA 3H5YA 2BR0A 1RCDA 4NLGA 2OPQB 5F8JA 4EVEA 3A68A 1Z4AA 4H4MA 4ZPCA 2IY4A 4KO0B 1GX6A 2GYDA 2I1RA 4NLOA 2AGQA 2V2RA 1TK6A 4ZP6A 1L8IA 2C2FA 3ISEA 4URGA 2ZD1A 5J2MA 3CDEA 2JEJA 4WXOA 4YR0A 4RNMA 3MEDA 1FKPA 2QE5A 4KV8B 3Q8RB 4NLQA 2IJFA 1K1QA 3Q4QA 2BANA 4H4OA 1RYRA 3NOZX 3GIJA 5KT5A 3SI8A 4WFZA 3V6DA 2FLNA 4WZQA 3KLHA 1UWBB 4RW7B 2HNDA 3G6XA 1DLOA 1GX5A 2IAJB 4PGKA 3LAKA 2UUWA 2BW1A 4RC6A 2ASDA 2HTNA 4FS1A 1DTTB 3OL8A 3JYTB 3MECB 1RT5A 2V2NA 5KG7A 1RT3B 2RF2B 3IS9B 4NLXA 3KHLA 4U6PA 3KHGA 3KX9A 3UNOA 4Z3BA 5E2DA 5J2QB 3F37A 1RT7A 2VA3A 5ERKA 3KLGB 3GV7B 1LWEB 2YW7A 3M8PB 4ECSA 4O3SA 5ERJA 5D8RA 4DZ0A 3KLFB 3WNWA 4QWEA 1C2PA 5K52A 2BKCA 2IU2A 4ED1A 4MKAA 3QO9B 4WYLA 3V81A 4IR9A 1HNVA 5FFCA 3EGMA 2HNYB 5F8HA 5D8QA 3MR3A 3V4IB 3DLGB 3HVTB 4K4XA 3QLHA 1S9EA 3DOKB 2FVRA 3KK3A 3Q4RA 5D3GA 2R2TA 2ILZA 5GN8B 5DGAA 1Z6OA 1HQUB 4K4UA 1S2ZA 1RA6A 4EEYA 3NL0A 3AJOA 5K14B 2BRLA 5KFSA 4HYKA 4RC8A 3LP2B 4Q44A 2IM2A 4DEZA 4O3NA 3D28A 3D5MA 3BREA 2FJCA 2HNZB 3HVAA 1JLEA 1C1BB 2RKIB 3JSMB 2XCPA 3RD0A 3KA3A 3E51A 4EVDA 4R42A 1DATA 4ZMMA 2XJOA 2ASJA 2GC8A 2WLUA 4H4MB 2J6SA 5JKMG 1RYSA 2HMIA 5JKLG 2VA2A 1S49A 2V2PA 4LQ9A 4LSNA 2VXXA 3MPSA 2YKMA 4ZP8A 3GE4A 2XCAA 3MR5A 4R5PA 3H4DA 5FEJA 5KFYA 1C1CB 3ITHB 5J2MB 2OPPA 4ZP7A 4KE5A 4G1QB 1MMLA 3OHAA 1TL3A 1LW0A 3SH6A 1S10A 3PHEA 5GU0X 2XJNA 2BANB 2IM1A 4LQ3A 4FBTA 1K1SA 1NHUA 1S48A 5KFGA 4M33A 3F34A 3AJQA 1IKWA 4JV0A 1RTHA 5DQGA 1HNIB 4EYHB 3GV5B 4IOBA 4RW4B 2HNDB 5HBMA 3ICLA 1DLOB 4DL5A 4RC6B 4DL4A 3NP2X 5KFHA 4IFYA 3I5BA 4TOCA 4REUA 1RT5B 2FFXJ 4TOFA 3WVVA 3QIDA 3PW2A 4IR1A 1TVRA 1NFVA 4RNFA 2ZG7X 4EBDA 3PVXA 2F8EX 2V2LA 1SH2A 3KOAA 2FG4A 2OPSA 4O3PA 3E1MA 1I6JA 1F30A 5FFBA 3KXUA 1YUXA 2VZBA 4M95A 4ECZA 1T05B 3G6YA 1S9FA 1HARA 3BVKA 3PZPA 1N56A 5J1EA 4CYAA 4HKQA 5K53A 3BQ0A 2IA6A 5KFXA 2V2IA 3GHQA 2C2UA 4AM5A 3V81B 4URSA 4RZRA 2HWIA 3BR9A 4O4GA 2DPJA 4KFBB 4NZ0A 3R2RA 1YV1A 1REVA 4IDKA 3QLHB 1S9EB 3N6NA 3ES3A 3KK1B 2CLBA 5KFKA 2OH2A 3PVRA 1TL1B 2JC1A 3KK3B 4TY8A 1JREA 1NNQA 4ZJKA 3MEEB 5KFNA 4IH5A 5D3GB 4NLRA 5KFRA 5D8PA 1N4LA 3N6LA 4PQUA 3H98A 3KA8A 1S0MA 3PWQC 4CMYV 4Y34A 1QGHA 1TJOA 1BQNA 4EO6A 1O9IA 3DI6A 1N48A 3IRXA 3BVIA 1S1TB 5KFDA 3OL6A 4Q43A 4Q0BB 4LYXA 4LPMA 1JLEB 2V2MA 2AGPA 5J2PA 1XZ3A 4CVTA 3MFIA 3MR6A 3NGDA 3UOFA 1S1UB 4FBUA 2B6AB 5F8LA 2V4RA 3T5HA 4ZHRB 3GIIA 3M9NB 3FQLA 1J30A 4O4RA 4TY9A 5CMRA 4ED8A 4Y08A 3T5JA 2GIQA 2CIHA 1XZ1A 1JIGA 4TW3A 1EETA 3H4BA 4WYWA 2ZA8A 4ECWA 2BJYA 3C6UA 5KFQA 2YKMB 1JLCA 5KG2A 2AQ4A 4ISPA 4IKAA 5J2NB 3PW5A 1ZUJA 3F38A 3KLIA 4YR2A 4RW8A 5KFZA 5KFFA 3O7RA 3M9OB 5KFLA 4IG0A 3PWFA 4ED0A 1JLBA 3PJXA 2OPPB 3MFHA 3QGGA 4Q8FA 1RT4B 1LW0B 3DLKA 4DYZA 1BQMA 1LWFB 2UVUA 2C41A 1RTIA 4K4YA 1OTKA 2IBKA 1RTDA 4K4WA 1IKWB 2W7OA 3T5KA 2QV6A 1RTHB 4ED2A 4DE6A 4YP3A 1DTQB 3H5XA 5HBMB 3PW1B 2D3ZA 4ZL5A 5I4JA 3OSPA 4WZMA 1VRUB 4EVCA 2BE2A 3MEGA 3V6KA 4PGIA 1JXLA 1H96A 1EP4B 4RC5A 3KHHA 5D8SA 3EZUA 3F32A 2AWZA 1JLAB 3BSCA 2V2SA 1TVRB 4ECXA 4R8UB 5DLFA 3PW8A 1LKPA 4XPEA 4DI0A 2BQRA 4I2PB 3C6TB 2OPSB 2R2SA 5DGBA 4KVSA 2WHOA 3PVTA 3KNAA 2ASLA 1RTJA 1HPZB 1J5OB 4O3QA 2CKWA 3HIUA 3EPIA 3I0SA 3KA9A 4DG1A 3IQ1A 3FDSA 2JD60 5DLGA 3Q8SB 3F35A 3PR4A 2IM3A 5CZUA 1TKZA 2OPRA 4IFVA 3RBEA 5DG9A 1RT6B 1RA7A 2B43A 4IDKB 2JEFA 1QYBA 4LPNA 4M34A 4ZL6A 4XKTA 4TY8B 3GV8B 4PQUB 2O5DA 2UX1A 4NLUA 3DYAA 4A25A 4RU9A 1RT2A 4MJYA 1OS5A 1BQNB 2V2JA 4AM2A 4NRUA 3E1NA 3LP1A 2IM0A 2GIRA 1SOFA 2ZE2A 3LAMA 5D8YA 4J9OA 1F33A 3DDKA 4NLDA 3OLAA 4EVBA 5J2PB 2C2DA 4PWDB 4MFBB 4RW6A 3UR0A 1L8HA 4XPCA 3CJ2A 1XR7A 2XKQA 4IRCA 3I5CA 3F33A 3BSAA 1LW2B 5T14A 1T03A 1MOJA 3DRRA 5D8XA 5KT3A 4I7FA 4ZKXA 4P18A 3EPGA 2XI3A 2WLAA 4M94A 3DRPB 4KB7A 3F39A 1SV5A 3KJVA 3GVYA 2W9CB 1C0UB 2WCXA 3TAMB 4J9SA 4KSEB 3NKYA 4F4WA 2B5JB 2UVVA 3R2HA 3KLIB 4RW8B 1IKVB 1IKXA 1SH3A 3RBDA 2WONA 3N6MA 4PUOA 3FFIB 2UVRA 3NMAA 1JI5A 3DLKB 1ZTTA 3O7SA 1BQMB 4O3RA 5JKMA 4MKUA 1RTIB 5JKLA 2YJKA 3Q4OA 4J9NA 1VLGA 3KK2B 1RTDB 1UMNA 3QB9A 1S4FA 3OHBA 5HJFA 2YKNA 3NAHA 1TKXB 3DRSA 4TOEA 4MUDA 1ZTWA 1JI4A 1SUQA 1RYTA 2VG6A 1LWCA 2BE2B 2YNGB 3BVLA 3MEGB 2F7NA 2V15A 5GOUA 4TLRA 2RDIA 2CEIA 4DYXA 3Q4NA 5HP1A 4TOGA 1TKTB 3BVEA 2ZKUA 4TXSA 4ICLA 2UUTA 1S1VA 1JLGB 1HYSA 2VG5A 3CVKA 5KFIA 3PVTB 4DYYA 2YNHB 2Z6MA 3KHRA 2ZA6A 4M32A 2CHIA 3LP0A 2CLUA 5I42A 2JEIA 1RTJB 1YVFA 3HVWA 5F9NA 4ED7A 5HLFA 3OGHA 3I0SB 3OL7A 4DG1B 3MTKA 4CYBA 5KT2A 4RW9A 1S0OA 1BFRA 4MK9A 5KG3A 1JGCA 5I3UA 3UQSA 1TKZB 4IFVB 1NHVA 1KRQA 4MKBA 3KWOA 3E01A 3RGDA 5CYMA 4F4XA 3A9QA 3T1AA 4RUAA 2FZFA 5FDLA 3DLEA 4LSLA 4ZTTA 1QE1A 5KFOA 2RDJA 2BQ3A 2YNIA 3DYAB 3PVYA 1IM4A 2ZD1B 1RT2B 5DG8A 2FG8A 3MEDB 1FKPB 4YQWA 3LP1B 2C2RA 1JKHA 4ITWA 4JUZA 4H4OB 3GQCA 5FFEA 1W25A 4B3OA 1KLMA 4ZVGA 3V6DB 3TVKA 3M9MB 4R0EA 4PG0A 4RW6B 3KLHB 3BKNA 1TV6A 4J9PA 4ZVHA 1MFRA 5LG8A 1D1UA 2WOMA 2JLEA 4WXWA 4GC7A 2Y3QA 4QWBA 2FL0A 3OJ5A 3DOLA 2J6TA 4TOBA 3E1PA 3VNXA 3V6JA 1SV5B 3KJVB 4WE1A 3DMJA 4ZVFA 5HQOA 1RT7B 2C22A 5L9XA 1RAJA 3HHKA 4EO8A 3E1QA 3QYYA 2WTFA 1N6QA 5GU2X 1S6PA 2WONB 1LKOA 4PUOB 1S3QA 2BK6A 3G6VA 5LBHA 2IC3A 4EBEA 3R2KA 2YNFA 5HJHA 4ZP9A 2R2RA 1TQLA 4U7CA 3QIPA 3CWJA 1HNVB 2I5JA 3H59A 3RAQA 4RC7A 4XGSA 3QD8A 4ZKWA 2ATLA 2FVPA 3HL1A 1U09A 2ZURX 2ILYA 1T3NA 1FK9A 3DRSB 1SUQB 1D0EA 1LWCB 5LG2A 3QGIA 4FS2A 4MY7A 3V6HA 3BQ1A 5KFUA 5EWEA 1TP7A 1JKVA 2V2OA 4K4ZA 1KHVA 4TODA 4ECTA 4ICLB 1S30A 4QWCA 1S1VB 2W9AA 1IERA 2WB4A 4EYIB 4Y3CA 3RAVA 3WVUA 1YUZA 3IGNA 5EUHA 4IH7A 5J9VA 4NYZA 4DASA 5F8IA 1NF4A 5HROA 5I42B 1TKPA 3RBCA 3RAXA 1ZETA 2FLLA 5C6FA 1HQEA 4E6KA 3PWQA 5J8WA 3QHCA 3RB6A 5D8OA 4G3IA 5I3UB 3TA8A 2QQYA 1UWBA 4RW7A 2HMIB 3H5SA 2AGOA 5KFMA 4LSNB 2R8KA 4YMEA 5KG0A 4TN2A 3T5LA 4R5PB 3ISFA 1VELA 1QE1B 1RT3A 5CYQA 3PVYB 2FVCA 2J6UA 2AU0A 4EBCA 5KG1A 3Q8QB 4ERUA 4XO0A 1JKHB 1TL3B 3G86A 1LWEA 3M8PA 3KLFA 2FHAA 1KLMB 3IS8A 5FFDA 2ITBA 3VQSA 1VRTA 2DPIA 1TV6B 5L1JA 3R2OA 3QO9A 2V9WA 4J9LA 4H54A 5GU3X 1LB3A 4K4TA 5KFPA 1R0AA 4IFYB 4Z5SA 2WOMB 2HNYA 3V4IA 4K4SA 3DLGA 2Z5QA 3HVTA 3CJ5A 1MU2A 3DM2A 3CJ3A 5C42A 3NBPA 1HRSA 4QUWA 5L1LA 4J9RA 1HQUA 4WFXA 3BVFA 4WE1B 2FVSA 3DMJB 1XR5A 1Z4UA 1BG7A 1DPSA 3M8QA 1S0NA 4MH8A 5IX6A 5DQHA 4RUCA 4LQNA 2HWHA 5J1EB 3QZ3A 5L1IA 4KVRA 4NLPA 2HNZA 2OH3A 4GC6A 5GU1X 4KHMA 1C1BA 2RKIA 5KFBA 2D41A 3QIPB 3JSMA 4X2BA 2R8IA 4O4GB 4QPXA 2XGWA 3QVDA 1REVB 2CF7A 2JD80 3PVRB 4DL3A 1C0TA 1FK9B 3CIZA 2C28A 4IRDA 1S9GA 2BRKA 4ECVA 1GWGA 1AEWA 1SQ3A 1RCGA 4TOAA 3R2SA 4CVPA 4NLVA 4KHRA 5KG6A 3QHBA 2PYBA 1B71A 5CMQA 1RDRA 4MK8A 3LALA 1T94A 3DI6B 2IJNA 3IRXB 2XGQA 1C1CA 4MIAA 1JX4A 3ITHA 3R2MA 1FKOA 2HAIA 5EWFA 4G1QA 5HROB 3BSOA 2RBDA 2FVQA 1HQEB 4AM4A 5KT4A 1IKYA 4NLWA 3U90A 4YKHA 5C25A 2XI2A 1HNIA 4IXKA 4RW4A 3ERZA 1EETB 5KFCA 2YW6A 1RT1A 3C6UB 3FQKA 1NF6A 1JLCB 5KFAA 3AF9X 4ED6A 3KMSA 1JLQA 3SFGA 2UVWA 1XR6A 4IG0B 5CYQB 1RCCA 3ISND 1JLBB 2FJWA 3KLVA 4TOHA 4QWDA 3AK8A 1Z6OM 2FJVA 1LKMA 4J9QA 1HMVA 3OSNA 4I2QA 4ISMA 2CN7A 5F8NA 4K50A 3CO9A 1T05A 4DYUA 1VRTB 2FJXA 2ZG8X 5KG4A 4URQU 4Q8EA 2VG7A 5DG7A 4QW8A 3I5AA 4QWAA 1R0AB 4J9MA 4KFBA 4ID5A 4RC5B 1MU2B 3KK1A 3DM2B 4II4A 5KFEA 5C42B 1TL1A 2E9TA 3MEEA 3BGRA 3NBPB 2W8LA 3PW7A 3FRZA 5KFVA 4ECRA 4LQJA 4TQRA 2ALZA 1NNDA 4U3GA 2R8GA 4Q45A 2OC5A 3UOIA 2YJJA 4OYNA
chains in the Genus database with same CATH superfamily
2BOAA 3R27A 5L39A 3KUHA 5JVHQ 4KPYA 1WC3A 1N54B 1CSJA 1QJHA 2FLPA 2J0XA 2MGZB 3HSZA 1S1TA 4Q0BA 4JI0J 4JP8A 2COLA 2XC9A 2CJBA 1SL2A 1N32F 1FA0A 1XTZA 1SJQA 1MMDA 3GIKA 3GJRB 2RB7A 1UJ5A 2ATCB 4Z37A 4DS4A 4JV5F 1D9FA 2M52A 1X0FA 1WKLA 1S97A 3QRQA 3JTOA 3A3NB 3ADAC 1YJUA 2ZFHA 2BJ3A 3OL9A 1RWWB 5C24A 3GIMA 3K17A 3EVOA 3T9JA 1S7HA 5C2CA 2ZZNA 1UA1A 2FKZA 4NRTA 1X4EA 5J2NA 3AA9A 2G4HA 5KG5A 2GVDA 4KVQA 3CXCR 4A8YA 5IV4A 3CDUA 3MAAA 3EZ0A 4QU7A 1D9DA 3KHKA 5J93A 5ETLA 3M1VB 1S1XA 5E0OA 3S8SA 2AD9A 1LWFA 5H9EK 1SQGA 1F9FA 1DVBA 1MSWD 4ML5A 3DRRB 3R6GB 4F04B 3QZ7A 1PJ5A 3PW1A 2HS3A 1M1GA 1FD2A 3BV8A 1NK0A 2HVZA 3O2IA 9ATCB 4NCGA 3MF5A 2QMWA 4F0MA 4O3OA 3KMQA 3HT3A 3H2UB 1UL3A 1N5VA 3E6RA 4PEOA 4RNHA 4E40A 4Y2MA 2W8KA 4ECUA 2XGPA 1HMVB 1PAUB 4I2QB 3UDLA 2XMTA 1YIJS 4LIWA 3GILA 1XBWA 4CVRA 4P2SA 1NDCA 1ICEB 1CQNA 2L08A 3J81U 1J5OA 1IESA 1VBZA 4F4ZA 2VG7B 3M8ZA 2MQLA 1UVHA 3BDEA 3PDNA 4UY85 1O9RA 4ZIVA 1RISA 2BABA 3BYRA 4ER8A 3OJUA 4DV5J 1RUSA 2V4QA 1U49A 3SHXA 3B78A 1JMTA 2MJNA 1ZS3A 4NLTA 2YH0A 4K59A 4YOEA 1FESA 3M2UA 2BQUA 3LP0B 3MM6A 2VZ9A 3AK9A 1WELA 4DPOA 4OYIA 4JI2F 1Z2ZA 4AYBD 4XK8C 2CWLA 3W63A 3M8SA 1HW9A 4CM0A 3MUMP 3BB5A 1JQGA 1UZHA 4KJIA 4NZ7A 2MJUA 4B3MF 3FKBA 3FVBA 1GMUA 2BJDA 5L1KA 4LRFA 2PMZD 3RE7A 5CYMB 1YTYA 1Q5VA 3R7NB 3JYTA 1CJTA 2VXIA 3FCWA 5FDLB 3MECA 1TFYA 3AF7X 3HHLC 2BV3A 4I1TA 2MB0B 1N52B 4ZVSB 5C24B 2YNIB 2RF2A 4DL6A 2UUCJ 2EFOA 4OYPA 1N1QA 1X4GA 3TZWA 2X3DA 1C0UA 3A8KA 2CPZA 3TAPA 2LQ5A 2R2UA 3GP9A 4BWMA 3SQOP 3P6YC 4OI6A 2GS4A 4KH0B 4RUBA 2MQQA 3TR5A 2OUGA 1ZPWX 4OFZA 3BGFA 3WIVA 2X51A 5KT6A 2BM0A 3MHYA 1LOUA 1S1XB 3SMZA 2DRBA 4WCEQ 1YSJA 2E1RA 3PHTA 4ECQA 1RWKB 2OP5A 4NLSA 1M1HA 2DNYA 2VH7A 3DOKA 1PCAA 2BX6A 3DOLB 2V34A 1JTSA 2I38A 2WAQD 4NCGB 5IOLA 3B6BA 2Z56B 3KA4A 1F9HA 1FEEA 2BJ1A 5DJBA 4BC7A 2AYGA 3QGHA 1GXUA 3JB9k 1TKTA 1HR0J 1S99A 2RHQB 2Z57B 4P7TA 4DPWA 3HKWA 3C1YA 1NK5A 1CULB 1Y0HA 1B70B 5CZVA 1VJXA 3Q8PB 2I5JB 2GAHC 3WVWA 1RKJA 2YKAA 3I56S 2JD70 3PX4A 2BR0A 1FT8A 2GO9A 4USJC 3R7SB 1QSYA 1QUPA 4LR7A 4KHPJ 1HKAA 1IVZA 1Z4AA 4H4MA 2IY4A 4QIEA 2C2ZB 1FVSA 1KNZA 1X5OA 2ZJRQ 5AE3A 2I1RA 4NLOA 2D3O1 3IFEA 3PEJA 2XBPA 3V4MA 2B7CB 1PSDA 4X64J 2HKEA 1SJ4P 1M5OC 1YK9A 3D1QA 5J2MA 2IRUA 3CDEA 3UD5A 2HGNA 1X9WA 2GQCA 2HHWA 1A0OB 2IJFA 1HBNA 3GCWP 3NOZX 2ASYA 3GIJA 4KRWA 4W4KB 1RKIA 2FLNA 2V8GA 4QYZK 3C66A 4FPIA 5E3AA 2HNDA 3G6XA 4CNYA 1GX5A 4PGKA 2BMBA 1F6TA 2ASDA 4FS1A 2C2KB 2MQ8A 2L9WA 3JYTB 1CJTB 3MECB 2ROPA 2V2NA 5KG7A 4EGLA 2RF2B 4NLXA 4U6PA 1RT7A 2MHNA 2VA3A 5ERKA 1T9WA 2J9DA 2ZNYA 5ETOA 2YW7A 4X4OA 5ERJA 3HKZD 4CDIA 2EKYA 1WHYA 4DV3F 2BJ8A 2IU2A 1OYEA 2AJ2A 2FC9A 2GVZA 2IMOA 4MT1A 3IWXA 2IY5B 4IR9A 1HNVA 2WSCC 5F8HA 3BKUA 3DLGB 1YITS 4IUFA 3DOKB 3DN9A 3UO0A 3KK3A 3OUYA 5D3GA 4KIAA 2XULA 3T1HJ 1F1BB 2M4MA 4JI5F 4K4UA 4USIA 5DM6Q 5EX0A 3BR8A 4EEYA 3SXLA 5KFSA 2BRLA 4HYKA 4FNHA 2EXUA 4Q44A 3GR0A 4ZVQB 1MN7A 1S7IA 4YEAA 1H2TZ 2YKQA 5K5MA 1A6LA 2GJIA 4LF6F 3TOQA 3HVAA 4CO5A 3JSMB 1R27B 3KG4A 3QT7A 2I0XA 4YFUA 2EG2A 3UDVA 2KFYA 2XJOA 1E6YA 3N01A 2K3IA 4CH0S 1FVQA 1NKCA 2MLZA 4H4MB 2CQGA 5RUBA 4DS5A 2HMIA 4X65J 1S49A 3MPSA 2GHWA 3BO2A 4CT8A 2YKMA 3B54A 4ZP8A 3GJQB 1XMOF 3OPKA 3GE4A 2KZZA 3CDAA 8ATCB 5LXYA 4A8XA 4OI2A 4CLFA 1R31A 1BHNA 2J7WA 3Q83A 2W2MP 2O67A 5J2MB 1FX2A 2OPPA 3LH2S 4KE5A 4G1QB 3C46A 1RK8A 3MPYA 1N34J 1XEZA 1TFWA 2GMJA 1HBNB 1NHUA 2W1BA 5KFGA 4K0KJ 1RABB 1TAUA 1IKWA 3VGUA 1K8AT 1DFDA 3ZZ0A 1HNIB 1JJ2R 2ZZTA 2HNDB 3CJQA 1U4BA 2GGPB 3NP2X 4JB8B 4TOCA 3VV9A 3D3BJ 5B0AA 2BVZA 1JWWA 3IR6B 4QIWD 2BKOA 2J76E 4TOFA 3WVVA 1R0BG 3QIDA 4IR1A 1TVRA 1I94J 2KDOA 1NFVA 4C2MA 4C9DA 1SH2A 3OJSA 3MM9A 2OPSA 4PR6A 2ZH4A 1FERA 2C42A 2I2YA 4PYAA 3KXUA 2F4VF 2Z2ZA 3J81Y 1Y11A 2VOPA 1SVDA 1OQ3A 3BVKA 3PZPA 3EVMA 3Q24A 1XIQA 3BQ0A 3HP6A 2GVZB 5KFXA 3GHQA 4AM5A 2C1EB 3FZBA 4LRDA 2ROGA 4RUHA 3R2RA 4OV1A 1HQ2A 4L3KA 4OQJA 4AXIA 2CLBA 5KFKA 1RWXB 2AT1B 1F3FA 1TL1B 2HAFA 4CQ1A 5GAEI 1UMJA 1JREA 3KK3B 5D3GB 1CG2A 4P72A 5D8PA 3N6LA 3A3PB 3D6FB 2RHSB 4WBFA 1WJ9A 2F63A 5L9NA 1TJOA 1XNRJ 3QATA 2DTJA 1SXLA 3DI6A 1N48A 3RYLA 5CQGA 3CUNA 4LF8J 2MZJA 3BVIA 4Q43A 1KN6A 4LPMA 3D2WA 4CVTA 3MFIA 2DVIA 3HXMA 2QA2A 4ENOA 4XTTA 2KT2A 2B6AB 5F8LA 2V4RA 3T5HA 4ZHRB 1YI2S 2KO1A 4UZBA 2ZM6F 4Y08A 2PE8A 3NEKA 4OHYA 5K8NA 2QC3A 1NK6A 2ZC4A 3MM8B 3CT9A 1EETA 3H4BA 2AW0A 3KFWX 4ECWA 2LXFA 2F9DA 3KWMA 4ID8A 5KFQA 2YKMB 2W4CA 1JLCA 2AQ4A 2XS7A 3PW5A 2U1AA 4NYPA 1NCLA 3OVBA 5KFZA 2QA4S 1NPKA 5KFFA 5SZTA 4ED0A 3L9ZA 3DLLQ 3TP2A 2OPPB 4GO7X 4K2JA 4Q8FA 2UVUA 2MQMA 2OD4A 1IKWB 2KFNA 2YWWA 2W7OA 1DTQB 3G8TA 4NEZA 1V3SA 2V69A 4Y6IA 3PFEA 3D66A 4G65A 1U1RA 4PGIA 1Y4ZB 1H96A 2HBZB 4HVZA 4WK3A 1P8GA 1TVRB 1HNXF 5A0YA 4R8UB 5LSRA 4DI0A 1VLOA 3MM9B 2OPSB 2XMWA 3LA0A 3SZ2A 1KD1T 3RJMB 5CA5A 1RTJA 3MM5B 1HPZB 5LSLA 2NXCA 1PJ6A 4HDHA 3HIUA 1UA0A 3I0SA 2Q66A 4J9VA 1DHMA 5DLGA 9RUBA 3T9ZA 5BYSA 2DCLA 1GAOA 3PR4A 2D9PA 1QVFR 4B9MA 2RAQA 3MCSA 3RBEA 2EWHA 7AT1B 2B56A 2VDHA 4M34A 3U27A 1VLYA 1TK5A 3ZZYA 3GV8B 1S6OA 3C16A 5G0RA 4X66J 1CEZA 2UX1A 3D6MB 3HM9A 4A25A 2H65B 1RT2A 2LXUA 3S01A 4MJYA 2CZVC 3AHPA 2VQEF 5HAOA 4WKYA 4IQMA 2V2JA 3FSYA 3E1NA 2IM0A 5GMDA 3D68A 5GAHU 3DDKA 4EVBA 3MD3A 2DITA 3RBXA 3P5BP 5GADI 3P5TL 4E98A 4XPCA 3CJ2A 3K2YA 1T7PA 1T03A 3AA8A 2VC0A 1I1GA 2ZHBA 4I7FA 4N77A 1RWVB 5IM0A 3EJMA 4BBYA 3EPGA 2DNQA 4D3HA 1NUEA 1IBMJ 4LFCF 3KJVA 1OJ4A 4FF2A 1X60A 2HQDA 5L8RC 3AB4B 5I3QA 2UVVA 2A3JA 3L09A 4DR5F 1H6KX 4ZVOB 1TUGB 3FFIB 1NJYA 2CRLA 4DU8A 1N32J 3N4WA 5MLCV 1ZTTA 2R7RA 4MKUA 2XMAA 3B4DA 2YJKA 3KK2B 1UMNA 5THWA 4JV5J 4LRCA 4B3TF 3UD4P 5F3ZA 2ERRA 1S4FA 3CMES 2CJKA 3DRSA 2VB6A 4MUDA 3QSIA 1SUQA 2VG6A 3PYFA 2R7WA 1C4AA 2YNGB 2M8HA 3A4TA 4OIXA 5HK4A 1OYDA 1SJ3P 5B0EA 5IWAF 3IBFB 2AYEA 3VAIA 3OBIA 3Q4NA 1N8RT 1FFGB 1U2CA 4TOGA 2V68A 5A0YB 3KYLA 3BVEA 2ZKUA 2ZH1A 3ZFVA 3G8SA 4ANCA 1HYSA 2XYGB 3CVKA 3IAM9 1SJ1A 4DYYA 4NA1A 3DLJA 3POTB 2Z6MA 4UUWA 4M32A 3QJLA 1RTJB 3NXZA 4DUZF 4ED7A 4CCHA 4P74A 3I0SB 2MSTA 4CYBA 5KT2A 3J7A1 4DN0A 1JGCA 5I3UA 2AEFA 4X62J 2F7VA 1UVIA 2OAUA 3T6BA 3BBFA 3RGDA 1G3OA 4LBHA 3T1AA 2FZFA 1CJUA 5G0RB 2IDLA 2FLOA 1TTHB 1QE1A 2RDJA 5D15A 2BQ3A 2ZD1B 1RT2B 1CPZA 2FG8A 1G2EA 3B4MA 4QIVA 3MEDB 2XZWA 4YQWA 3N5BA 4GVBA 1RHQB 1JKHA 1ZBTA 2QMUB 1Y3KA 4ZPTR 2XHWA 1F5BA 4H4OB 3GQCA 2DHAA 1W25A 4K2XA 4ZVGA 3WC2A 5CYJA 1ZA2B 3BGLA 4R0EA 4PXEA 3BKNA 3EDRB 4DV1J 2CPJA 3OXLA 2C3UA 4ZVHA 1ZZNA 2HZVA 5CD4H 3J7AN 1XK8A 4DR4F 1VOMA 3OJ5A 1FO1A 2J0QD 2G2ZA 1KDNA 3PACA 4UOCA 2J6TA 3E1PA 3KJVB 1R6VA 1HI8A 1S59A 1R8AA 3PKYA 5L9XA 3CC4S 1AZSB 2NZ4A 1YHQS 4EO8A 4XIUA 2WTFA 2RQKA 3IP0A 2NLWA 4JI2J 1N6QA 2YPZA 1X4AA 1XQIA 2IC3A 1ZAXA 1WOOA 4RX6A 4EBEA 2ZOFA 2V2QA 2YNFA 3JAMU 4PCQA 1TQLA 3QIPA 3QD8A 2WSEC 1RQ0A 3RRHA 1HI0P 4FVMA 2WVEA 1VHIA 3Q86A 2ILYA 1T3NA 3TX0A 3DRSB 4PKDB 1SUQB 3MPVA 4K7QA 1D0EA 2CQ1A 2QGFB 5LG2A 2HFNA 4DCPB 4N47A 1K9MT 3V6HA 3BQ1A 5GAGI 1OIAA 2R7QA 2V2OA 4K4ZA 4ZS6A 2QA4G 1S30A 2MY8A 3EX7B 2E7VA 2W9AA 2WB4A 3C15A 1H0HB 3WVUA 1F60B 5EN1A 4RKUC 2LEBA 4C0HA 4B17A 3RAXA 1D9AA 3RBCA 3VAFA 1ZETA 3NGTA 1GK8A 1FDAA 5J8WA 3RB6A 1Y5LB 4G3IA 5I3UB 3TA8A 2KG0A 1OPZA 1UWBA 4RW7A 2AGOA 2ZH7A 3L3CA 2QMXA 4LSNB 2H9ZA 2AZ1A 1P1LA 4USTA 4YMEA 2V6AA 3G71S 2VFVA 3M6XA 3K5MA 2IRYA 4TN2A 1CJUB 4R5PB 3W9HA 3MUTP 3PO5A 1QE1B 3F0NA 4KPCA 4F7VA 2J6UA 1A7GE 4ERUA 4GVBB 1JKHB 2C3YA 4K5RA 2L9NA 3G86A 2J9EA 3M8PA 4UZCA 2BXJA 1UJ4A 1K0TA 4OX7A 2ITBA 3Q0AA 1NK7A 2LECA 2OJ3A 2HHHF 5DS7A 1DQ9A 3JSYA 3KUGA 3R2OA 2V9WA 4YHHJ 4J9LA 3CCJS 1SKRA 5KFPA 2XHCA 3HVTA 3CJ5A 4I4BA 2UU9J 3VAMA 5C42A 4J90A 3O8WA 5K8OA 1U45A 3M6VA 3NBPA 1HRSA 2ACYA 5L1LA 1TAQA 3Q8VA 4P52A 4J9RA 1HQUA 2FVSA 1F5AA 3HX9A 1U1KA 1JNZB 1FTCA 4M5KA 1Z4UA 2RS2A 4JYAJ 4WJBA 4YB7A 2MPUA 4CNZA 2N4CA 4LQNA 3TEGA 2IVMA 5J1EB 5L1IA 2OH3A 5F3TA 4KHMA 3UNYA 1P9QC 2FDNA 3M6JA 3QIPB 2Y8YA 2QA1A 2XGWA 4XAKA 1KTVA 3PRVA 3M2RB 2CF7A 3OQ2A 2W24A 3PVRB 4DL3A 3UDEA 2XM3A 4WK1A 1SQ3A 3RR8A 1RCGA 1AW0A 2OSRA 4KH1B 5KG6A 4DR6J 3QHBA 5CMQA 3LALA 4QR0A 1FEHA 3DDIA 3GG1A 4FF3A 2IJNA 1YRXA 3I87A 3M30A 1BD6A 1H72C 3U1MA 1C1CA 4DV3J 3ITHA 4F0KA 2ZH6A 2NSBA 3R2MA 4QOTA 4DFMA 2BEFA 5LMUJ 4USKA 2M9KA 3MURP 1WDDA 4C6AA 3BZQA 3W2WB 3OFGA 2B7BB 3U90A 3Q2TC 3KXDA 1RAIB 4YKHA 2XI2A 1MROB 4E0DA 4RW4A 3ERZA 1QAXA 4UOGA 4JI5J 1U25A 4C3LA 2YW6A 3MXHP 4W92B 3C6UB 2RSQA 1UEUA 1FFSB 4L76A 2HFZA 3AF9X 4ED6A 3X3UA 3K59A 1X4FA 3CJ8A 4IG0B 3ISND 1JLBB 3SV4A 2CQ3A 3ENVA 2FHOB 4ZCMA 3K5PA 3N6OA 1Z6OM 1VS3A 2FJVA 4J9QA 2DY1A 1HHQA 3OSNA 3A1YG 3BO4A 2Y44A 2CN7A 1WORA 4C97A 2NQPA 5F8NA 2DR5A 3HD2A 4MJKA 5KG4A 3KG0A 4KXRB 3VCDA 2LQBA 4AL7A 1VDHA 2A6OA 3I5AA 4QWAA 4J9MA 2FGOA 3AFGA 3FUYA 5HMXA 4DL0C 4RC5B 5D0EA 2L9DA 1VQMS 2ROEA 5C42B 4LF9J 2E9TA 3MEEA 3NBPB 3G87A 3K5LA 1B7FA 2ALZA 1T9XA 1EAYC 2UXDF 1R6YA 1X9SA 2HRYA 3NRBA 3GSDA 4O44A 3W61A 5A8RA 4QBUA 1UVKA 4B9LA 2A1BA 3BM7A 3TNVA 4AL6A 2XS5A 2XTJP 2QEXS 4P71A 2HHXA 4OYOA 5LMNJ 2AX1A 1TZ0A 1FHAA 4M5NA 1JIHA 4EZ9A 1S1UA 2R7SA 1U7LA 4USMA 3T1YF 3H7HB 4JV1A 3RB0A 3BQ2A 1CC7A 1JKUA 2JHEA 2VKRA 1N5YA 1OSCA 3CCSS 3WDOA 2XNRA 4OL8A 2QF9A 5LS9A 2MKKA 3MR2A 4ZVTB 1VQ8S 2ZJPQ 3SCIE 2PFFB 4C8KA 3F44A 1QLNA 2KL8A 2ZE2B 3ZTPA 4NOHA 2UXBF 2QX0A 3OD2A 2ZJQQ 2C2JA 2DHSA 1BY9A 3Q22A 3M30B 3OR1B 5DQIA 3EGZA 1TMJA 3TZYA 4PRFA 2RVJA 1RT4A 1AFIA 2EPIA 2LQ9A 3H20A 4PG5A 1Q16B 4RJVA 3QWUA 3OVSA 3RBZA 2AZ3A 5EWGA 5LM7E 3F36A 1WC4A 2EEYA 4YY3F 4CO4A 3HVRA 2EC0A 1KP6A 4LYUA 4LRAA 4IG3A 4OZ3A 2GHVC 3UN2A 2V8VA 3IR7B 4DV7F 2OFHX 4JI8F 1VRUA 3ZZZA 5B0FA 5EDWA 1LK7A 5KFWA 1YG0A 1UKUA 1EP4A 4QW9A 3ENAA 1IKXB 6FD1A 1VQYA 5DDRC 4TLQA 1JLAA 4CLKA 1TKOA 2GV1A 2Q6BA 4I56A 4I2PA 1RWPB 1RCEA 3JAMY 4ZLPA 5F0WA 5F9LA 1WHXA 1WACA 2L48A 4DQSA 4F50A 4LVOP 3D3CJ 3H2VE 2B4PA 4ETRA 3TAQA 2WK4A 2X170 5C5JA 3GONA 1WI6A 2YKNB 4U8VA 2OPQA 3KNGA 4B02A 4LQVA 4ECYA 4FZVA 1U8SA 1RU1A 1F2HA 3MEKA 4S0MA 2E1PA 3QZ8A 1U1OA 4X84A 4Y2IA 3TVYA 3ZC4A 1D8YA 3UFBA 4ED5A 2HZAA 2VG5B 3R2DJ 4NMXA 2WVDA 3IC1A 3H40A 4O44B 5A8RB 2M0GB 3SCKE 5J1PA 1ITPA 2E5LJ 4DOZA 2RUSA 5AXSA 1YKWA 4CZCA 4LPJA 5FFAA 2DH8A 5HLFB 1H73A 2H5JB 2XMVA 3TA1A 4CO3A 4PWDA 4I6AA 3C19A 1ELOA 2W2PP 1YJTA 2DNHA 4EWTA 3EICA 2PO4A 1U02A 3UE2A 4JI3F 1DTTA 4DV4F 4UUXA 1N5YB 1KBRA 3DLEB 3BF4A 4ZVEA 3BT5A 5HO4A 1N5TA 3DRPA 1FRIA 3QPIA 2GQ2A 5J2QA 3OLBA 3TAMA 3DRYA 5HQLA 4OHVA 2B5JA 4FXVA 4ZPDA 4KAIA 3KLGA 1IKVA 2ZBPA 1QAIA 1VEIA 2JVOA 2DNLA 2KXFA 3PO4A 3RW7A 5JXSA 3OTBA 1RJJA 3SBMA 2YX1A 3IA0A 1J5EF 3PW4A 4TU7A 3NS6A 4M63A 1K44A 3TQ1A 1R03A 1QUVA 4DR2J 4IG3B 4OZJA 4CLZA 3PJWA 2BBEA 1IBKF 4OI3A 1VK8A 1FXRA 2FY8A 3V2UC 5D4OA 3FSEA 3EM1A 3ZNUA 4C8NA 2ZDPA 2QSWA 1N0VC 4CT9A 1FWPA 1WTBA 3AOCA 2K3KA 2RRAA 3H5UA 1NM2A 5F8MA 4CTAB 4FXWA 4OI0A 3E2CA 3CMQA 2R8JA 4B9NA 2XZDB 2A18A 2YNHA 1VQLS 3U7JA 4IWJA 2CJXB 2Z90A 3ILJA 2CNOB 4RNOA 1OY8A 3UCZP 4ZCIA 5AJ3J 2OPQB 5A8KA 2B3TB 2FPHX 2VFSA 2NUUG 1QAYA 3OT9A 1TL5A 1FRKA 2BJEA 2GYDA 4DR7F 1PBUA 3TUIC 3RUBL 4DR5J 3NMRA 3CSKA 1WI8A 2EVZA 2ZC3A 4DX6A 3T41A 2CWXA 5ETNA 3I9ZA 2DNOA 1F3VA 3WBZA 4YR0A 4RNMA 3Q8RB 1XJWB 1IR1A 1RBOB 3C14B 1REGX 4Y2KA 2LCWA 2KFZA 4WTOB 2F65A 4WZQA 5E2QA 1A9NB 3KLHA 1KTQA 4DLEA 2R7OA 4M5LA 4QYRA 4ES2A 3LAKA 4RC6A 2GCFA 1DTTB 1AROP 2IRXA 3JZAB 2KYXA 1F0XA 3EGNA 2VPZB 3KHLA 3KX9A 2HFOA 4Z3BA 5J2QB 4DSFA 2X7IA 3L0MA 1HBOA 2HFSA 3KLGB 1LWEB 4USWA 1GNKA 4O3SA 3EDQB 5D8RA 3KLFB 2NPFA 2VASA 3F56A 1PIEA 2BKCA 3OVAA 5CHCB 4MKAA 2AHOB 3LGNA 4CLYA 1KR4A 4OZ2A 3QAEA 4WYLA 2QLXA 4M5JA 5FFCA 3WX8A 3MR3A 1IJFB 4PQAA 3AODA 3D67A 1SC1B 3BYPA 5JMNA 4N8NA 2ILZA 1FTRA 3DGPA 2PDAA 4I64A 1Q95G 3NL0A 5K8MA 2YQ0A 4U8YA 2YWKA 2YXLA 4X4SA 3HDSA 1CJVA 4M5HA 4DEZA 2LA6A 3CJTA 3WC0A 2VF3A 1DRZA 1C1BB 4DI6A 2RKIB 1EQMA 3KA3A 2V8TA 1I5OB 4EVDA 3EVWA 3N28A 4ZMMA 1R8PA 2G38B 4USUA 3IM8A 2LU1A 5A8KB 4PPZA 2BW2A 2KYZA 4DFKA 2DNKA 2KU7A 2VXXA 3FEZA 1WOPA 2WW8A 3DU6A 3WQPA 1QTMA 4PG8A 3MR5A 1HBMB 3DOMB 1RHRB 2YKPA 2LU2A 2E5HA 5D0RA 5KAKA 4LJMA 3S6EA 4ZP7A 2P9CA 2MKSA 1LW0A 3PHEA 2XJNA 2NYHA 2P6SA 3SSQA 4KC5A 4DQRA 1CBKA 2DCUB 1HNZF 3F34A 1Q81T 4MYUA 4EYHB 4WU2A 3Q2SC 2WW4A 3SDEA 4DL5A 2W2QP 4RC6B 4OZ1A 1HNWF 4C8OA 4IFYA 3VZIA 2FGCA 1EKRA 4LFAF 2QO3A 3DU5A 3RTVA 1BWVA 1C4CA 4RNFA 3PYGA 2ZUAA 4C8ZA 3BGUA 2XS2A 3H90A 2H51B 1HBOB 1Y5IB 1IR2A 2ZH9A 3B82A 1RE1B 5FFBA 2XWXA 2RIJA 4ZJQA 5CAAA 4ECZA 4V19X 1S9FA 1Q79A 1HARA 2NR0A 1NKEA 4CYAA 5A6PA 5K53A 2UUBF 4M1KA 3ZTOA 2C2UA 5FD1A 1KVKA 4RZRA 2HWIA 4EK2A 2CQPA 4O4GA 4KFBB 1NEEA 2CA9A 5ETPA 5ITHA 4IDKA 1EHWA 1YDLA 3KK1B 2OH2A 4C11A 3I32A 4C48A 3I96A 1NNQA 4NLRA 5KFRA 4EI2A 1N4LA 3G9CA 3DGPB 2C3MA 4LBPA 3HF5A 3JZ9A 4CMYV 4NPOA 1O9IA 1CJVB 3IRXA 3AD7C 3OL6A 5KFDA 3HMJG 2HHHJ 1SCJB 2V2MA 5GMEA 5J2PA 1VBYA 2HQCA 4FYVB 3UOFA 1Q4RA 3PIPQ 2QL7B 3QJJA 3GIIA 3FQLA 2OMLA 5CMRA 4ED8A 3UWTA 2FJEB 3VQTA 2DR9A 4F8RA 2ZH3A 3J7ZT 5D0GA 4PAAA 1BGXT 1N88A 2VBWA 5EGYA 1VQ9S 1EX8A 3ZZPA 3QT6A 4FKYA 4IKAA 3SCLE 3F38A 2AEMA 2D3OR 3I4HX 2EKNA 1HI1A 1Y00A 4X4VA 1LXJA 4ELTA 1LW0B 3K89A 5CH7B 4DYZA 1KS2A 3BKTA 2C41A 1NSAA 4NEYA 4K4YA 2RD5C 3KJFB 1IQTA 2IYGA 4TNOA 2OD6A 4YDXA 3HHEA 2RQMA 4PXDA 4YP3A 4ED2A 4LF1A 3H5XA 4E8UA 1NSQA 2D3ZA 2PMHA 2ZKTA 4RBTA 4WZMA 4RR5A 4A8WA 2DRAA 2VBYA 3L7PA 2LQ8A 1U47A 2VPWB 3TA0A 3V6KA 3W3SA 1SQEA 3EZUA 2AWZA 2FJBB 1LNQA 1WF2A 4ECXA 3PW8A 5M2RA 4IO1A 3PYDA 3C6TB 1V6HA 2R2SA 1AYEA 4OX8A 5B7WA 2PN6A 3PVTA 1WG1A 2DNZA 4ED4A 3RAMA 4DJBA 4WJG4 3AY0A 1OO0B 2CJYB 1QDUB 3DFEA 2CKWA 3K8WA 2QFIA 2JD60 3ULHA 3FNNA 5CZUA 4LF5F 1RT6B 2CZ4A 4IDKB 4F0HA 1QYBA 3D1HA 3OTOF 1RGVA 2KM8B 4LPNA 2F40A 4C11B 3RR7A 4XKTA 4USHA 3PRBA 1N36F 4NLUA 3DYAA 2Y1RI 1U1QA 2JLFA 2CYYA 1O6XA 3LP1A 2GIRA 2RS8A 2M5YA 2KHCA 1S79A 3CCRS 4NLDA 3OLAA 5ETRA 3FBFA 5J2PB 4MFBB 2D9OA 2H4WB 4HI1A 1GH8A 3UR0A 1KLNA 4FYYB 2R9LA 2HS4A 3BSAA 4OV6A 1LW2B 3R5DA 2ZEJA 2G0CA 5D8XA 2XSJA 3DRRA 3PNIA 3AQPA 3VF0B 1FRJA 4KB7A 2ZH8A 1CQMA 1SV5A 2M70A 5IT4A 2UXDJ 4P7VA 2W9CB 2WCXA 1KKHA 2OEMA 4J9SA 4KSEB 4F4WA 3HULA 2Y9HA 4NXMF 4P10A 5HJYA 3PFOA 4DR1F 1SH3A 3H42A 2OI2A 2CPYA 4A4JA 4LFBF 1QM9A 1AUDA 2C3OA 2V8PA 2X3GA 2ZOMA 3LTOA 4C0OC 4NXNJ 4ZN1A 4O3RA 5JKMA 2HGMA 3W65A 2HLTA 5JKLA 3Q4OA 3CCWA 4OX9F 3QB9A 4GRSA 2GA7A 1WSVA 2QG9B 3NAHA 1TKXB 4TOEA 3MM7A 3IO1A 2PC6A 3ETMA 3BVLA 2LDIA 3AD9C 4B3RJ 4U7UD 2LLZA 2JFDA 3H8YA 4F3MA 4DYXA 4CLWA 3US5A 2X1AA 4ICLA 2UUTA 2KXNB 1G1XA 2XY5A 1JLGB 3OV7A 5KFIA 3PVTB 1VR6A 2ZOGA 3KHRA 2ZA6A 2FHKA 2CHIA 3LP0A 4G1IA 4Q2MA 2R7UA 3DKDA 1YVFA 3GYXB 5F9NA 4ILLA 2LP4A 4AQYF 3FMWA 4KGZB 5HQ8A 5KG3A 3HFVA 4DV7J 1XNQJ 2IYIA 1RCXB 4G6VB 4HTJA 3KWOA 2E7WA 2CPXA 2APOA 3UFCX 5CYMA 3KDNA 2HRTA 2EG1A 2FHMA 4HLBA 4RUAA 1K0VA 4DV0F 5FDLA 2XLKA 1UVNA 4ZTTA 2YNIA 3DYAB 2MQNA 2V50A 5FLXU 1FKPB 2PGCA 3LP1B 4OYXA 1WUUA 2EBGA 3MZIA 4JUZA 4UTGA 1FKAF 3V6DB 3M9MB 2IVYA 4FYXB 4OLOA 1TV6A 4J9PA 4C3MA 4ETZA 2QJ3A 1VYAA 1D1UA 4CWBA 2DNGA 2NXJA 3M4XA 3MCOA 5IFMA 2OTJS 2XSJB 4GC7A 3GFHA 2VONA 2NXNA 3DOLA 4TOBA 3UR3C 3V6JA 1SV5B 2YQ3A 3KJQB 4FPRA 3W9IA 4ZVFA 5HQOA 2Z8QA 3HHKA 1E6VB 3U1NA 2R7VA 1S3QA 2PA8D 4KGMA 4UY8T 3RW6A 1T0TV 1KFSA 3GMGA 2DEIA 4CLLA 3GLJA 2YQ1A 3UVJB 1HWIA 5HJHA 4C8YA 2DT9A 4KQZA 2R2RA 1B3TA 1CULA 2V4JA 2DHXA 2I5JA 3H59A 4XGSA 4DV4J 2ATLA 2N82B 3CCTA 1VQSA 2FYXA 1U09A 3MM7B 4NWBA 1FJEB 2E66A 2YWHA 3HHDA 2B8PA 5HVGA 5KFUA 5EWEA 4F4KA 2O3DA 2XEXA 1TP7A 3QNWB 3DHWC 4A8MP 4ICLB 1NDLA 2Y0SD 1IERA 1U1NA 1RP5A 3RAVA 1HA1A 1Q8BA 2WSFC 5EUHA 4IH7A 5J9VA 1Y9OA 3UW1A 3VZHA 1OMSA 3QHCA 2CQBA 2FTRA 4MKYA 5D8OA 4OHZA 3NGRA 3CF5Q 3TANA 2QQYA 1TUVA 4WPAA 3TUPA 3A8JA 3H5SA 3QSYB 3CD7A 2R8KA 2YH1A 4NL5A 4UF4A 2OMOA 4WP3A 3R1HA 1WG4A 1NPRA 1VELA 2DKOB 3GFZA 1Y3JA 5CYQA 2HG4A 2CWKA 5KG1A 3Q8QB 2FJDB 5GAEU 4M8LA 1TL3B 4F26A 5C7PA 1FRMA 1G6BA 3BEGB 4CM2A 1HL6A 2KVIA 3QGPA 4C98A 3GJSB 1TV6B 5L1JA 1I3OB 4HHUA 2HFVA 4LR9A 4AUKA 1QSSA 4H54A 4ZK7M 5GU3X 4BCAA 1R0AA 7FDRA 3G8QA 3DLGA 2Z5QA 3RG6A 3DM2A 2WVFA 3CJ3A 2FJAB 4TU8A 3ILOA 3O3LA 2E5GA 1JB0C 1XR5A 3X1LB 1BG7A 2A10A 1VC5A 1S0NA 4YDDB 1DJ0A 1NSKL 2QYCA 4FN5A 3QZ3A 1Y10A 4NLPA 2CDQA 4GC6A 5GU1X 5K9FA 2LA4A 2V4JB 3JSMA 4X2BA 4DZ6A 1F9EB 3ZTRA 1REVB 2PA3A 2H54B 4IRDA 1O8BA 1S9GA 4ECVA 2GAGC 1AEWA 3LUYA 3PXGa 4WF9Q 1UETA 3R2SA 1TELA 2QLBB 4NLVA 4X4TA 5DDQC 2SXLA 4ZCKA 3C2PA 1T94A 1W2BR 4WIIA 3CULA 3GIRA 1HIYA 1IBLJ 5D77A 1KFDA 1RLCL 2XGQA 1Y5NB 1HR0F 4BHQA 4MIAA 3DRXA 1YWXA 3D6HB 1RBLA 2QLWA 1FKOA 4G1QA 3A3OB 4DBQA 3BSOA 1Z2LA 1ZM4A 1TL4A 2C2MB 5KT4A 3GCXP 2EFNA 5C25A 3R5JB 1HNIA 3R2CJ 1MWZA 3W60A 3D54A 1SI9A 3OTDA 2GGPA 3SYZA 4QPTA 4G1PA 1RT1A 3FQKA 1TKDA 1YJ7A 3KMSA 1JLQA 2DK2A 4X4RA 1XR6A 5CYQB 4X64F 3TJ9A 1FWLA 2IBOA 5I3PA 3TI0A 1VQ5S 2FJWA 3HHLB 4PPDA 4TOHA 1IXKA 3AK8A 3HZEA 2XLJA 1LKMA 5T41A 1IBCB 1UZDA 4DXLA 4K50A 3KTQA 3HZGA 1KVIA 2FJXA 2AJ4A 2PEBA 4ZPWR 1NPPA 4ETXA 1LXNA 3VGVA 1R0AB 2HHUA 4ID5A 3O6QA 1AUSL 3CCQS 4ZVPB 4ELUA 4NI2A 3NS7B 2CVEA 2AV5A 3DM2B 2GFFA 5GADU 1RAHB 1TL1A 3BGRA 3VR1A 1X5PA 2W8LA 1UVMA 5JDOB 4MYTA 3Q8UA 2ABYA 4OHXA 3CE8A 1NNDA 1KRPA 2FD2A 2JDJA 2G2OA 5U47A 2BE7D 4CY9A 1HBUA 4ZPAA 4LF4J 2WTLA 1HNZJ 4CVSA 5DZ7A 2N3LA 3LO3A 2W7PA 1CS4A 2PEHA 2RNEA 4PG1A 2K2PA 2X1GA 4OMFG 2OPRB 4DFPA 2B9EA 1HWJA 3E1OA 4KGXB 2B6AA 2WRMA 4ZHRA 1JJCB 4KKOA 1JLFA 4ZLWA 4LFAJ 3NP0X 4TO9A 1UTAA 3JXOA 1VK3A 1S9GB 2FUG9 3WIUA 4J9KA 3K0JA 5BXIA 3PR5B 1YBAA 3MM8A 3JS9A 2LDYA 2YKOA 5FLXY 4AT1B 1NJWA 2CQCA 2G1DA 4TVAB 4IQXA 2B9WA 2CDRB 5B0GA 2Y1JA 1VQKS 2HIYA 2OEKA 4Q5VA 3DLBA 1X4DA 2W0OA 2VOOA 2HHSA 5FIIA 4Y2CA 3E6SA 2UUBJ 1FKOB 3L7UA 3KKFA 2HBQB 3DBYA 2BA9A 3W66A 2CNKB 2W9BA 4FDFA 1R0CB 4RO0A 2JOQA 2G0IA 5C25B 1DTQA 1KONA 1M0SA 3UPFA 2ZG9X 3H7GA 3BS9A 1ZM2A 3FK4A 4X65F 1RT1B 3T19A 3I55S 1JLQB 2IB0A 3R5BA 1RAOA 4AXJA 3P8BB 1ROFA 3BO3A 4Y2AA 1O0PA 3MD1A 5JACA 5BR8F 4R8UA 4MK7A 3KLEA 4N7TA 3CJ0A 3RRGA 4Y00A 2ZA7A 3R5AA 2D69A 4ITTA 3DLHA 3CD6S 2KM8C 1BXNA 1RHMB 2AX0A 3VHQA 3MM5A 1HPZA 1W2IA 1S12A 1EUMA 4K0KF 2WWXB 1UWAA 1X7VA 3HHLD 2E9RX 5E1UA 3BJYA 2Y0BB 2BZ2A 2A2DA 4KO0A 4ID5B 2MZRA 2M3DA 2VD3A 2NZCA 4NI2B 1KQSR 5KT7A 3W7BA 2XMUA 4YXJA 1FRHA 3FRYA 5HP1B 3BGRB 4MTPA 3RB3A 2P2CB 4ZITA 3SIDA 4P2XA 3SFUA 3FSIA 4DV6J 4F4YA 1I94F 2DGWA 5B0CA 4EMDA 4W4MA 5ETKA 2DNPA 2HFUA 2J8SA 4WU3A 1HBUB 3CJ4A 3HCXA 2QN6B 1WEYA 4KV8A 1RCIA 3CCES 2JEGA 4RW9B 1CS4B 3GG0A 3JQJA 2DR6A 1UEVA 2G13A 2F9JA 2HR5A 1VC6A 2FZKB 2IAJA 2I6WA 3E01B 5JUMA 1NRKA 4IYQA 3ISZA 4KKOB 1KHWA 3FJ2A 1JLFB 4RNNA 1RHJB 2MXYA 4LSLB 1YGYA 3PZAA 4DL7A 1PKUA 2AIRB 4P2FA 3Q8YA 4AL5A 3BSNA 3J7Z5 5LJ5Y 3J81j 4CMYA 2G9OA 2CNLB 1XNRF 4QCLA 1JK9B 1ZOTA 3W62A 4XDDA 3IN5A 4B3OB 5GAGU 4ZCLA 3AB2B 4LF8F 1FNOA 2MKCA 3FFIA 2ZHAA 2UUAJ 2MKHA 4V1Ak 1SKWA 5JJBA 3EYZA 3EGVA 5J8SA 3FBEA 2W9BB 1XMQJ 2KT3A 3KK2A 3M05A 3PW8C 3CD5A 4OYWA 1UP1A 3NGKA 2DGXA 4ZMCA 4FYWB 5DO2A 5KFJA 3GYNA 2F5GA 2YNGA 2GX8A 3RB4A 4A48A 2CADA 2VBXA 2XMJA 1JYBA 4QR2A 1GXTA 1X5TA 1S6PB 3ENQA 3E1JA 4ED3A 1RAAB 3KLEB 3QQCD 4YN3B 2XWYA 4F2RA 2YPYA 4QIGA 3BBBA 3W9JA 4Z2XA 3POTA 1Q1KA 4K8RA 2UP1A 4C8MA 1BCFA 4RC7B 3DCAA 2DR8A 1YBUA 2J7UA 2RMLA 3AOAA 1RCDA 1MG7A 4UQTA 4EVEA 3A68A 2F3JA 3VAKA 5KOXA 4KO0B 2CZ9A 5A2QU 1TK6A 2N4DA 3P45B 4DR1J 4WFBQ 1LQ9A 3KDOA 1L8IA 2UXCJ 1U1PA 3QBCA 2C2FA 3ISEA 4URGA 2GO8A 4KGKA 2ZD1A 4RL1A 2GQQA 5ADZA 2X1BA 2JEJA 5LL6d 4KT0C 1NHKL 3MEDA 4KV8B 3C23A 2DHGA 4B3SJ 4NLQA 1K1QA 3SQGA 4O0NA 4H4OA 4GO5X 3PX6A 4JI7J 3SI8A 4WFZA 4CH7A 4PYDA 2A6MA 1JJ4A 2IAJB 4PG6A 1WOSA 2FZCB 4PZVA 2UUWA 1NJIT 2HTNA 3QWPA 2CPEA 1D3WA 3D4JA 3QAUA 4LIRA 1RT5A 3NNCA 1RT3B 2QYGA 2VIHA 3KHGA 3VTIA 3UNOA 3CD0A 4X66F 2N02A 5E2DA 1FI4A 2XYPB 3F37A 5KTQA 1AZSA 4DZ0A 1NSPA 5B08A 1N0UA 5IQQA 4QWEA 4AQYJ 2UZAA 4ED1A 1QSLA 3QO9B 1GMWA 3N79A 2W25A 3R3TA 3V81A 2HVEA 1RACB 2HNYB 5D8QA 3V4IB 1DBDA 4DR3F 1L5UA 4K4XA 3QLHA 1AFJA 3GGYA 5AT1B 1YLXA 4RWXA 5D4NA 2R2TA 4K5SA 1CJKB 1Z6OA 5E3QA 2PD1A 1IBMF 2HVIA 1S2ZA 1MLAA 4UOFA 5H1SV 4RC8A 4DQPA 4O3NA 3D5MA 2ZVIA 5D78A 1R7IA 1X4HA 2HNZB 1JLEA 3JTPA 2IIHA 2XCPA 3GZ7A 3E51A 2AMCB 3DHXA 4R42A 4N41A 4LF7F 4NMLA 2ASJA 1T3OA 3CCVS 2DGUA 1YZ7A 1L3SA 1F2GA 3K7RA 2J6SA 5JKMG 1RYSA 1YBTA 5JKLG 4CYUB 2XZTB 4YB6A 4LQ9A 4LSNA 3NWGA 2XSFA 4DSJA 3F41A 4L75A 2RRBA 3J7YI 2XCAA 2WVCA 2BACA 4R5PA 4DSIA 2VFRA 1GQEA 3H4DA 5FEJA 1N5QA 3T9NA 2EFVA 5E3CA 3VAJA 2XO6A 3RZAA 3D0GE 1MMLA 3OHAA 3BH6B 3SH6A 1S10A 2CIMA 1CVJA 5GU0X 3TX8A 3SQGB 2JFKA 4LQ3A 4FBTA 1K1SA 2CPHA 3GE9A 3ETOA 1TR0A 4M33A 3AJQA 4JV0A 3FMBA 3DXBA 3GV5B 4L74A 4OHWA 5HBMA 1GT8A 2AYBA 1X8DA 3EWGA 4X62F 2R7XA 5KFHA 1UCNA 2ZWPA 3I5BA 4JI4F 4B9SA 3SSSA 1RT5B 3OXFA 1UPPA 3WHIA 2HK2A 2PFDA 2ZG7X 3NLCA 2V2LA 2Q1LA 2MMYA 2Z2YB 4O3PA 3ZTSA 3E1MA 4MAKA 2PIIA 1NK8A 5DETA 1YUXA 4DWIA 4M95A 3OR2B 1U24A 4DQQA 1DARA 3S1TA 1T05B 3KDQA 1WTFA 3G6YA 1F5CA 4ATNA 4Y0FA 1N56A 5J1EA 1V5VA 3MGJA 1WKKA 4B3MJ 2V2IA 4DV1F 3MMBA 3V81B 4URSA 4X0JA 2DPJA 4NZ0A 1V9OA 1YV1A 4JI6F 3K5NA 3QLHB 4UOHA 3M2RA 1PC4A 3PVRA 1SL0A 3UCUP 4TY8A 4ZJKA 5D8HB 3MWBA 1QVGR 2B9XA 2YVSA 3M8WA 3VALA 3H98A 3KA8A 1S0MA 4OZ5A 4CLSA 1I51B 3QT8A 3JTNA 3HSDA 2C3PA 4EO6A 1XWLA 1BC6A 1NDKA 1ZA1B 3A12A 1U0HA 1S1TB 2CQHA 4ZLJA 1VIOA 4Q0BB 4CI0B 4LYXA 2JSXA 1JLEB 2V67A 4PXBA 3MR6A 3NGDA 5DDPC 1JNRB 4MKVA 4BS2A 1H2VZ 2DRDA 5G4DA 1KVJA 1PBAA 3HFZB 5CZXA 1J30A 1YX2A 3MMCA 3W2WA 3T5JA 2CIHA 1MROA 2KHDA 3IAS9 4DV2F 1VISA 4PWWA 4ZIWA 2R7TA 4WYWA 2ZA8A 2BJYA 3C6UA 2RQCA 2CQ4A 2JL9A 5KG2A 2CJ9A 5J2NB 1ZUJA 3KLIA 4YR2A 2ZH2A 2RILA 5C2GA 2CG4A 2GVDB 4IG0A 5KFLA 1FRLA 5JVGQ 2G4BA 1JLBA 3PJXA 4M5MA 3I82A 3K5OA 3MFHA 1ZM9A 2EI5A 3QGGA 2KTQA 2PT0A 4HTIA 5B0DA 1H7XA 3MAAB 3M8YA 3DLKA 3R5GA 3HD1A 1BQMA 1LWFB 1RTIA 1OTKA 2IBKA 1WEZA 3T5KA 1VQPS 4DZDA 4MIWA 4J7CA 1HD1A 4DE6A 1UFLA 3EE3A 5HBMB 3PW1B 2CXEA 4ZL5A 2OGUA 5I4JA 2CFXA 3OSPA 5B09A 2E1MC 4EVCA 1EB0A 4DSEA 1BUXA 3MEGA 1JXLA 4RC5A 5DDOC 2VODA 2ZVSA 4PXCA 3ZZUA 1LKPA 2ZHOA 2BQRA 2V94A 4JOUA 1NLKL 2POKA 5DGBA 4KVSA 5FJ4A 3HFKA 3PTWA 1RWOB 3KNAA 5HMZA 2ASLA 4Y65A 5E33A 1U6FA 1J5OB 4O3QA 1FE4A 3ILIA 2BW7A 3EPIA 4DG1A 3IQ1A 4NX9A 2R3VA 2VC1A 3SV3A 3MMBB 2IM3A 4YHHF 5A2QY 4IFVA 5DG9A 4DPYA 1RA7A 2V2ZA 2MQOA 1RWNB 5I4MA 4AFFA 4ZL6A 4TY8B 2NS1B 2UU9F 2O5DA 3C1ZA 1WSRA 2K1RA 1FRXA 1NH8A 1X31C 1GMWD 1N33F 4RU9A 4GMKA 2XNQA 5T7LA 3MOZA 1OS5A 1FNMA 4AM2A 3M2UB 3MM6B 4NRUA 1SOFA 2AJ1A 2F4FA 2ZE2A 1H38A 3P96A 3VAHA 4JYAF 1U0HB 3LAMA 3UN5A 2HQGA 1F33A 3OR1A 4RW6A 4O0IA 2CPIA 2HW3A 2MYFA 2BKPA 4YVZA 3D9BA 4I67A 4A8OA 2XKQA 3MMCB 3I5CA 5T14A 2PI5A 5BYQA 5KT3A 4ZKXA 4CO2A 5D4PA 4V19J 3VGSA 4P18A 1FE0A 4X4PA 3W5YA 2O66A 3F39A 4M5IA 5J1NA 4DSLA 1H98A 3GVYA 1C0UB 5H9FJ 3R2HA 2MZTA 3KLIB 4RWWA 4DR6F 1IKXA 2RUGA 5HN0A 3RBDA 2WONA 4LF6J 2ZWOA 3N6MA 4PUOA 3AJDA 2BDPA 3CCLS 3UDCA 2UVRA 3NMAA 1JI5A 3DLKB 3WZ0A 1BQMB 1RTIB 1VJWA 4FF1A 5LMUF 2H48B 1VLGA 2F8MA 1T9YA 2CUYA 2QLFB 2B4VA 3L4BC 3J80U 2ZBCA 2OHDA 2YKNA 3OTCA 1PAEX 1EQ0A 1ZTWA 1RYTA 1LWCA 5M2UA 3MEGB 5GOUA 1YQHA 1RAEB 1XMOJ 3R6LB 1YJRA 1TKTB 1WWHA 4TXSA 2CQDA 1S1VA 2VG5A 4IOAQ 4F3OA 3GWCA 2YY3A 3CNQP 4QJVA 3PY8A 3CB4A 4ZJOA 2VQFF 5IT9U 2IA0A 3FSXA 5I42A 2DISA 3BGOP 2MY7A 5HLFA 4DG1B 1BFRA 2Z2MA 8AT1B 4MK9A 5L38A 1Q78A 3MDFA 3W5XA 3UQSA 1B0PA 4IFVB 5IC6B 2GIFA 3VV2B 1M5HA 2RJZA 3K58A 1PYTA 1VQOS 1NBEB 1M5PC 1SC6A 3DLEA 1P27B 3OXGA 2DBBA 2K1RB 4LF9F 5BR8J 2XMMA 3BH7B 4F4AA 1T11A 2QLJB 3CCMS 1QD1A 2G2YA 5T7LB 3E2EA 2F4VJ 1KQFB 5A8WA 2WBRA 4CRJA 2VPXB 1NZAA 1WC0A 3N9UC 2GHPA 5IT0A 2LMIA 5FFEA 4JBCA 1KLMA 4HH1A 1RHUB 2HHTA 4PG0A 2KJWA 4RW6B 5LMNF 2W4PA 1MFRA 5LG8A 4DCOB 2FQQB 2HK3A 2C2OB 3K57A 3GYGA 3CMAS 3PJ9A 2Y3QA 4QWBA 3G2XA 2QTWA 3Q89A 3VNXA 3OTEA 3PG9A 4WE1A 4EU0A 4J9UE 3AAWB 1RT7B 4CO1A 2C22A 2JJ4D 3MAQA 1RAJA 1OSDA 3VVUA 3LW5C 2P9GA 1L3TA 1FDBA 2F8HA 2NXUA 5GU2X 2WONB 1LKOA 1RBAA 4PUOB 3G6VA 2VHGA 1SPBP 1X5SA 5DRKA 3RGIA 4CTAA 5LBHA 4USVA 2J8AA 3AD8C 4L6V3 5HATA 3R2KA 4ZP9A 4U7CA 3GB0A 1BE4A 3TWZA 1HNVB 3RAQA 2QIFA 1Q0NA 4ZKWA 5EHHA 2ZM6J 1UAWA 2FVPA 1HHSA 2HHQA 2ZURX 1FD8A 3OUYB 1FK9A 4HHHA 1LWCB 2HPUA 3QGIA 2D1CA 4MY7A 2EFPA 5HMWA 1VHFA 4LREA 1T95A 2VJVA 1P6TA 1UFWA 3MMAA 5KOWA 1KHVA 4ALZA 3THTA 1SJFA 4QWCA 3GFYA 1S1VB 2B51A 2CQIA 1WC5A 2HSEB 4EYIB 4Y3CA 2OELA 2BE9B 4M5DA 4NYZA 5F8IA 1WD6A 1NF4A 1ZAVA 5I42B 1TKPA 1S77D 3GGZA 4E6KA 1Q8LA 3C14A 1QTNB 2D74B 3PWQA 1VFJA 1E6YB 2M7SA 2HLUA 4NA2A 2GNKA 2GJFA 4C8LA 2HMIB 2HIQA 1CLFA 4I6WA 2UV8G 5KFMA 3CTRA 1Q86T 3V3KB 5HQMA 1WF1A 1VQ7S 1RADB 1FWKA 5AXMA 4B9TA 1T9TA 5KG0A 3T5LA 1HNXJ 1U1LA 2JZ5A 3MPDA 3U1LA 2E5JA 3W2VA 2AU0A 5ETQA 4JI1F 2LQJA 2N7YA 2XO7A 5A8WB 5LSOA 4LSZB 2RDDA 4R25A 1KQKA 2E5LF 1FJGF 1LWEA 2HBYB 1O5JA 5E3RA 3KLFA 1KLMB 1NXIA 3IS8A 3NS5A 1BQXA 3TARA 2XQCA 1P9YA 4GKJF 2AEJA 4YB5A 4ELVA 1WEXA 1VJQA 5CCLA 1VGYA 4DPUA 1RLDA 1WKJA 4N56A 5CCMA 4QUWA 2RQ4A 4WE1B 3MTJA 2OSQA 2VQEJ 3TZZA 2V2KA 4WP8A 1VC0A 1VMBA 3NGUA 1Q7LB 2N3OA 3M8QA 2RE1A 1BMQB 4MH8A 2NYIA 4L73A 2HWHA 2GW8A 5A76A 4P75A 4BWJA 2KJVA 1C1BA 2RKIA 2D41A 2FB0A 2XMKA 2R8IA 2XG8A 1SB6A 3TUJC 2B8QA 5E7OB 2CVIA 2JD80 3C21A 3FGVA 1C0TA 4DR2F 1FK9B 1EIYB 1NJZA 3CIZA 2C28A 2BJ9A 3VAGA 1GWGA 1SC3B 4LFCJ 3CC7S 2E1CA 3UI3A 3MMAB 3JSBA 4RBUA 3VWSA 2PYBA 4GKKF 1B71A 1WHWA 1RDRA 4MK8A 1URRA 1OQ6A 3DI6B 2QFJA 1HBMA 3DOMA 3LKDA 2FZGB 2DXFA 1JX4A 2M8DB 2QRRA 3D0HE 3ENWA 1R89A 2KB2A 4M5DB 2HAIA 2ZBRA 2CQ2A 2LKZA 1VCTA 4PG4A 4DR3J 4B3TJ 1IKYA 4LR8A 4NLWA 2VJUA 4FF4A 1XMBA 4IXKA 1IM6A 5AJ3F 2AR0A 3QFHA 1EETB 2B0GA 5IWAJ 3R9LA 3FVYA 1JLCB 3EGWB 5KFAA 3BBCA 2K06A 5A6WA 3SFGA 3P49B 1RCCA 4A8KA 1WF0A 2GMHA 3W2VB 3W64A 4WFNQ 3NG8A 1EARA 1J27A 1WC1A 1MN9A 4ISMA 3W54A 5D4LA 4NCBA 4DUZJ 3W8GA 2OO4A 4I6YA 3J80Y 4LF7J 4DYUA 3LGHA 4HT5A 4OX6A 1FF2A 4ZLLA 3PV8A 2B9YA 2ZITA 2E7XA 4UQGA 3CO0P 1P1TA 1M90T 1X0PA 3WX4A 3B8HA 3I4PA 5AXLA 2XB2D 4KFBA 1FX4A 4CLUA 1RSCA 1APSA 3W8PA 3KK1A 4C3KA 4II4A 5KFEA 2KVQE 3BN4A 3PIOQ 2DGQA 1G4CA 1U6ZA 5DZ6A 3PW7A 3FRZA 5LXRA 5E5NA 4TQRA 4Q45A 2YBVA 2OC5A 2YJJA 4YS2A 3ZNJ1 5ETSA 5IT9Y 2VPYB 3D19A 2IPOB 2Z5PA 4OYMA 4X4QA 3M8QB 3ISNC 4B9UA 2V9KA 4LRBA 3PW0A 2EFGA 2V8HA 1NH7A 5LOQA 4TQSA 3AF8X 3R8YA 2BOPA 1U48A 2JC0A 2KI2A 3A13A 3KJNB 1LK5A 4FNIA 2XYHB 5KFTA 2LEPA 2CJQA 4JI4J 3LOUA 2ZH5A 1W7WA 4B08A 1C0TB 4I0WA 4DR4J 4IRKA 4L3NA 4YUDA 3CDWA 2JH3A 4MN9A 3NOGA 4M35A 3C16B 2KT5A 3I0RA 1OWXA 3QFWA 1SIZA 2NREA 4M5GA 1X9MA 5B0BA 4DX7A 2C6RA 4H4KA 2JX2A 1QAJA 3QJPA 4TYBA 4XKUA 1NK4A 1OY6A 3BPSP 1VEQA 4O23A 4DU7A 5LT5A 3CC2S 3FI6A 1H7WA 1NB2A 8RUCA 4OYZA 2IMWP 3UN3A 3IGVA 4JI6J 2D5KA 1IKYB 4Y28C 4OJGA 1SH0A 1CC8A 1T03B 1SIWB 2DYAA 4I7FB 3THVA 2K7JA 2MKYA 4JV2A 5IM0B 3LPYA 1XN9A 4ZN3A 2OTLS 2W2OP 4DQIA 3HPOA 3PEHA 3NAIA 3AT1B 3IG1A 1U0SA 3IRWP 3SE1A 3G96A 3DNCA 3H2LA 2D7SA 1UVJA 3CCZA 2CPFA 1S6QA 3C3LA 2YTCA 2MZSA 5F8GA 3C6TA 3OFEA 1NJXA 2DGVA 2Z58B 1RI7A 1S1WA 3QMQA 2XJMA 2W7AA 4MXPA 3EXCX 1GTHA 3HK2A 1ZS6A 3E1LA 4Q7AA 2CHPA 4FP9A 1U1MA 2OIHA 3IBWA 1SQFA 4TYAA 2GJ2A 4LQHA 4DV2J 3M6WA 1HWUA 4NLYA 2VG6B 2DR7A 1YJWS 2GMLA 2HQFA 2HVHA 1RT6A 3HLUA 4ZLNA 3DDNA 2BM1A 4II4B 2A2CA 3KA6A 1B64A 3MCMA 2DEJA 1HYSB 1RTZA 2R8HA 1FCAA 3TZXA 4LMZA 5HMYA 1T9VA 2P9EA 2YWGA 2V0NA 1ZZFA 1RWUA 2Z5RA 4DN9A 3IWLA 4U9RA 2VFUA 2KH9A 1GEHA 2G0JA 2Q3PA 4I68A 4YR3A 4MFBA 4RPFA 3HJVA 2M88A 3AH6A 4IH6A 2J5AA 1TMMA 3M32A 2AYMA 3HO1A 5IZHA 2KKHA 1N5SA 4HT7A 1WNEA 1LW2A 3TW0A 4PG7A 1XC9A 1U6BA 1U2RA 2F1FA 4KBIA 4LF2A 3I0RB 3CJRA 4PABA 1VQNS 2PSZA 3IS9A 1URNA 1DURA 2C2EA 4DSKA 2W9CA 1DQAA 2BKNA 3AOBA 1MWYA 4MIBA 4ITSA 2MKJA 2FHJA 3UD3P 1YJ9S 2AF6A 2ZDOA 1SL1A 3MI7X 2KRBA 2RRNA 3ZXWA 5F0UA 2L41A 3LANA 3NNHA 3IS7A 2DD8S 3PM9A 4Z7CA 5D6GA 2MLYA 3G4SS 1JJHA 2YWEA 4ZPVR 3R2LA 2HQ3A 4IWKA 2QSFA 1TKXA 4DL2A 5GN8A 2D3UA 1N33J 4K4VA 3IG1B 3GSIA 3ELHA 1X4CA 4OYBA 5GAHI 5K14A 3LP2A 1Q82T 2V8DA 4ZKHA 3K8VA 5D0HA 1N6QB 1HFEL 3AJPA 4BC9A 2Y3YA 5HU6D 1TL7A 4NE9C 1RHKB 1S6QB 1WDTA 2Z2LA 1VBXA 2IC3B 2P8IA 2E9ZA 4B9VA 4XKSA 2NCKL 2J0SD 1JLGA 3OW2R 1S1WB 2YNFB 3FEYB 2CN6A 4WFYA 4ZPBA 5CD4A 3R97A 2WVBA 2GYQA 3H5YA 4NLGA 2DXDA 2VKZG 1LFPA 1WC6A 2DH7A 1EZZB 5F8JA 4J37A 1WHVA 2AP6A 4ZPCA 4P9SA 1R3NA 1GX6A 3GJTB 3D6TB 2JVRA 3LWLA 4ANEA 2AGQA 2V2RA 2YX4A 4ZP6A 3I31A 3AQOA 1IQZA 2R42A 1HWKA 1S5ZA 5HSPA 5AXNA 3O44A 3C15B 2RH3A 4BDPA 4WXOA 3R7BB 1R8HA 1FKPA 4W4LB 2QE5A 3PKMA 5IS2A 3SIPB 4EUVA 4HDGA 1H74A 3Q4QA 2BANA 4UT4A 4EZ6A 1RYRA 5KT5A 1UEKA 1VRQC 3V6DA 2B4UA 2LEAA 2Z4PA 1UWBB 4RW7B 4A46A 5L46A 1MNEA 1DLOA 3IMQJ 3M32B 4DUYF 2BW1A 1UFKA 5H9FK 2ADCA 2EK1A 3OL8A 2DHHA 2ADBA 4LBIA 3D1OA 1FXLA 1R8BA 3FRSA 2JWNA 4F2SA 3IS9B 4RLEA 1ZAWA 3MOJB 2JRSA 4YXMA 4OZ0A 3DXSX 3TQEA 5CXTA 2B4OA 1V5IB 4QU6A 2VQFJ 3ZTQA 4WKRA 2RT3A 4C0BA 3GV7B 3M8PB 4ECSA 1GFWB 3RU0A 1E6VA 3WNWA 1C2PA 5K52A 2MSSA 3JQMA 2DNRA 3NOCA 2KZMA 1R43A 5IQ6A 3QRRA 3UVJA 2EW9A 4AE5A 3T1YJ 2FIUA 1V3RA 3EGMA 1PYOB 3HVTB 4ANDA 1S9EA 2FVRA 1V3ZA 2VV5A 3Q4RA 4HHJA 4ZDNA 5GN8B 4ES3A 4WWSA 5DGAA 1HQUB 3P4UB 1RA6A 4RBVA 3AJOA 5K14B 3LP2B 4P6QA 2NPIA 2UXBJ 2IM2A 1TL7B 5CABA 3D28A 3IBCB 4LUBA 4LT6A 4UW2A 3BREA 2FJCA 3VGTA 3CW2C 3TYTA 3RD0A 4NXNF 4DLGA 4YY3J 1DATA 5HL7Q 3G82A 4OZLA 2HHPA 2GC8A 5BJRA 4ZVRB 2WLUA 3JQKA 4KR0B 5K8PA 3DGVA 4JI8J 3ZO7A 4N8OA 2VA2A 2V2PA 1OY9A 2IVFB 4B3RF 3E8OA 1O51A 2CNNB 4N76A 2E5IA 4F3QA 2K8GA 2EBEA 5KFYA 1C1CB 1PC5A 3ZZTA 3ITHB 4CO0A 2GS8A 1UPMB 4C4WA 1FDNA 3PX0A 4KTQA 4Z7YA 1M1KT 1TL3A 3FZ2A 2BANB 2DNNA 2IM1A 3I6PA 4P2MA 1S48A 2DJWA 3FBCA 1B0VA 3FCVA 4A47A 4ZJLA 1EJ7L 1RTHA 4JI0F 5DQGA 4NYOA 1RAGB 2MDAA 4IOBA 4RW4B 1BLUA 2E29A 2V2VA 3ICLA 4OYAA 1DLOB 3MCNA 1TK0A 1XNQF 4DL4A 1M5SA 2J0WA 2LVWA 1IR0A 4REUA 4BLGA 2HYIB 4HL9A 5H9EJ 2FFXJ 3N5FA 1PGZA 4DMZA 1HWLA 3PW2A 2ZNZA 5AE2A 4L72B 4EBDA 3PVXA 2F8EX 3KOAA 2FG4A 2W2NP 1B4SA 2CQ0A 1I6JA 1F30A 1IN0A 3FC9A 1PILA 2VZBA 2Y8WA 3T6JA 2VDIA 2MHEA 5F41A 1FJCA 2IHR1 4U96A 3IM9A 4HKQA 4P73A 4F02A 2IA6A 3M2VA 1HD0A 1TK8A 1LFWA 4N5SA 3BR9A 4W98A 4JI3J 1S0VA 2FHJD 2MTLA 2LFVA 1REVA 1S9EB 3N6NA 3ES3A 4DX8H 4ES1A 3NCQA 1FHTA 2JC1A 3MEEB 5KFNA 4IH5A 2OKCA 1PO6A 4PQUA 3LWMA 1FJ7A 3L95X 1DQ8A 4JI1J 3C8YA 1D8ZA 3H25A 3AXMA 3PWQC 4Y34A 1QGHA 2X1FA 1BQNA 1FJGJ 2CAJA 2DNMA 3HJFA 1DAXA 2K7KA 1IWAA 2DXEA 2W4DA 4ZKAA 5ETVA 2AGPA 2DB1A 1XZ3A 4GKJJ 4DPXA 1Y7PA 1J5EJ 4OJHA 1S1UB 3BN7A 1MW7A 2MZQA 4FBUA 3QRPA 4X4NA 3G82B 3M9NB 3H0PA 3GPAA 4O4RA 4TY9A 1IBKJ 3LQVA 2GIQA 2OLWA 1XZ1A 1JIGA 3FBBA 2XLIA 4TW3A 5IV3A 2QL9B 2HHVA 1RU2A 2DIUA 1KEKA 1YRUA 4ISPA 2HBRB 1KWMA 3MR7A 4RW8A 4NCAA 2PMWA 4DV5F 3O7RA 4FKXA 3M9OB 1XERA 3PWFA 1RB0A 3HHLA 1RT4B 4DF8A 4WFAQ 4RU2A 3N0VA 3TA2A 1NZ8A 3S7RA 4NA3A 1TU0B 5E3PA 1RTDA 4K4WA 5GVQA 2I8EA 2Q43A 2QV6A 1RTHB 3NCRA 1NKBA 2E44A 3EXYA 1VRUB 3FCHA 2BE2A 2EC2A 4D3GA 4DR7J 3EMTA 1B7YB 1SC4B 4GKKJ 1EP4B 2H1YA 1NO8A 3KHHA 5D8SA 4PWUA 3F32A 1MWQA 1JLAB 3BSCA 2V2SA 1S76D 3EZ5A 5DLFA 5JDOA 4XPEA