3EZUA

Crystal structure of multidomain protein of unknown function with ggdef-domain (np_951600.1) from geobacter sulfurreducens at 1.95 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
342
structure length
336
Chain Sequence
GMSGDILNDIVAACLELERKASSVFKMFAAHAGSDEARRFWETVADETRHHSAVYERLQERGGRENLPIIIYKPAETLEELEMIGKSIDEQVERYTEAPSSEAACLLGFRLQLYLLHPAFASLCRLTRDASEDLPDIGYGRYLRRFIDGIGSCGLATAETELLGEALFRLWNEARQLAAQSHFDALTGVMTRAGFFKTVGSLAYAAQRSGSNVGIMLIDLDYFKLVGQTGDRILQLVAETITSHLRRSDVVGRYDGDEFVVYLSPVEPASLRTVAENLRRSIEEESARMVPVTASIGVAQGILGTDVDGGIEELVRLADECLMQAKYTGKNKVVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GGDEF domain protein
publication title Crystal structure of multidomain protein of unknown function with GGDEF-domain (NP_951600.1) from GEOBACTER SULFURREDUCENS at 1.95 A resolution
rcsb
source organism Geobacter sulfurreducens
total genus 133
structure length 336
sequence length 342
ec nomenclature
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ezuA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ezuA02
1NHUA 4I2PB 5F8HA 1O9IA 1GX5A 2FLPA 4K4XA 2HMIA 2FVPA 3UNOA 3ICLA 2GIRA 4FS2A 5FFDA 3R2HA 2GYQA 3OL8A 2GYDA 1N5YB 4CVTA 1AEWA 1LWEB 3OLAA 5HP1A 4F4XA 3NAIA 3H98A 2CN7A 4ED2A 1VRTA 3KLFB 4RC8A 4KB7A 3AF7X 2RDIA 1TK6A 4DL2A 4KBIA 4MKUA 4NCGA 5C42A 2ATLA 3PVTB 3KA6A 3HL1A 1VJXA 1DVBA 3OSPA 3KNAA 4DL3A 5F8MA 3RB6A 5T14A 1HQEA 1RT5B 4GC7A 5CZUA 4RW4B 1HNIA 2V4RA 2HNYB 2UVRA 2YNFA 1JKVA 3LALA 3DI6A 3E1PA 5E2DA 3MFIA 3KXUA 1DPSA 2ZA8A 3KLEB 3NP0X 5KFTA 3HVTA 2VG7A 3FQKA 2BRKA 2C22A 2WONA 2FKZA 3V6KA 1NNDA 2V4QA 4ED7A 5KFSA 4EVBA 3LAMA 3QIPA 1EP4B 2E9RX 3KLGA 4NYZA 1T05A 3GIMA 5J2MA 3C6UA 4WYLA 1O9RA 3I0RA 4G1QB 3NGDA 1QUVA 2ILZA 5GN8A 1D0EA 3KK3B 3GYNA 4YP3A 3OHAA 3DMJB 4IH6A 3CWJA 1S9EB 1S6QA 1VELA 1DTQB 3PVYB 1RYRA 4EBDA 4K4UA 4KFBB 4RW9B 4J9NA 2IAJB 2C41A 1BQNA 1S1TB 3KOAA 2BE2A 1JLCB 4IFVA 4WFZA 1S0MA 4KSEB 4RNOA 1FHAA 5FFCA 1BFRA 5I4JA 1VEIA 5JKLA 4I2QA 4IH5A 3GV8B 5DLFA 5KFLA 2VXIA 4IH7A 4J9RA 4Y34A 2RBDA 1LW0B 4B3OA 2R2RA 3KA3A 4EYIB 4O3RA 1IKVA 4TODA 3AK8A 1JX4A 2JD70 4DYUA 4WXWA 2OPRB 5F8NA 4II4B 3DLEB 1S49A 4JUZA 1EETB 3IS8A 1RT7B 5FFAA 3BQ1A 1XZ1A 3PVRA 5D8SA 5D8RA 1J5OA 4IRKA 2VXXA 4NLVA 4TY9A 2RKIB 3KMSA 1RTIA 1T03B 1JLGB 1RT2B 3KJVA 2ZE2B 3A68A 4ZHRB 3KA8A 3GVYA 3MF5A 4I7FB 4F50A 2ZA7A 5CMRA 4RNMA 1LWFA 5KFNA 4ZKWA 1NFVA 5EWGA 1RCGA 5F9LA 2FHAA 4NLOA 2DPIA 1UWBA 2J6TA 1JLQB 1XR5A 1N4LA 1RYTA 4NLGA 2XGWA 4J9PA 3MEDB 3R2LA 2OPQA 3LP1B 5KG2A 1UMNA 3M8PB 4PG1A 4Q45A 4Y08A 1N56A 1DTTB 2FJWA 5KG4A 5CYQA 3BVLA 3RGDA 5LG2A 4ZVGA 2UUTA 3FQLA 1DLOB 3AF9X 4LQNA 4J9MA 2VA3A 5KFCA 2V2IA 5L9XA 2V2OA 3UOIA 2BANA 1FKPA 3OGHA 1TKTA 2CJQA 2HNZA 1LWCB 3AJOA 2Z90A 4LSNA 1T3NA 3QLHB 3QVDA 4YR3A 5KFMA 4KVQA 4WE1B 3T5JA 2IMWP 2UUWA 2Y3QA 3JYTB 4ITTA 1WNEA 2J6UA 4KE5A 4RC6B 1SOFA 3LANA 3V81B 4IR1A 3VQSA 3ISNC 3IN5A 3CDUA 3GE4A 3JSMA 1S9GA 2CHPA 4X2BA 4O3PA 4QWCA 4YR2A 1RTHB 3BT5A 2HMIB 2R8KA 3SIDA 1RTDA 3DRSA 3KK3A 3RE7A 5HP1B 3DMJA 3BSAA 1HYSA 5L1KA 2BJYA 3R2MA 1DTQA 1VRTB 4MFBA 1GWGA 3PVYA 3GHQA 2FZFA 5K52A 4NCGB 5DG8A 5C42B 1RT4A 1VEQA 4ZVHA 4M32A 4H4OA 3KHLA 3PWQC 1JLCA 1Z6OA 3KWOA 4NLYA 4IR9A 4K4SA 1JGCA 2WTFA 5F8LA 1HNIB 3FI6A 4AM5A 4H4MB 2YNFB 3RB0A 1NF4A 4ZLWA 2ALZA 3DI6B 1LW0A 5HQOA 4MH8A 5KT5A 5KFZA 1R03A 4ED3A 3HVTB 2VG7B 2J6SA 3TQ1A 2WONB 4Q0BA 2JC1A 2E9TA 2IBKA 4K4VA 2V2NA 4RNHA 4J9KA 4Y3CA 3WNWA 2XCPA 3MR5A 2ILYA 3PW0A 2I1RA 3KLGB 3F34A 1T05B 3DLEA 5J2MB 2E9ZA 3KMQA 4ZPDA 3I0RB 1XZ3A 1EETA 3WVUA 3DOLB 3G6YA 1S6QB 3E6RA 2RKIA 2C6RA 1T03A 2QF9A 2V0NA 1RT3B 1HNVA 4RW8B 1YUXA 4RC5B 1BQNB 2BE2B 3V6JA 2R8IA 4IFVB 4ECXA 2YKMB 3I0SB 3BGRA 1RT1A 3MPSA 3PW4A 4B3OB 1S1WB 5D8QA 3O7SA 5J2PA 1L8HA 3G6VA 5KT4A 4ZL6A 4ZKXA 1IKVB 3CJ5A 3IRXA 3EZUA 2VZBA 2IM0A 2ZG8X 4KHRA 2AU0A 4ETRA 2YNGA 2IU2A 2V2MA 5KG0A 3QZ3A 5L1LA 2JD80 3PVRB 2BRLA 3MEGA 4TOBA 4KAIA 3KHHA 4EVCA 2UVUA 3MECA 1J5OB 1REVA 4LQ9A 1RTIB 5JKMG 5GU0X 5KT3A 2JEGA 2W9BB 3QIDA 4TOAA 2PYBA 2HAIA 3H2LA 4IXKA 3H5XA 5IX6A 1IESA 1JLFA 3JYTA 5KFQA 1C0TA 5HLFA 1LWFB 5KT6A 3AF8X 4ZKHA 3V81A 1S9FA 1FKOB 3NKYA 1UWBB 5KFBA 5KG1A 1RTHA 1F30A 5J1EA 5EWFA 2OPQB 3FSIA 4NLTA 1F33A 4ZPCA 3UDLA 1W25A 4FBTA 1MU2A 3HKWA 4R0EA 1HRSA 2FG4A 1KRQA 1LW2A 2IC3B 5CYQB 1NNQA 2XWYA 5J8SA 1TL3B 2ZKUA 3DRPA 4DEZA 4R42A 1JLAB 2VA2A 3DOKA 3GILA 1VRUB 4QWAA 1RYSA 5DLGA 3TA8A 2BANB 4EO6A 1FKPB 5F8GA 1TKTB 2HNZB 2VG5A 4LSNB 3M9MB 1C1CA 4H4MA 4TQSA 4JV1A 1S30A 3QZ8A 3H5SA 4IG3A 1S1XB 5CYMA 4H54A 2ITBA 1RTJA 3JSMB 2XJNA 1S9GB 4YKHA 5E1UA 5C25A 4NLRA 5KFDA 2R2TA 3N6MA 3CDWA 2FJCA 4MK8A 2IB0A 1SH0A 4ECYA 1RTDB 2D7SA 3DRSB 2XKQA 2F7NA 2R8JA 4DG1A 4ZL5A 3DOLA 3BVIA 2GC8A 1HYSB 5D3GB 4MFBB 3KHGA 2B6AA 3OJ5A 1RT3A 1JIHA 4ZPAA 4TOGA 4RW8A 3RAQA 1TV6A 1ZTTA 3KA9A 3PJWA 4ID5B 3ISND 1JKHB 1RT4B 2C2UA 4RC5A 1UVHA 2WOMA 4H4OB 3T1AA 3AJQA 2V15A 1RA6A 4Q8FA 3LP0A 2ZG9X 4Q43A 5D8XA 2YKMA 2G4HA 4ZVFA 5HJFA 3I0SA 5I3UB 2W9AA 4URQU 3PWFA 3MR3A 2RDJA 3R2OA 2V2JA 1S1WA 4O3QA 1S3QA 3D28A 3E6SA 2R2SA 1IKYA 1TP7A 3M9OB 2YNIB 4RUCA 4Q0BB 4U6PA 4OL8A 3D5MA 2WLUA 3OLBA 4NLSA 3T5LA 4ICLB 3NMAA 1Z4AA 1SV5A 4DL7A 3IGNA 5DQGA 3H40A 2ASJA 3DM2A 4PGIA 1TVRA 3E1QA 1ZETA 2WLAA 4XO0A 2W9BA 3IGVA 4G3IA 4ZP9A 1HNVB 4RW7A 4Z5SA 4Q8EA 1MMLA 3N6NA 2YJJA 1H96A 4XPEA 4IFYB 3PW8C 3OL6A 2ZURX 2ZG7X 1FKOA 3R2SA 3FSEA 1OTKA 3BGRB 1HMVA 1RT1B 1SQ3A 4EEYA 2XGQA 4A25A 4K4ZA 4CYAA 2HNDA 5J2PB 5KFPA 4OYNA 1C1BA 3QYYA 4RW6A 3IRXB 5KFHA 1QAIA 3PR4A 3F32A 2QE5A 2IC3A 2YNGB 2RF2A 4KVRA 5KFGA 1MOJA 4M95A 2AWZA 4LSLB 2FVQA 3PHEA 4WFXA 4NZ0A 2V2SA 1TL3A 3V4IB 5HJHA 3V6HA 4IRCA 1JLAA 4RC7A 4F4WA 1VRUA 2C2EA 2W9CA 4NLUA 5KG7A 3MEGB 2CN6A 4DE6A 1BG7A 4ED8A 3MECB 3H4DA 1REVB 5J2NA 3RD0A 4E6KA 1RCIA 3Q4OA 2AX1A 3GV5B 4LYXA 2CF7A 5KT2A 4LQJA 5FDLA 1JLFB 4IDKA 1C2PA 4JV2A 4ML5A 1C0TB 2YNHA 1S1XA 5HLFB 4QPXA 1QAJA 1IKWA 3HHKA 1MFRA 4TYBA 1JREA 3OL7A 3IS7A 5J1EB 2XJOA 1JIGA 4ZJKA 1JTSA 2WK4A 3HVAA 3MTKA 2O5DA 2UVVA 3RAVA 3QGHA 5GU1X 4CYBA 4DYZA 1MU2B 5FFBA 2FVRA 4ZMMA 5D3GA 4EYHB 1LW2B 4ECUA 5EDWA 3KLVA 3EGMA 2WTLA 3Q4QA 4KO0A 1HQUB 2D3ZA 2GIQA 3DRPB 3PWQA 3G86A 4ID5A 1JKHA 2Z6MA 3DOKB 4R8UA 2C2DA 5KFRA 4CVSA 5L1JA 4WYWA 3SI8A 4EVDA 2C28A 2VG5B 4ITWA 5I3UA 4ECZA 4K50A 1C1CB 3EPGA 2Z5QA 5KFAA 4EBEA 3LAKA 3ES3A 3WVWA 2JC0A 4TYAA 2YKNB 4CMYA 4PQUB 4IG3B 4TOCA 5CYMB 4DZ0A 2YNIA 4O3NA 5I42B 5KG5A 4P18A 1C0UA 4EO8A 1RTJB 3AK9A 3PW2A 2XI2A 2FLNA 5C25B 4ICLA 2XCAA 2QQYA 4QWBA 3RBEA 1I6JA 4ED0A 1S97A 4ECWA 3DYAB 1N6QA 3SFGA 4J9LA 4DL6A 4DG1B 3CO9A 4DI0A 4YR0A 1TKZA 5JXSA 4QUWA 1YVFA 2B6AB 1S4FA 1B71A 5LS9A 2BQRA 3BR9A 5JKMA 1TV6B 3SHXA 2WOMB 3E2CA 5KFVA 5HROA 1FK9A 3DRRA 1R0AA 3KX9A 2I5JA 4EBCA 4NLQA 4IFYA 1U09A 2ZD1B 4IRDA 5KFKA 4RNNA 3LP0B 4AM4A 4QW8A 3SH6A 4QWEA 1SH3A 4MKAA 4TO9A 4Y2CA 3GIJA 4RNFA 3DLGA 2FVSA 1IKXA 4YMEA 3T5KA 2D41A 1IKYB 4MK7A 1SUQB 2HWIA 2V2PA 3QGIA 4TW3A 3E1OA 4ISPA 2V9WA 2AX0A 4PGKA 2ASDA 2OPPA 1JI5A 3GV7B 4ECQA 3BSCA 4KV8B 4LSLA 3KK1A 4O44A 1SV5B 3GQCA 3V4IA 1QGHA 1NHVA 1RA7A 3CJ0A 1N48A 4MKBA 3NBPA 1TJOA 4TOFA 1TKOA 4LYUA 3IS9B 5J2QA 3BKNA 3DM2B 1TVRB 2FL0A 1TKXB 4M35A 3Q4NA 4PG0A 2W7OA 5DG7A 5K14A 2OPSA 2IJNA 3MFHA 4RW7B 5AXSA 2FJXA 4MK9A 1RCCA 3T19A 5J93A 4FBUA 2R8GA 4NLWA 1S1UA 4F4ZA 1KHVA 4TN2A 4EVEA 3V6DA 4ECTA 2WB4A 5ERJA 2V2LA 4LPMA 4IQXA 4J9OA 5KG6A 5ERKA 2WRMA 1HMVB 3FFIA 4DYXA 3H5YA 4M94A 3BJYA 4WZMA 1BQMA 3NOZX 2IM2A 3QHBA 5C5JA 2FFXJ 2HNDB 1NF6A 3R2RA 1C1BB 4J9SA 2CLBA 5KFWA 3QB9A 4RW6B 2XI3A 5KFUA 3PZAA 5JACA 4TQRA 2AGOA 5C24A 3RB3A 2RF2B 4WZQA 5LG8A 2BW1A 4HKQA 2Z5RA 4DL5A 5F9NA 3H4BA 2BR0A 1HQUA 1JLEB 4ZP6A 4J9QA 2IM3A 3T5HA 4RC7B 5L1IA 4K4WA 3UOFA 3PW7A 2W9CB 3O7RA 1SH2A 2XC9A 4MUDA 1YV1A 5GU2X 2X170 2CEIA 3KHRA 1IERA 3QHCA 5D8YA 1QE1B 2FJVA 1CSJA 2XJMA 5J2NB 1VLGA 3LP2A 5KFFA 1TKPA 1BCFA 4R5PB 3I5AA 2BKCA 5FDLB 2OH2A 4IDKB 2YKNA 2D3UA 1JLBB 4PUOA 4PQUA 2YNHB 4REUA 5EUHA 3C6TA 5I42A 1IKWB 1S6PA 3Q8PB 3NAHA 3BQ2A 3Q8RB 2VG6A 2W0OA 3TVKA 1GX6A 2JEJA 3KK2A 2B5JB 4F4YA 4DYYA 2QV6A 2R8HA 2CHIA 1LKMA 5F8JA 1DATA 3BQ0A 3KLIA 3DYAA 4NLXA 4M33A 2C2FA 3I5BA 4TY8A 1TL1B 2W8LA 2GS4A 5C6FA 2HR5A 4CY9A 4O3SA 3TAMA 1RCEA 4KO0B 3T9JA 2W8KA 3H5UA 5KFEA 3VNXA 1ZS3A 4CMYV 3KLHB 4MIAA 4NLDA 4R8UB 2ZD1A 2B43A 4O3OA 4TLRA 3BVKA 4KKOB 3NL0A 5LBHA 3A9QA 4IG0A 3E1NA 3HIUA 4RZRA 4TOEA 3E01B 2FVCA 1ZUJA 4XPCA 1SUQA 2Z5PA 2YW6A 3N6LA 5HBMA 2C2JA 1C0UB 4HYKA 1HARA 3CIZA 2XGPA 4NRTA 3QD8A 4ZP7A 2UX1A 5J8WA 1J30A 4KV8A 2CLUA 4ISMA 1S0NA 4QWDA 2OC5A 1JKUA 2IM1A 1HPZB 4XKSA 3IS9A 2YW7A 4NLPA 1N6QB 3QGGA 3QO9B 1TKZB 1TKXA 4PWDA 2HTNA 3NP2X 3PR5B 3AJPA 1JYBA 3DLKA 1LKPA 4XKTA 5GOUA 3U90A 4ZPBA 1RAJA 3RBCA 4AM2A 4Q44A 4Z3BA 3MEEA 3PW8A 4O4GA 4LPNA 5HROB 1FK9B 3DRRB 1R0AB 2I5JB 1RT6A 3FRZA 5D8PA 2R2UA 5JUMA 4LQHA 3M8QA 4IWKA 4IOBA 3DLGB 1KLMA 2AGQA 1IKXB 1T94A 2DPJA 3ITHA 4DL4A 4ZP8A 5DG9A 5JKLG 1XR6A 1YUZA 2WHOA 4ZVEA 5KG3A 3IG1A 3E1JA 4I2PA 1QYBA 3MR6A 2OPPB 1RDRA 4MN9A 3KK1B 2IY4A 4TXSA 2EC0A 3SE1A 4O44B 1JLEA 1N5YA 3FDSA 3NBPB 3PW1B 5J2QB 1LWEA 4ECSA 2D5KA 5KFXA 3GIIA 1LKOA 3F33A 1QE1A 2CKWA 3KLFA 4ECVA 1S0OA 5K14B 5DGAA 5FFEA 3E1LA 2OPSB 4R5PA 2JEIA 4O4RA 3PVTA 2FLLA 3BSNA 3F35A 3ERZA 3RAXA 1JLBA 1S1UB 4URSA 1RT5A 3PJXA 3PZPA 3V6DB 4RW4A 2AQ4A 2HNYA 5K53A 3FFIB 2V2RA 3PVXA 1S1VB 1BQMB 2B5JA 3CJ2A 3KLEA 3G6XA 4K4YA 3OSNA 4WFYA 4LPJA 1EP4A 2F8EX 3E51A 4U7CA 5C24B 1TL1A 5KFJA 2AGPA 4XGSA 1D1UA 3UPFA 4G1QA 1S10A 1L8IA 1OS5A 4ED6A 1ZTWA 3KLHA 4GC6A 3CJ3A 1Z6OM 1S9EA 3M9NB 4KKOA 3RBDA 2C2RA 4KHMA 3LP2B 4MIBA 2BQUA 4LQ3A 2JEFA 4KFBA 4RW9A 4MJYA 2IAJA 1S1TA 4URGA 1JXLA 3E01A 4PUOB 3GIKA 2BQ3A 1HQEB 2ZA6A 3C6TB 5EWEA 3QZ7A 5KT7A 1S6PB 4ED1A 3CDEA 2FG8A 5GU3X 1XR7A 2VG6B 3F39A 3Q4RA 4XKUA 4KVSA 3RB4A 3KK2B 3BREA 4JV0A 3BSOA 4M34A 3CJ4A 1HPZA 3CVKA 4ZMCA 3KLIB 3QIPB 3Q8SB 5DGBA 5KFOA 3WVVA 3QO9A 3E1MA 5DQIA 5FEJA 4IWJA 2OPRA 4TY8B 4II4A 4Y2AA 3C6UB 3H59A 1N1QA 3TAMB 5KFIA 2OH3A 2IA6A 2UVWA 3EPIA 2BK6A 1RT7A 5F8IA 5GN8B 4WXOA 3EZ0A 3IQ1A 3Q8QB 3KA4A 4CVRA 1JLGA 1RT2A 1IM4A 4YQWA 4NRUA 5DQHA 4QW9A 2ZE2A 4IG0B 4ZHRA 1EUMA 3MR2A 5D8OA 3SFUA 1RCDA 2JLEA 4I7FA 2W7PA 3OL9A 3FVBA 3F36A 3BVFA 3BVEA 3ISFA 4ERUA 1K1SA 5HBMB 4I2QB 4LQVA 5CMQA 4CVPA 3PW5A 1JLQA 2CIHA 4IKAA 3UR0A 3MEDA 1TQLA 3LP1A 5KFYA 5J9VA 1LB3A 2WCXA 4FS1A 3H7GA 3DDKA 3M8PA 4MY7A 1S2ZA 1KHWA 3PW1A 1DTTA 4PWDB 1JI4A 4RUAA 3DLKB 3UQSA 3HVWA 2IJFA 1DLOA 3R2KA 3MEEB 4O4GB 4DASA 3OHBA 1LWCA 4ZTTA 3QLHA 1RT6B 3KJVB 4RU9A 4WE1A 4K4TA 1Z4UA 1K1QA 3M8QB 1S1VA 1KLMB 2HWHA 3ISEA 3ITHB 1S48A 4U3GA 4RC6A 3I5CA 4ECRA 3F37A 2YJKA 4TOHA 2JD60 3IG1B 3F38A 2ASLA
chains in the Genus database with same CATH superfamily
1O6XA 2FLPA 3NRBA 3L7UA 2HMIA 2FVPA 2GIRA 1HIYA 2G2YA 1UP1A 4DPWA 3PV8A 1N5VA 3CCSS 1HNWF 2I9SA 2GYDA 2YWFA 1GTEA 3TEGA 1VRTA 2XY7A 1RKJA 4UZCA 1AFJA 3AF7X 4ED4A 4DL2A 4KBIA 4DV0J 5LMNF 1GK8A 3PVTB 3KA6A 2YQ1A 2XY6A 2N3LA 1NM2A 1NK8A 1Q78A 3PYGA 3NCRA 3RB6A 1HQEA 2ADCA 2V50A 2UV8A 2GJIA 1N32F 5CZUA 4RW4B 1HNIA 1VIOA 4RX6A 3NMRA 2HNYB 2BUNA 2UVRA 1YQHA 1JKVA 3EZOA 3LALA 5E2DA 5HMZA 5KFTA 1F2GA 2VG7A 1A9NB 2BRKA 2WZ1A 2C22A 1T02A 1NNDA 3I4PA 4EVBA 1EP4B 2E9RX 3LQVA 4HL9A 2LKZA 1U7LA 2QFJA 1WF2A 1MN9A 2MKHA 4YDXA 3TEHB 2EKYA 1QUVA 5HANA 4KGVB 5GN8A 2UUBF 3EGWB 3GYNA 4IH6A 1S6QA 1VELA 4ZPTR 1DTQB 1WOSA 4B02A 3D54A 4C8YA 1Q0NA 2R7SA 4DUYF 3VQTA 1Q1KA 2LYVA 3MMCA 4L3KA 2IAJB 4JI0F 1RHUB 2FHOB 3M8YA 4M5JA 3K89A 2HRYA 3J7YI 2YKAA 1UJ6A 4B9MA 5JKLA 4AUKA 1ICEB 1YSJA 4IH7A 4AXJA 4B3OA 1ZM2A 1JMTA 3C21A 1BY9A 2QJ3A 3AK8A 3T1YF 1N33F 3D6HB 2W2MP 4F25A 2DCLA 5IXUA 5F8NA 4II4B 4DQPA 4WFNQ 4DSFA 3S1TA 1LEOA 4JUZA 1IVZA 5FFAA 1R0BG 1TMJA 1XZ1A 3CMQA 3GG0A 3MD1A 4IRKA 2YH0A 3CCUS 2RKIB 3KMSA 5ETSA 2YWGA 1NJZA 2Q6BA 3KJVA 4ZHRB 1K9MT 3RBZA 4I7FB 2Y0SD 4UUWA 2ZA7A 4RNMA 1ROFA 1LWFA 4DFPA 4ZKWA 3FBFA 5J1PA 1YITS 1NFVA 3M1VA 5ETRA 5IS2A 2DD8S 3LOUA 1F1BB 4KJIA 1CJTB 3OXLA 5DO2A 2XGWA 4J9PA 4DWIA 2ZH4A 2OPQA 2AJ0A 4X0JA 2BABA 1UMNA 4DR6F 3VVUA 1SC4B 1VI7A 2FJWA 4CRJA 1MWYA 2BYCA 3DXSX 3MZIA 2XYGB 1K8AT 2IRYA 4J9MA 2ZH2A 2DRAA 5D6GA 2YQ3A 3KG0A 1JJ2R 4ELUA 3IRWP 3OGHA 1TKTA 2CJQA 3PYEA 4ZK7M 3V2UC 4KVQA 4WE1B 3M32A 3BEGB 2UUWA 2Y3QA 1ELOA 1R8AA 3FBCA 3JYTB 1WNEA 4ZVPB 3LANA 3VQSA 3ISNC 3GE4A 3PJ9A 4O3PA 3SQGB 4QWCA 1GH8A 3UN5A 3T41A 3PIOQ 2ROPA 1U6BA 4G65A 2C2NA 3F44A 3SDEA 2XMAA 3AJ2A 4J90A 2FJEB 3RE7A 3KG1A 5HP1B 1VYAA 3B78A 5L1KA 2BJYA 2NSBA 3R2MA 5HL7Q 3TOQA 1R6VA 2BE7D 4KGKA 2E44A 4B3MJ 5K8MA 1WWHA 2C3YA 5K52A 4NCGB 5DG8A 1FJ7A 5C42B 3KHLA 4H4OA 3PWQC 2MLYA 3PX4A 1FFGB 1GT8A 3R5JB 3Q2TC 2UUAJ 2DEJA 3TA1A 1Q86T 3FI6A 4X4UA 2ZITA 3NGKA 4LSZB 2YNFB 3RB0A 1NF4A 1H0HB 3GJSB 1LW0A 4ETXA 4LF7F 5IT9Y 2LVWA 4USTA 1TL7B 3TQ1A 4A8OA 2MQPA 4P7VA 3GCXP 4DQIA 2V2NA 3WNWA 3K58A 2VFTA 2XCPA 3MR5A 3PW0A 3KLGB 1T05B 3DLEA 2IRUA 5D0EA 1PIEA 2DR7A 1PGZA 2HBZB 1EETA 4C8KA 4ZIWA 5E5NA 4DR1J 5FLXY 1XNQJ 3DOLB 2GIFA 2MY8A 3I82A 2EFOA 3G9CA 3M2RB 3E6RA 2C1EB 3N4WA 2JH3A 2BJEA 2KRBA 5L39A 3EVOA 3J80U 3M05A 1DQAA 2NPIA 1FJGF 1ZAXA 5B7WA 2Q3PA 1YUXA 3Q8YA 2BE2B 3BGOP 3V6JA 2C3MA 4IFVB 3OVSA 2U1AA 5F3TA 1Y0HA 3CTRA 4FYXB 1UTAA 5B0CA 3MPSA 2DIUA 2VF3A 4F3MA 4OV6A 4JYAF 1SC1B 2W4DA 2Z30B 1L8HA 3G6VA 3NEKA 1IKVB 3CJ5A 3MCOA 2VZBA 2IM0A 1GEHA 3JSBA 4LF6F 2AU0A 2JRSA 3BZQA 4ER8A 2VD3A 1BXNA 3GMGA 4YHHF 1RP5A 4C3LA 4TOBA 4OI6A 1KTVA 1NH7A 4HACB 1H98A 1J5OB 4WK1A 1RTIB 4C8NA 5GU0X 4IXKA 3H5XA 1RWVB 2IBOA 1WC4A 3HO1A 5KT6A 1X7VA 4P2SA 2XNRA 1PCAA 3B82A 1FKOB 3NKYA 2XWXA 2HK2A 1VIXA 2PFDA 5B0EA 1UWBB 1H7XA 2NYHA 4N8OA 4JB8B 5AXLA 1RBOB 5EWFA 2HVDA 2HHHF 3MPYA 4NLTA 2PA8D 1W25A 5SZTA 1PBAA 3ZZPA 3M8RA 2FG4A 1KRQA 2RMLA 1J27A 3DCAA 3GG1A 2XWYA 3UNGC 4Q5VA 1S72S 1TL3B 2IVYA 2HGNA 3DOKA 2PT0A 4OZ0A 1VQSA 3TA8A 3BGUA 2BANB 4EO6A 4RJVA 3TW0A 2AJ1A 2RQCA 3NY0A 2HNZB 4USWA 3K57A 1U48A 3L3CA 3M9MB 2IJRA 2F9DA 5IZHA 3C8YA 1S57A 2B4VA 4QIWD 3IWLA 4JV1A 1HD1A 3Q86A 4GKKF 3QZ8A 2CPDA 4ELTA 3T9ZA 4ZVUB 3H5SA 2CDRB 5HMXA 4B9UA 3DLHA 4JBCA 2YKOA 1KEKA 2ITBA 3JTPA 3SMZA 4ETZA 2HEKA 4NLRA 1KR4A 2QG9B 1IQZA 4MK8A 2IB0A 1SH0A 2F8HA 4AXIA 1GMVA 4CLLA 1J5EF 4J91A 4AQYJ 2DGXA 2QL5B 1HYSB 5C2GA 5GAHU 3CDBA 3LGHA 1CS4B 2JNJA 3W8GA 4ANEA 2M2BA 2LA6A 1WKKA 3ISND 3AJQA 2V15A 4OYWA 3AXMA 3F41A 2G4HA 1TK0A 2ZVIA 1ZM3A 3VGUA 2RDJA 1RE1B 3C1ZA 2PSZA 1NHKL 1S1WA 3D28A 3C2PA 1HWUA 3A4TA 2GQCA 2POKA 4RUCA 4Q0BB 2FTRA 1ZYQA 2WLUA 3M8WA 3OLBA 1NK0A 4ZJOA 3T5LA 3F56A 2VDIA 3EX7B 3HXMA 3TWZA 3LTOA 4FXVA 1V3RA 1CEZA 4WU3A 3H40A 2B7BB 3M8SA 3DM2A 2FQQB 4PGIA 4I68A 2WLAA 3M2VB 4ZITA 1RWWB 2W9BA 1GFWB 2N4CA 4G3IA 1V9OA 1Q8KA 1YI2S 1HNVB 4DR2F 4LF4J 3TZXA 2F5GA 1X9WA 3OBIA 1VQNS 2ZURX 4LRBA 1UPPA 3BGRB 2IRXA 1RT1B 3PRBA 2XGQA 4KIAA 2YPYA 4N56A 3PRVA 4K4ZA 3W61A 3A3OB 5HATA 2HNDA 2K1RB 2KXHA 1C1BA 4RW6A 3IRXB 1SKRA 1QAIA 1K47A 4H4KA 2W7AA 2F3JA 2QE5A 2YNGB 2RF2A 4LSLB 3QATA 2F8MA 4WFXA 1L3UA 5HJHA 3V6HA 3A1YG 4IRCA 5M2RA 3CIMA 1ZAVA 2DBBA 1VRUA 2C2EA 3DHWC 3MEGB 3EGVA 4ED8A 3MECB 3KJQB 1P1LA 1REVB 1RCIA 3Q4OA 2AX1A 2HBQB 2ATCB 3P5TL 3J7YU 4X4RA 2CF7A 4WK3A 4UW2A 3TUPA 2BXJA 4P72A 1UETA 4L6V3 1KSPA 3K59A 4ML5A 1S1XA 3HD1A 1KVIA 3L09A 5BYRA 1IKWA 1H2VZ 4OHYA 4X4NA 1BWVA 1FA0A 1JIGA 4M5DB 2FIUA 3MTKA 4DZ6A 3P5BP 5K8NA 2DHSA 3QGHA 2V63A 4N8NA 3W2WB 1MU2B 1WOOA 5FFBA 2FVRA 3AQPA 2AD9A 4X4QA 1LW2B 3U02A 4UQGA 1QAYA 3LA0A 3G87A 4FVCA 1WHYA 3ELHA 4WWSA 2DT9A 4OHVA 2R7VA 4USIA 1F9FA 3TUIC 2PE8A 1A0OB 2GQ2A 1RAIB 1EHWA 2Z57B 3M6XA 2LDIA 4BWMA 2CQ3A 5H9FK 3HULA 3MMBA 3EGZA 1DY3A 1IJEB 1KQFB 4EBEA 4MYUA 3VTIA 1GXTA 3LAKA 1SPBP 4CDIA 2PIIA 5CYMB 4OJHA 4O3NA 1BLUA 1XMBA 4P18A 4EO8A 1RTJB 2OKQA 3AK9A 5D4OA 4ICLA 4ANCA 3RBEA 1I6JA 1RXOB 2ZKTA 3PYDA 5JDOB 2MXYA 5ETKA 1Y4ZB 1WG4A 4CLZA 1F5AA 1N6QA 1SIZA 4DL6A 5HVGA 3I56S 4DG1B 2HIYA 2EBGA 2YWHA 1TKZA 1Q7LB 1IBCB 2P5VA 4EK2A 1PJ7A 2B6AB 2DVIA 4F04B 3TP2A 1ZM4A 3MM7B 1KDNA 1LXNA 3VR1A 1NKEA 4HTJA 3G8TA 3SHXA 2R7RA 2WOMB 2W2OP 3VAMA 3KX9A 4EBCA 4IFYA 4DFMA 2CJYB 2I0XA 4DS4A 4OZNA 4B9SA 3TNVA 1HI0P 4LUBA 1YK9A 1U0HB 3RYLA 2KM8C 4L74A 1SH3A 2QN6B 3AY0A 3PYFA 4Y2CA 2FB0A 1RAEB 2ZEJA 1IKXA 2V8HA 2EK6A 2CPZA 1IKYB 3QAEA 2ZJRQ 2BBEA 1R6YA 2DR6A 5IC6B 4TW3A 3E1OA 2CJBA 4LRFA 1D9DA 2V9WA 2AX0A 4FPRA 1H73A 2OPPA 3L95X 3GV7B 2GVZB 3ZZOA 1I94F 1GTHA 1SV5B 3ZTRA 3GQCA 4ZCKA 4NPOA 2ZWPA 2HHPA 2Y8WA 2MQLA 5AXMA 4TOFA 1TKOA 3BKNA 2E5HA 2CQ4A 2W01A 2FL0A 2GA7A 2MQ8A 1NDCA 4Y2IA 5HI7A 5K14A 3HHDA 4YB6A 1JNRB 1YIJS 3MFHA 2DNYA 1RCCA 2BKOA 2CQ1A 3T19A 4J9UE 2UP1A 4DN0A 4NLWA 1S1UA 4EI2A 1WDTA 2V5HG 3V6DA 3SV4A 3FMBA 4LPMA 2UXBF 2CWLA 4QU7A 4IQXA 2FUG9 5ERKA 3FFIA 2E5LF 4DYXA 1ZBTA 2XO7A 4WZMA 1FXRA 3QHBA 3L4BC 4P7TA 1FNXH 2VJUA 3QB9A 2CVEA 5D77A 2WVEA 4TQRA 1KVJA 2LLZA 5L9NA 5ETQA 1VBKA 2BW1A 2JL9A 3HMJG 2LQJA 5F9NA 3H4BA 1HQUA 3HHLC 4DQSA 2FZGB 5E41A 3T5HA 4RC7B 1LFWA 3UW1A 5SUHA 2X170 2CEIA 3VAJA 2XEXA 1CSJA 2XJMA 5J2NB 5F0WA 1IWAA 1TAQA 1BCFA 5E2QA 3I5AA 1VQ8S 2PA3A 5A0YB 2R7TA 1JJHA 2XYPB 1VBYA 1UVMA 2BKCA 3DHXA 4YUDA 2GFFA 4PUOA 4PQUA 5EUHA 4G1IA 5AJ3J 3SZ2A 3ENVA 4DQRA 2LQ9A 3TVKA 1Y10A 1GX6A 4E2FB 4DLEA 2BM0A 4F4YA 1H2TZ 4DYYA 4XTTA 1LKMA 2XMTA 1XQIA 3L9ZA 1DATA 3RRKA 3BQ0A 5DDRC 1GMWD 4PXCA 2AR0A 3IAS9 4YXJA 3HZGA 3NGTA 2WB1D 4EGLA 3C15A 2GS4A 3EVWA 2AIRB 4J37A 2HR5A 4KO0B 3HSJA 3H5UA 1RGVA 4DS5A 1CJKA 4P2XA 2DNRA 4MIAA 1EARA 1VQ4S 4TLRA 4KKOB 3ZTQA 2DNHA 1SCJB 2JLFA 3P45B 1KD1T 4IG0A 1SVDA 1FRXA 5EX3A 5GADI 3H20A 3FC9A 2V4JB 3IBWA 2XHWA 3HHEA 1FERA 2DR5A 3LW5C 4C0BA 3N6LA 1VFJA 3EICA 1C0UB 1U2CA 1CJUB 2NLWA 3VCDA 2LA4A 4DSEA 1NPKA 1J30A 4KV8A 1P1TA 1VS3A 1JKUA 4DUTA 4FP9A 4XKSA 3ZZZA 4DPYA 2YW7A 1QD1A 3KUGA 3H2UB 3BYPA 4F2SA 3C1YA 3FNNA 1I3OB 1TKXA 3EDRB 2HTNA 1PKUA 1EB0A 2KFNA 2DHHA 1LKPA 4OX9F 3K5NA 4AM2A 5A8KA 4Q44A 1WC6A 3LUYA 3MEEA 2RDDA 4O4GA 4LPNA 2OSQA 5HROB 1QY7A 3QWUA 3GFHA 1WI6A 4UOCA 1TFWA 4R25A 4JV5J 4ELVA 1SJQA 4NE9C 2ZH3A 2CPIA 2AGQA 2A6MA 4CO4A 2OAUA 5DG9A 1XR6A 2W2NP 3P3DA 4X66F 4LF9J 2WHOA 4B3SF 3E1JA 1QYBA 2NCKL 2VDHA 2RJZA 5ADZA 3I31A 4A8YA 3W5ZA 4A8XA 2IY4A 2EC0A 5CD4A 1IJFB 2E1RA 3FDSA 3NBPB 4C7QA 4P71A 3PW1B 5J2QB 3KDOA 3UE2A 1LKOA 1QE1A 1IWGA 5DGAA 3QNWB 2G1HA 4R5PA 2JSXA 3PVTA 3GZ7A 1WHWA 3F35A 2YXLA 1Z1ZA 3PJXA 4RW4A 3CJRA 2HNYA 2V2QA 3PVXA 2XO6A 7FDRA 2B5JA 5EX0A 4QIVA 2ZC4A 3VWSA 4RWWA 4MJKA 4K4YA 1OY6A 4HVZA 2HHTA 3KYLA 4LPJA 4M5HA 1RWKB 2J7WA 1EP4A 2XLKA 3E51A 2WVBA 2HLUA 1TL1A 2E1MC 2VPYB 4AT1B 2G0CA 2OHDA 4C97A 3FKBA 2Z2YB 1D1UA 3UPFA 3HPOA 3NNHA 3D68A 2FD2A 2K3IA 1S10A 1OS5A 2E7WA 4C3KA 1ACMB 1ZTWA 3UD3P 4ZVQB 4GC6A 3ZZTA 3THVA 4V1Ak 3RBDA 2C2RA 2CQBA 3KKFA 4MIBA 3THTA 2M52A 2LQBA 4WIIA 1GAOA 2D74B 2IAJA 1Y5NB 1E6VA 3D9BA 4URGA 3EWGA 1QTNB 2GNKA 2BQ3A 3FRRA 1HQEB 1LK5A 4BWJA 1OPZA 3QQCD 4QPTA 3QZ7A 5KT7A 1VJWA 3HHLD 4FVMA 1Q5YA 2HHXA 1Q16B 4JI2F 2VG6B 4N47A 2WBRA 3CCMS 1HW9A 3ILLA 3KK2B 2MGZA 3BREA 4X64J 3OXGA 2V2VA 4PKDB 3CVKA 2CVIA 2G38B 5GMEA 1FRMA 3E1MA 4II4A 1FXLA 4DR5F 3H59A 3TAMB 2IA6A 4PG8A 2UVWA 3EPIA 5GN8B 2AMCB 4LT6A 3IQ1A 3Q8QB 3KA4A 4CWBA 1U1NA 2X3GA 1YWXA 4YQWA 4QYRA 4ZHRA 1MROB 3ZFVA 4I7FA 4L3NA 2W7PA 3TZZA 3F36A 4P10A 3U27A 3BVFA 4CNZA 4OZ3A 4CO1A 1NJWA 2D1CA 2YY3A 3RJMB 3IWXA 1SBRA 2EG2A 2KJWA 4LQVA 3PW5A 4JI8J 3TUJC 4W4KB 1CJTA 4K5SA 4IKAA 1HHSA 4FF1A 2K7JA 3SBMA 1JB0C 1TL4A 1LB3A 3HM9A 9RUBA 4MY7A 3TARA 4CNYA 1UWAA 4QIFA 4HI2A 2X1FA 2VV5A 4PWDB 3C23A 8RUCA 1FTCA 2YBVA 4A8FA 5DDQC 3R2KA 2CQGA 3POTB 1U47A 3G4SS 3NXZA 2XNQA 3ILJA 3NP5A 2ZBRA 1ZOTA 4ZTTA 4A48A 5CHCB 2YX4A 3KJVB 2L41A 4WE1A 4QZVB 2CPJA 5M2UA 1K1QA 3AHPA 2AJ2A 2G2OA 4DSKA 1KLMB 2IYIA 3ITHB 1R31A 3FCVA 3M2UA 3J7A1 4DV7J 3M1VB 2RU9A 2GMHA 2V8DA 2H48B 3IG1B 2I6WA 2WWXB 2ASLA 2QA1A 3SQGA 2ERRA 2EKNA 3T3FA 1X4AA 2EBEA 3ICLA 2DKOB 5FFDA 2MGYA 3R2HA 2GYQA 4B3RJ 2MDAA 1SJRA 1LWEB 3OLAA 5HP1A 4C8ZA 4B9VA 2DHAA 4LF8J 4JI7J 1S76D 2HFVA 4KB7A 4B9NA 2RDIA 1EX8A 3MOJB 4NCGA 2VKRA 3ETOA 2RSQA 5C42A 2ATLA 2M9KA 1MMDA 1Y11A 3BBCA 3OSPA 3OPKA 1KKHA 5T14A 4O0IA 1TKDA 2YNFA 3M32B 3MM5A 5H1SV 4CO2A 1DPSA 2ZA8A 1KOHA 2ZBQA 2VQFJ 1TL7A 3FSXA 1BQXA 3CJTA 2FKZA 1S59A 1RLDA 1BUXA 3QSYB 1FDBA 2OEJA 3KLGA 4NYZA 1T05A 1YJRA 2XLJA 1ZZFA 3N0VA 1NMEB 4WBFA 3NGDA 1I1GA 3M6JA 1OWXA 1D0EA 3D67A 4YP3A 3OHAA 1G1XA 3AA9A 1S9EB 3ISZA 4X65J 3TX0A 3B4DA 4I6AA 3RW7A 2CNKB 2B3TB 4KFBB 2SXLA 4RW9B 2NREA 1YG0A 3OVBA 1U1QA 3I4HX 2BE2A 1NJIT 4IFVA 5HN0A 1S0MA 2LXFA 1NXIA 2RHSB 4WIQA 3SV3A 3GGYA 1TZ0A 4FF3A 4IH5A 3C14A 3G8QA 3GV8B 5KFLA 2KN4A 1NK7A 1FEHA 4Y34A 2RBDA 1LW0B 3NCQA 2R2RA 1XN9A 4AL7A 3K2YA 4EYIB 1WACA 1IKVA 1EQ0A 3A3PB 4UY8T 1JX4A 1GNKA 1FFSB 2LXIA 3IBFB 2VC1A 4ZVRB 1WSVA 3DLEB 2LCWA 4UZBA 3CULA 4WJG4 1QM9A 2VH7A 1EETB 3IS8A 3BQ1A 2ZOGA 5D8RA 1K73T 1J5OA 4TY9A 2K3KA 3R7BB 1RTIA 3W2VA 1Q7YT 1JLGB 2ZE2B 3GVYA 3DXBA 1WC5A 4JP8A 5B0AA 2DCUB 1KFSA 3A8EA 1HLWA 1W2IA 5KFNA 5EWGA 3QJLA 1AROP 1RCGA 4LF1A 2FHAA 4NLOA 1UWBA 2J6TA 1N4LA 2GZOA 2GV1A 3MEDB 3OFGA 3LP1B 2AZ3A 4DCOB 2ZHBA 5ETLA 4WP9A 1NSPA 4PG1A 1G6BA 4Y08A 1DTTB 1HBOB 5KG4A 2HS4A 2UUCF 3RGDA 1L5UA 1D9AA 4ZVGA 2FDNA 1U1MA 3FQLA 1NCLA 3AF9X 4LQNA 4U67Q 1E6YB 5L9XA 3AD8C 3L0MA 4LFBJ 3UOIA 2BANA 2BOAA 3QMQA 2HNZA 2F40A 1LWCB 3GYXB 5GADU 1AB8A 4W92B 1YBTA 1IR1A 1NLKL 4ITTA 1RWMB 9ATCB 2XQCA 1NK6A 4KE5A 1SOFA 5CQGA 3IN5A 3AB2B 3CCRS 3K0JA 1K0VA 4X2BA 3BO3A 4YR2A 5DZ7A 2DITA 1U0SA 3HHLB 2MTLA 4C9DA 2EG1A 1NRKA 1HWIA 3KK3A 2G2ZA 3DMJA 3BSAA 1HYSA 4DUZF 3BH7B 2Q43A 3NNAA 1CS4A 2J0XA 4DV2F 3V4MA 4OYOA 3J81j 3HFZB 2XULA 4B3TJ 1JLCA 1Z6OA 3D3BJ 4IR9A 3KJFB 1NAQA 2NZ4A 1JGCA 2WTFA 2MPUA 4L72B 4NWBA 3NWGA 2YKQA 1RJJA 2RAQA 5G4DA 2MKYA 3HHNB 3DI6B 1FESA 1R03A 4CLTA 4A46A 3HVTB 2F4VJ 3B4MA 2WONB 4Q0BA 2MQMA 4YOEA 3C3LA 4YVZA 4P6QA 1KQGB 3KMQA 2HVZA 3VALA 4ZPDA 3I0RB 1XZ3A 3R7SB 1IR0A 3HX9A 4CT8A 1ZPVA 2Z56B 2OUGA 2Q79A 3M2VA 2ZH7A 2YVSA 1YHQS 3I55S 3JZAB 3AOBA 2HW3A 1HNVA 2HHSA 3TJAA 1HWJA 3WIVA 2R8IA 2KU7A 3PIPQ 4LF2A 4ECXA 3O1LA 1WKJA 3EVMA 1M5VC 2YWWA 3BGRA 1RT1A 3D6TB 4X4OA 4WTOB 2FY8A 3GGZA 2IDLA 3CCWA 4CH1A 1S1WB 4PG6A 4C2MA 5KT4A 2H51B 1FRHA 2E1AA 3IRXA 3FJ2A 2DNQA 2YNGA 2IU2A 5KG0A 1DQ9A 2NUUG 2GO9A 1WKLA 1LOUA 2O1PA 2R9LA 1SXLA 2MY7A 1MN7A 1XERA 2JD80 3MEGA 3P6YC 4JI5J 4OJ3A 3MECA 5D8HB 1UEVA 1U6ZA 1REVA 3W65A 2W9BB 4I6WA 4K0KF 4DR7F 2J5AA 1Y7PA 2EEYA 3QIDA 3SEOA 2KT3A 5IX6A 1KWMA 2HFZA 3W9JA 3AF8X 2NXCA 4ZKHA 2MSTA 5A6WA 3MGJA 4EFAC 1RTHA 1F30A 1PILA 2XMVA 4M5DA 2HAFA 1IN0A 1F33A 4ZPCA 1NJYA 4CP5A 4FBTA 3W2WA 1MU2A 2QC3A 4R0EA 2B9XA 3J81Y 2R7WA 1LW2A 5CYQB 3GONA 4UOHA 2OSRA 5J8SA 4HHJA 4FYVB 4DEZA 1UAWA 2QA4S 2WAQD 2VA2A 3GILA 1VRUB 3DOMB 2E7VA 2AYMA 5DLGA 1YBUA 1XMQJ 1FKPB 5F8GA 3PKYA 1YJNS 4UUXA 3C66A 4LSNB 2GJ2A 1F2HA 1S1XB 3CF5Q 2A0FB 5CYMA 4NMXA 5AE1A 4ZA1A 2J9DE 2Z2ZA 1RTJA 2XJNA 3JSMB 3NS5A 2X1BA 1N52B 4C48A 3H2VE 3CDWA 2FJCA 1QSYA 2B9EA 1RTDB 2IVFB 3PFEA 3DRSB 2XKQA 1RTZA 2F7NA 4OZ2A 4DG1A 3BVIA 1RAFB 4P2FA 3NS6A 2B6AA 5A8WB 2HYIB 4RBUA 3MM7A 1NKCA 4DX8H 1JIHA 4RW8A 3RAQA 2DNMA 1RT4B 4RC5A 2WOMA 1YRUA 4NXNF 5L8RC 2ZZMA 4DMZA 5D8XA 2YKMA 3WIUA 4ZVFA 3MMBB 3I0SA 2CNNB 4JI1F 3ZC4A 3PWFA 4D3HA 1PYTA 2COLA 3C46A 2NUHA 3VF0B 2V2JA 1VHFA 2GJFA 2HGMA 2R2SA 1IKYA 2LU2A 1YJUA 2C3UA 4AE5A 4U6PA 2OTLS 3UI3A 1V6HA 4DV6F 4NLSA 4OLOA 3LF0A 4ICLB 2GVZA 1HBNA 3M4XA 5B0DA 1H3DA 1SV5A 3GCWP 4DL7A 3U1LA 3WZ0A 4XK8C 2P9CA 3MWBA 2ASJA 3E1QA 1EZZB 2M5YA 3UVJB 1L3KA 1MNEA 5F0UA 2E5JA 3DRXA 3OFHA 2XTJP 1R8PA 1XMOJ 4Q8EA 1MMLA 1MLAA 1H96A 4IFYB 3PW8C 2ZG7X 4DR3J 1RSCA 1SQ3A 1PO6A 2RRNA 2RUGA 3HLUA 3HCXA 4Z7CA 4A25A 1B70B 4KC5A 1L3SA 4Y65A 5J2PB 3DGPB 3OJSA 5KFPA 5L38A 1M5OC 4NYOA 1B0PA 3QT6A 1I5OB 1SQEA 1X5OA 2GHPA 1ZA1B 5EN1A 2F9JA 3UDCA 1RHQB 4O0NA 4KVRA 1MOJA 1T9VA 4QQBA 4M95A 2FVQA 2LFVA 4NZ0A 5ETMA 1JLAA 4RC7A 2P6TA 4LF5J 2YWEA 3EJMA 5KG7A 5E7OB 2RRAA 1BG7A 2CQ2A 5J2NA 4E6KA 5HJYA 4NEZA 3D6FB 1Y5IB 5A0YA 3RGIA 4LQJA 2H1YA 3MUMP 3NLCA 1DBDA 1WTBA 4JV2A 5HLFB 2EPIA 2LXUA 2NSCA 2VQEF 3RBXA 2GAHC 4TYBA 3OL7A 5B09A 4X4VA 1OY9A 4ZJKA 4YDDB 2EK1A 1H74A 1JTSA 2WK4A 1D8YA 3OJUA 2UVVA 3AJ1A 4L73A 1N0UA 4P52A 3D7SB 3RAVA 4YN3B 4NCBA 2KL8A 3TJ8A 5D3GA 2YPZA 3M30B 5EDWA 4C98A 3NNCA 4JI8F 3EGMA 3EUNA 4KO0A 1HQUB 2D3ZA 2GIQA 3PWQA 4ID5A 2OI2A 4CLYA 1IXKA 2C2DA 1Q8BA 2DNLA 5AT1B 3SI8A 3Q2SC 2C28A 5LM7E 4ECZA 4K50A 1PYSB 1C1CB 4HDGA 1VRQC 2VONA 4QYZK 1XNRF 1FDNA 5IT9U 3ES3A 1FKAF 4TYAA 2V4JA 3D1OA 4PQUB 4IG3B 4TOCA 2KRRA 4PG5A 4ZPWR 5KG5A 1C0UA 2YTCA 3QT5A 3R2CJ 1CJUA 2EXUA 3PW2A 4JI4F 2FLNA 5THWA 3M6WA 3W5XA 3TZYA 4U95A 1UVNA 4GKJF 2ADBA 4DU7A 1UMJA 3PNIA 5FLXU 1G2EA 2UZAA 4J9LA 3E2EA 2XM3A 3CO9A 5A2QY 4DI0A 4DJBA 5JXSA 3C15B 4QUWA 1YVFA 1B71A 4EZ6A 3NOCA 5LS9A 1FEEA 4EUVA 5JKMA 1TV6B 1ZAWA 3FEYB 2QLXA 3HK2A 5KFVA 5HROA 2ZM6J 3GIRA 2C2MB 4MKAA 3LKDA 2FHKA 1L3VA 1DQ8A 1DFDA 3GIJA 1HWLA 5JMNA 2GQQA 3TRGA 4NYPA 4YMEA 1N34J 2RH3A 3FCHA 2QMWA 2NYIA 2UU9F 4YY3J 2ZH1A 2ASDA 4YFUA 2CZVC 4KV8B 2KO1A 2AW0A 2L9WA 2XMMA 1QAXA 2J7KA 3VGVA 1NHVA 3CJ0A 2OELA 1B64A 3NBPA 2XS2A 1TJOA 3PG9A 4LYUA 5J2QA 4FF2A 3CW2C 1AFIA 3J7AN 4Z2XA 1TVRB 4FPIA 4ILMA 1TKXB 1B3TA 4NXMJ 3Q4NA 4K2XA 1MMNA 2QYGA 1PC5A 2BEFA 4X4SA 4FKXA 5HMWA 3ONQA 1M1HA 1KC8T 3CCLS 4FBUA 2R8GA 3PCOB 1KHVA 3KG4A 4PWWA 4U9RA 3NGRA 3ZTPA 4EVEA 3BPSP 4ECTA 4CYUA 5E3RA 1WEZA 3IR5B 4OJGA 2APOA 1HMVB 4M94A 3W9IA 4CI0B 3P49B 2QYCA 4DX6A 2XYHB 2CPYA 1Z2LA 1FO1A 1FF2A 1Q5VA 3BO2A 1YJ9S 3UO0A 1REGX 1NF6A 2M4MA 2DJWA 4ERDA 4DQQA 4J9SA 3UR3C 4DV1F 2HKEA 1HR0J 1UA1A 2DNKA 1G4CA 4FYDA 3AJDA 2JWNA 2VKZG 3GSIA 3AFGA 5LG8A 2CQDA 2IM3A 2UXDJ 3T1HF 1U1PA 2W9CB 3O7RA 4MUDA 1YV1A 1QE1B 3FZBA 5KFFA 2QZ8A 3W1YC 1JK9B 1UFWA 1TKPA 4R5PB 2MSSA 3M6VA 3W5YA 2Y1JA 5FDLB 2IFXA 2YKNA 4DV5J 4RUBA 2YNHB 1F6TA 4REUA 4DR4F 1QVGR 1HI1A 5I42A 3GFYA 3NAHA 3NG8A 2VG6A 1U45A 1B7YB 2BJ3A 1FD2A 5L46A 3KK2A 1ZS6A 2BJ8A 2B5JB 5BR8J 2R8HA 1KTQA 4DSJA 5F8JA 2AEMA 3BGFA 4DHVA 3GJTB 4N7TA 1TL1B 1P9YA 2W8LA 5IWAF 3TAMA 1X5PA 2VIHA 3T9JA 2J0WA 5KFEA 2KYZA 3LGMA 2FZKB 1SKSA 4ZLNA 5K9FA 4R8UB 3QFWA 1F0XA 2B43A 3VZHA 1X9SA 1QVFR 3NL0A 5LBHA 3A9QA 2DGTA 3LWLA 1MROA 4F26A 3CXCR 1UEUA 4TOEA 2KKHA 1E6VB 1HNWJ 2Q66A 2UV8G 1TK5A 4DF4A 3MI7X 3RTVA 5D0HA 4E8UA 1SUQA 2YW6A 2C2JA 4HYKA 1HARA 2XGPA 4V19X 2PFFB 5LMNJ 2MGZB 4C8LA 2CLUA 3A3NB 3FMWA 4WP8A 4PYAA 4Q2MA 4QWDA 4DDFA 2W4CA 5HQ8A 3R8YA 1N32J 4KT0C 1UL3A 4JI6F 3QGGA 3MPWA 4PWDA 1NU4A 3NP2X 3AJPA 3ENAA 4ALZA 1ULRA 5GOUA 4Z3BA 3GFXA 3POTA 1FK9B 2P9GA 2ZBIA 2JFDA 2UXCF 2P9EA 3FRZA 4USJC 4LQHA 1P8GA 1GXLA 5D0GA 4IOBA 3QJPA 3DLGB 1KLMA 3D3CJ 5K8PA 3ITHA 1CQNA 2UUBJ 5JKLG 1K44A 2HQFA 1PJ5A 4LR9A 2RU3A 2MKSA 3IG1A 5FD1A 2XS5A 4DUYJ 3W54A 1OPIA 1RDRA 4HLBA 3KK1B 5CZVA 3SE1A 2VB6A 2J9DA 2W2PP 3JAMY 4LFCF 1GMUA 2B0GA 1LWEA 5KFXA 2CKWA 1GMWA 4ECVA 4ES1A 2QLFB 5FFEA 3WHIA 2VOOA 2HSEB 4ZIVA 1N36F 2RHQB 2GHVC 3PO4A 2BKNA 1YRTA 1O0PA 3FEZA 1RHKB 3T1YJ 1N33J 2DHXA 2EFPA 5CZXA 2V6AA 5K53A 4KGMA 3D0IE 1M90T 3HF5A 3CJ2A 4Q7AA 3IXQA 3G6XA 2OMLA 2H5IB 3OTOF 3M2UB 2F63A 1KLNA 2F8EX 4DV4F 4EZ9A 5C24B 5KFJA 2BW7A 1SQGA 1U1OA 1JWWA 1T0TV 3UCZP 4LBHA 2X51A 2KDOA 5ETOA 3SSSA 1V3SA 1S9EA 2R7OA 4I6YA 4KHMA 3LP2B 4N5SA 3OTDA 3SXLA 2HQGA 2BQUA 1GQEA 5K5MA 4KFBA 4RW9A 1FX4A 1T9YA 1JXLA 4DR6J 3E01A 2LQ8A 2VBYA 1IBMF 4F2RA 3VGSA 3N5FA 3S8SA 1HNZF 5HK4A 1S6PB 3MDFA 5GU3X 3UCUP 3MM5B 1VQ9S 2V68A 3F39A 2CFXA 4XKUA 2HLTA 1KS2A 4ZJQA 3BSOA 3CJ4A 3R1HA 4YB7A 1HPZA 2HVHA 2CG8A 2MQQA 5HSPA 3M6UA 3MXHP 2L3MA 3Q8SB 2RS2A 4ZDNA 3QO9A 4DV3F 4IWJA 2N7YA 2MQOA 4DLGA 1IBKF 2JX2A 1NK9A 1N1QA 5KFIA 2A2CA 2W1BA 2BACA 2AYEA 5ETTA 5IM0B 3V5RA 2KZMA 5LL6d 4WXOA 3EZ0A 2VASA 4CVRA 3K5MA 1JLGA 3MAAB 1Q8LA 1DHMA 2ZE2A 2JLGA 2DH7A 2R4FA 3MM9B 3VGTA 1FWKA 3DU5A 2H5JB 3IR7B 3ISFA 3N5BA 1K1SA 1EKRA 3U7JA 3H25A 1U1LA 2ZZTA 2KG1A 2M8HA 3C14B 2MKKA 5CMQA 4CVPA 2KFZA 2D3O1 2OO4A 4YXMA 1WHVA 2CIHA 3TANA 3MEDA 2ABYA 3LP1A 3PEHA 4FS1A 1VDHA 1VQ7S 1KHWA 4DXLA 1DTTA 1VQ5S 1HBOA 2P8IA 4OYPA 3CMES 5KTQA 1W7WA 3IMQJ 3UQSA 4LF7J 3TZWA 2KT2A 1E6YA 2WSFC 1WTFA 2CQIA 3K7RA 4M5GA 2ZH9A 1U25A 3SIPB 1Q81T 1AW0A 1LWCA 3W2VB 2ROGA 2GO8A 2JVOA 4RU9A 4K4TA 2Q1LA 2XMWA 4C4WA 3ISEA 1YKWA 1FT8A 1S48A 2A2DA 5DDPC 3KJNB 5DZ6A 3F37A 2ZHOA 4TOHA 2IDEA 4K7QA 3H8YA 1R89A 2QIFA 3A8KA 1GX5A 2J8AA 3UNOA 1FJGJ 1SC6A 3HHLA 4FS2A 2HFSA 4CQ1A 2ZWOA 4OYAA 3TI0A 1UVJA 3U1NA 3O44A 2W25A 1NO8A 2R3VA 4F4XA 2CZ4A 3CUNA 4DL0C 3H98A 2CN7A 2QLBB 3KLFB 2DGSA 2JZ5A 3ZTSA 1AA1B 4C8MA 3AH6A 5IC4B 2HRTA 2MZTA 4MKUA 1CC7A 4JYAJ 1XBWA 1WELA 4WPAA 2N3OA 3HL1A 3KNAA 4DL3A 4RUHA 1U2FA 2KVQE 2OJ3A 4C8OA 4LF6J 4GC7A 1CQMA 2FHJD 1U4BA 3DI6A 3E1PA 4OYMA 2ALYB 1HA1A 1RCOB 4QR1A 4YHHJ 2YWKA 3ZXWA 3NP0X 3HVTA 4I4BA 3UDVA 2MLZA 1NEEA 2WONA 5AE3A 3V6KA 2V4QA 5KFSA 2IA0A 4P75A 2FJBB 3GIMA 4OI3A 4U7UK 5CAAA 2EFVA 2QSFA 3C6UA 3BH6B 6AT1B 3I0RA 3IM9A 4G1QB 1F9EB 2NR0A 2ILZA 4F3OA 1FWPA 1WI8A 3I96A 3ZTOA 3KK3B 3DMJB 4ZOSA 3CO0P 3V3KB 1RLCL 3CWJA 2E29A 4F4KA 4MAKA 1IBLF 1FFWB 5KOXA 1RYRA 3CCTA 2AYBA 3RAMA 4EBDA 4F0MA 1RADB 4J9NA 4ED5A 2HHHJ 4LR7A 1VQMS 1HNXF 3CCES 4FXWA 3KOAA 1JLCB 1YJTA 4P73A 2PO4A 4RNOA 4ILLA 5FFCA 3CD0A 1FJCA 1BFRA 4ZLLA 4QYZJ 4OX6A 1VEIA 3BBBA 5DLFA 3QAUA 3HDSA 1FDDA 3K5PA 3F0NA 1ZZNA 4O3RA 4TODA 2KHDA 3A8JA 3I32A 1L3TA 2JD70 3AT1B 4DYUA 2H9ZA 4WXWA 2OPRB 1HBMA 2XSJA 4L76A 3RG6A 2FHMA 1W26A 1RU1A 1S49A 2G4BA 3SCIE 2CJAA 4GKKJ 1OQ3A 1RT7B 2C2OB 1Y9OA 2MZQA 4K59A 4LBPA 3KWMA 1X8DA 3TVZA 2VXXA 2KJVA 4PCQA 5HMYA 4RL1A 1RT2B 6FDRA 2E1PA 3A68A 3OT9A 5GVQA 1FNOA 3KA8A 1T8EA 4F50A 1J5EJ 1X5SA 5CMRA 3NGUA 3HD2A 1M5HA 2C3PA 1NDLA 5E33A 1N5TA 1SKWA 2VPXB 5CYJA 5F9LA 2PEBA 5KOWA 3CJKB 2I8EA 4HEA9 1JLQB 4TLQA 3R2LA 3R9LA 1LNQA 5KG2A 5DM7Q 4B17A 3CCQS 4EU0A 2E5IA 4F3QA 1X60A 1S0VA 1N56A 1B0VA 2AKWB 1F3FA 4JI3F 5CYQA 3BVLA 1VQPS 5LG2A 4P9SA 5LSRA 4U8VA 2UUTA 3W64A 1Q95G 3CC4S 2Y1LB 1D09B 4FKYA 2X7IA 2VA3A 5KFCA 3DOMA 2V2IA 2VFRA 1QLNA 4M5NA 3MPUB 1FKPA 1MWZA 1X0PA 3AJOA 1R0CB 1RWNB 2Z90A 1Y3JA 4LSNA 1T3NA 3QLHB 4WFAQ 3QVDA 2IMWP 2KZZA 2EFGA 4OV1A 4FXDA 2IY5B 2OMOA 3HSGA 2J6UA 4RU2A 2E7XA 3MUTP 3AQOA 4IR1A 4ITSA 4WTYA 4NMLA 2HK3A 5G0RA 3DFEA 3E8OA 3JSMA 4G1PA 2CHPA 3OVAA 5A76A 1RWXB 1CVJA 4J5OA 1UVIA 1RTHB 2MZSA 3G82B 1URNA 3BS9A 3BT5A 3SIDA 1RTDA 5HAOA 3GJRB 1NB7A 3DRSA 4M1KA 1ITPA 1X5TA 1R27B 3H42A 4PWUA 3PVYA 2FZCB 3GHQA 5A8WA 3SSRA 3EYZA 1VQOS 2FZFA 4B9TA 2VUGA 1RT4A 1VEQA 4M32A 2GMJA 1AZSA 3R3TA 3KWOA 3PFOA 4K4SA 1WF0A 2VJVA 4LREA 3DN9A 1EQMA 4ID8A 2HHWA 4NXMF 2ZHAA 1FE4A 4DF8A 2QSWA 2AJ4A 3B54A 5HQOA 4GVLA 4MH8A 2QMUB 4TVAB 4Y0FA 1H6KX 5FJ4A 2J6SA 2E9TA 3VVTA 4K4VA 2E5GA 2ILYA 3F34A 4KR0B 5J2MB 3GR1A 2E9ZA 3WC2A 4ZN3A 4S0MA 3L7PA 3WVUA 3Q24A 3G6YA 4LMZA 1JJ4A 3UVJA 2C6RA 1DURA 1T03A 4O23A 4NI2B 1YLXA 4X4PA 4RW8B 3FZ2A 4RC5B 1BQNB 1OY8A 2ZBPA 2CWXA 2YKMB 2CUYA 2V9KA 3I0SB 3PDNA 3JQKA 3PW4A 2VODA 3PY8A 3UFBA 4DV0F 5D8QA 5J2PA 2DISA 3DGPA 3MAHA 2CNOB 3BDEA 4ZKXA 1CJVB 4DPXA 2PN6A 1X4CA 2HHQA 4ETRA 2V2MA 5CA5A 2RQMA 1HBNB 3MM8B 2KVIA 4GRSA 3QZ3A 1S5ZA 5CXTA 1VR6A 3KHKA 3BV8A 3PVRB 2BRLA 4KQZA 4KAIA 4ANDA 1FDAA 3TA2A 3W66A 5KT3A 2JEGA 3OUYB 3CGIA 4W4LB 1R8CA 3EE3A 2PYBA 1FVSA 1IESA 1B0TA 3P8BB 4DPUA 5HLFA 3SCJE 3V81A 1KOOA 3J7ZT 2HPUA 2QT7A 5IV3A 1RAAB 3N01A 5KG1A 4PPZA 3FSIA 4B08A 3D1QA 1C4CA 2AF6A 1DJ0A 2MB0B 2M0GB 1G3OA 3A8IA 3HKWA 3TYTA 1U2RA 1HRSA 3M30A 5A8RA 4M5MA 1NNQA 2HG4A 1NSAA 2ZKUA 2CJKA 2VC0A 3ZZRA 4WKYA 4OYXA 1JLAB 1TR0A 4QWAA 3Q0AA 1RYSA 4PRFA 4I67A 1AYEA 3JXOA 3R1LA 5LOQA 1C1CA 2B51A 4H4MA 1I94J 2C3OA 3PTWA 4TQSA 1V3ZA 3TUZC 1F5CA 4IG3A 4KHPJ 4H54A 3FRSA 2ZH6A 1FE0A 3FEXB 1BMQB 3N9UC 3D1HA 1AT1B 1S9GB 4YKHA 5E1UA 4PAAA 3N6MA 2QX0A 4DX7A 4ECYA 2WBMA 1FWLA 4AD6A 3F73A 2V2KA 2R7UA 1FRJA 3UCGA 2HIQA 2CDQA 2R8JA 2LMIA 5CD4H 4ZL5A 4IUFA 3HI9A 4J9VA 2UXBJ 2BE9B 2GC8A 5D3GB 3X1LB 5BYSA 2E5LJ 4UOFA 4R0JA 3BM7A 3HFKA 4MFBB 3KHGA 2GX8A 2KG0A 1RWOB 1RT3A 2GVDA 5EGYA 4ZPAA 3R5DA 2KYXA 1TV6A 1ZTTA 3KA9A 4GVBB 2LQ5A 4ID5B 3WQPA 3T1AA 4Q8FA 4RBTA 4RO0A 2ZG9X 4PR6A 4Q43A 4LR8A 3MOZA 1RWPB 4K8RA 3QRQA 2W9AA 4URQU 1F60B 1C4AA 3CD5A 4BCAA 4NL5A 3E6SA 1TP7A 2ZBCA 2ZDOA 4OL8A 1VISA 3D5MA 2MZRA 1SJ3P 2AJQA 2Y8YA 4X62J 1ZM9A 1OYDA 3RZAA 5DRKA 3FCWA 3EGNA 2AP6A 2X1AA 4Y2MA 3WBZA 3W63A 1Z4AA 3R6GB 3QSIA 1S12A 2L48A 3IGNA 1QDUB 2BKPA 4IO1A 2EVZA 4DZDA 1RUSA 1TVRA 4DX5A 1RWUA 1JNZB 4XO0A 4PG7A 3VAFA 2FGOA 1KFDA 3BF4A 3W60A 3PX0A 3TX8A 4Z5SA 4E0DA 4A8MP 3N6NA 3AD9C 5D4NA 4DCJB 4I1TA 4XPEA 5GMKa 1U49A 1NUEA 2XY5A 3G6ES 3EZ5A 3R2SA 1HMVA 1UJ5A 1KONA 3TR5A 3LWMA 4EEYA 5HVFA 2DRBA 1MW7A 4B3MF 2B56A 2JVRA 3BN4A 4PXEA 1VQKS 4M5KA 1UVKA 1VQ6S 2DTJA 4OYNA 3EMTA 4CH7A 3TAQA 2UUAF 5KFHA 1OSCA 4HHUA 4M5IA 3PR4A 1NPPA 2JFKA 2IC3A 4PQAA 4LVNP 5KFGA 4EWTA 2XG8A 1RISA 2V8TA 3CNQP 2W9CA 3PRDA 2E66A 3S7RA 3RD0A 4QIEA 3DLJA 3C19A 5LJ5Y 2V34A 4UY85 5T41A 2KFYA 4ZPVR 3DDIA 4LYXA 1URRA 2CADA 2J0SD 3THPA 1KVKA 5FDLA 1JLFB 3LO3A 5AXNA 3FBEA 1C0TB 2YNHA 4QPXA 4DR1F 3D0HE 2MLXA 2PC6A 4CYUB 1QAJA 1XNQF 4MKVA 3HHKA 3RR7A 2AHOB 5H9EK 4RLEA 2HS0A 2VPWB 4OX9J 1Q4RA 3IS7A 3BGLA 5J1EB 2XJOA 5LJ3Y 1SQFA 3GLJA 3HVAA 1RHJB 2FYXA 5GU1X 4DYZA 1YGYA 2CQCA 5IT0A 2PMWA 3D0GE 1S79A 4DFKA 1RHMB 1FRIA 4ZCIA 4ECUA 3KLVA 5JVGQ 3QRRA 3DRPB 5HU6D 3G86A 1JKHA 2KHCA 2Z6MA 4X66J 4R8UA 5T7LB 5B0BA 3TAPA 4WYWA 4B3SJ 2BZ2A 4EVDA 2VG5B 4ITWA 5I3UA 1FI4A 3EPGA 3PHTA 2B4PA 2B4OA 3WVWA 2YKNB 4A8WA 4CMYA 3Q83A 3I9ZA 3BN7A 4DZ0A 2YNIA 1NZAA 1YBAA 1V5IB 5I42B 1CBKA 2PMHA 2Z2MA 4ZLJA 1YJVA 5C25B 2HHUA 2RVJA 2OEKA 4RPFA 4ED0A 1BD6A 2EFQA 2OLWA 4OZLA 1NK5A 3D66A 3BPDA 1YJ7A 4CTAB 3SFGA 2N7CA 4ZCLA 4YR0A 4DPOA 4LJMA 2DHGA 2K7KA 4W4MA 5IQ6A 2BQRA 3OTBA 4BDPA 3BR9A 1RK8A 1WHXA 3E2CA 3US5A 1FK9A 1BGXT 2U2FA 4RNNA 3LP0B 4AM4A 4QW8A 4TO9A 2ZFHA 1X31C 3OFFA 3MM6B 3DLGA 4YEAA 2FVSA 1KBRA 1UPMB 3PKMA 2D41A 2RE1A 2PDAA 1SUQB 2HFUA 3MD3A 3P96A 2V2PA 2H3EB 4ISPA 4HT7A 4Y00A 1U02A 3KK1A 2V8UA 4Q2LA 3V4IA 3R5AA 1N48A 2DK2A 4USKA 4KGXB 3WX8A 2OP5A 1EIYB 1VC6A 3GYGA 4JI2J 5DG7A 3U1MA 4NZ7A 2CZ9A 2G13A 5E3PA 4RW7B 2FJXA 2AV5A 1QUPA 5DETA 3RRGA 3DKDA 2CRLA 4I0WA 4AQYF 1J2VA 2AZ1A 2XB2D 2WB4A 4J9OA 5KG6A 4DR5J 3H5YA 1WEYA 1N8RT 3AB4B 2N4DA 1QSLA 3NOZX 2ZVSA 5E0OA 4W98A 2MZ1A 2FFXJ 1QTMA 3R2RA 3KUHA 2PI4A 2CLBA 1QJHA 5J1NA 3VV2B 3J81U 2QLJB 3ZO7A 2NPFA 3PZAA 2NXNA 3A12A 4OI4A 5JACA 2AGOA 3C16A 4DSIA 5C24A 4WZQA 2KB2A 4DL5A 2Z5RA 1T9TA 4USUA 2BR0A 1Y00A 3R27A 1HFEL 5L1IA 3PW7A 2F4FA 1SH2A 3OFEA 2XC9A 5GU2X 1IERA 3QHCA 1F3VA 4FYYB 2FJVA 3LP2A 1SL0A 4DI6A 1OO0B 2YQ0A 1OIAA 4MIWA 3T6BA 4IDKB 4CLSA 1LK7A 3I6PA 1TMMA 2RIJA 5U47A 1S6PA 3Q8PB 2XBPA 3BQ2A 3Q8RB 2W0OA 2DXFA 1LXJA 1DRZA 5DJBA 2CHIA 1RHRB 1LKZA 3O6QA 4LF4F 3ET6B 2DEIA 3DYAA 1KP6A 1XJWB 4BS2A 4M33A 3DDNA 2QO3A 4BC9A 5C6FA 4CY9A 4O3SA 1TK8A 3QWPA 5LT5A 2RB7A 5IM0A 1HD0A 2QEXS 4C6AA 3R97A 1ZS3A 4CMYV 4NX9A 3G96A 3MMJA 4QJVA 2ZD1A 2J9EA 4O3OA 3BO4A 2VPZB 4HT5A 1WD6A 3BVKA 3IO1A 3MAAA 4A4JA 1CLFA 1T9WA 3E1NA 1AXQA 3HIUA 3MM9A 1CULB 2OKCA 4WFBQ 3E01B 2FVCA 1ZUJA 4XPCA 1H38A 4DOZA 3CCJS 2R7XA 3O8WA 3KUEA 1XC9A 3HT3A 1HBUB 4NRTA 4ZP7A 5J8WA 1VMBA 3VV9A 1TUWA 4ISMA 1S0NA 4RR5A 1HPZB 2DY9A 3IS9A 5C2CA 1HI8A 3QO9B 2F7VA 2CPEA 1HW8A 4ES3A 2J76E 4GO5X 3OV7A 4F0HA 1PAUB 1M1GA 3PR5B 4ZN1A 2ZH8A 1H7WA 3Q22A 2WVFA 4XKTA 4LFAJ 1TL5A 4CM2A 3U90A 2VL1A 4ZPBA 3RBCA 1U1RA 3PW8A 3DRRB 1R0AB 2I5JB 4QR0A 2H54B 4HTIA 2KM8B 3K5LA 2HGLA 4ZLPA 2V67A 4ZVSB 2R2UA 2HZVA 2BMBA 3MURP 4IWKA 4KPCA 2DPJA 2BA9A 3PXGa 4MYTA 4ZVEA 2RQKA 2DH9A 2MMYA 1RQ0A 2W24A 1B99A 3JTNA 2CQ0A 1Y3KA 3OR1B 2EFNA 4BLGA 2ROEA 4O44B 2RUSA 1JLEA 3CD7A 4CT9A 2Y3YA 4ECSA 2D5KA 4FYWB 3F33A 2ZOMA 3KLFA 2BDPA 1LQ9A 1S0OA 4WF9Q 3IWNC 3RR8A 2OPSB 3CSKA 3GWCA 2JEIA 5D15A 3SQOP 1SL2A 3ERZA 1JLBA 4F7VA 1N88A 3PZPA 2AQ4A 4N76A 5LSLA 2GCFA 2NXJA 4X4TA 1BQMB 2GW8A 1MWQA 1XEZA 2HWTA 2CG4A 3QBCA 4AYBD 3IC1A 2AEJA 3OSNA 1EAYC 4CO0A 3K17A 3FGVA 1NZ8A 2AGPA 4XGSA 4G1QA 1L8IA 4ED6A 1A7GE 3KLHA 3R2DJ 2V8PA 3M9NB 1PJ6A 2MJUA 3NGSA 3S01A 1NH8A 4LQ3A 2JEFA 2Y9HA 1NBEB 1FX2A 2CNLB 3GIKA 3FK4A 2ZA6A 3DBYA 3C6TB 5EWEA 1WC0A 4F4AA 4ED1A 2UUCJ 2FG8A 2RD5C 1DZ5A 1XR7A 4I64A 3Q4RA 4ATNA 2XZDB 3RB4A 4ILRA 3W3SA 3GSDA 4JV0A 1T11A 4M34A 3OR2B 5A2QU 3KLIB 1H2UX 4A47A 5DGBA 5FEJA 2OPRA 5DQIA 4TY8B 4USHA 4CH0S 1IQTA 3C6UB 4OFZA 5BJRA 3X3UA 4PXBA 1RT7A 3O2IA 5F8IA 3GU0A 1UA0A 4KXRB 2GHWA 5HJXA 4UT4A 1RT2A 3HZEA 4QW9A 3MR2A 5D8OA 3O5TB 3J80Y 3FVBA 3JS9A 2VZ9A 4OX7A 1NK4A 3BVEA 1KNZA 2YX1A 2VFUA 1S99A 4DUZJ 5DM6Q 5HBMB 4DV2J 4C11B 4U96A 3CJKA 1JLQA 4PEOA 2HVEA 4NEYA 5KFYA 2WCXA 3DDKA 5CCMA 2YX7A 4KHPF 4LIRA 1KN6A 1HHQA 1HKAA 5AJ3F 1HBMB 3HVRA 1M5SA 2XSJB 2XS7A 3N6OA 2B9YA 3DU6A 2DNPA 2QL7B 4UOGA 3DLKB 4U8YA 3HVWA 2IJFA 5MLCV 5IFMA 5BXIA 3OHBA 2DNNA 1VBZA 3QLHA 1RT6B 1RBLA 3H7HB 1HQ2A 1SJFA 1Z4UA 3M8QB 4E40A 1S1VA 1VOMA 2A10A 5HVHA 3ZZUA 3R6LB 3GB0A 5GAEI 3I5CA 4ECRA 2JD60 3BB5A 3HP6A 1NHUA 2D9OA 4I2PB 4CLWA 5F8HA 1O9IA 1UW9A 3G82A 4K4XA 2GGPA 1UVLA 4TNOA 3WX4A 3M8ZA 3OL8A 2HBYB 2LEAA 1N5YB 4AFFA 4CVTA 2I38A 1AEWA 2ZJPQ 2R7QA 3OTEA 3NAIA 4ED2A 4QR2A 4RC8A 2NXEA 3HFVA 4X62F 1YTYA 2HRUA 3LH2S 1TK6A 1VJXA 2ACMA 1DVBA 3MCMA 4P2MA 5F8MA 3HJFA 2DNOA 2BJ7A 4TU9A 1RT5B 3AXKA 5D4LA 2V4RA 3CE8A 1RBAA 4HR2A 4XDDA 3MFIA 3KXUA 3LGNA 2V69A 3KLEB 3DLBA 3FQKA 3JQJA 5H9EJ 4ED7A 3LAMA 3QIPA 5G0RB 3UN3A 4CLPA 4K0KJ 4DR7J 1X4FA 1B7FA 5J2MA 2P2CB 4WYLA 4JV5F 1O9RA 2ZJQQ 4OX8A 1U1KA 1VC5A 2VBZA 4LF9F 4NASA 2IHR1 5I3QA 3PVYB 4DU8A 2HURA 4NI2A 4K4UA 4JOUA 1EKSA 2C41A 1BQNA 3K8WA 1S1TB 2XMUA 1AZSB 4WFZA 2O67A 1M1KT 4KSEB 4Z37A 4OZ1A 1FHAA 5I4JA 3MUVP 4I2QA 5I3PA 1X4EA 2VXIA 2XLIA 4J9RA 1APSA 2A3JA 3LPEA 4IYQA 3MMAB 3KA3A 4ZCMA 1UFKA 3AODA 3VAGA 4TU8A 3Q89A 2RT3A 5HQMA 3GE9A 3SCLE 1CJVA 1RACB 5MAOA 2HZCA 4TU7A 5HQLA 3IFEA 5B0FA 4OHZA 2DGUA 3VAHA 2IVMA 2DB1A 4QU6A 4OZ5A 3MM8A 3DLLQ 4USVA 2HFOA 5HO4A 2MQNA 2MZJA 4RWXA 5LMUJ 1UCNA 3PVRA 3TQEA 5D8SA 3CC2S 4NLVA 1N5QA 1T03B 3OUYA 4DN9A 1BWEA 4IO9Q 1LWXA 2OGUA 3MF5A 2V8GA 2Y1RI 2C2KB 1H72C 1FRKA 2QFIA 2MEWA 3M7VA 2DPIA 4NCAA 1XR5A 2FGCA 4OYZA 4LRAA 1RYTA 4NLGA 2EI5A 2FHJA 2C42A 3JAMU 1KQKA 5JJBA 4KTQA 3UDEA 3DGVA 2G0JA 4NXNJ 3M8PB 4LBIA 1F9HA 4Q45A 4CLKA 1S4EA 2QA2A 5AE2A 2CJ9A 4JI1J 4H4KC 3DRYA 1TUVA 2WSEC 3TJ9A 2CAJA 1DLOB 4X64F 4YB5A 3OQ2A 2V2OA 1VHIA 1T95A 2OD6A 4DV6J 2MHNA 1YZ7A 4F67A 4YR3A 5KFMA 1ZPWX 3T5JA 2RRBA 3NWRA 4C0OC 3CPWR 2HFNA 3AA8A 2Z8QA 2OEMA 1R8HA 4B9LA 3QT7A 4MTPA 2Z2LA 2MKIA 4RC6B 3R5CA 3V81B 1TELA 4NA2A 3CDUA 1T9XA 1UFLA 1S9GA 2BM1A 3RW6A 2BJ9A 2IMOA 2HMIB 2R8KA 1FTRA 2VBWA 4DPTA 4CIOA 4OQJA 1DTQA 1VRTB 4MFBA 1GWGA 2ZNZA 5A8RB 1M5PC 3GJQB 2EW9A 4QOTA 4KH0B 2KT5A 2HBRB 4GVBA 1WF1A 4KRWA 4ZVHA 1VQYA 1U6FA 3W9HA 3W7BA 4NLYA 1SJ4P 3R5BA 2A1BA 2CWKA 4ZVTB 2WVCA 5F8LA 1HNIB 4OI0A 3CCZA 4AM5A 2X3DA 5ETNA 4H4MB 1FNMA 3DNCA 4ZLWA 2ALZA 3GP9A 5KT5A 5KFZA 4ED3A 4DCPB 4K5RA 2VG7B 2KI2A 1Q82T 3IR6B 2JC1A 3P4UB 2RQ4A 4MKYA 2IBKA 4RNHA 3BYRA 4J9KA 4Y3CA 2NZCA 2QL9B 1S6UA 2I1RA 1UJ4A 2IIHA 3HT0A 2KTQA 2KXNB 3ZNUA 1JQGA 2MYFA 4IOCQ 1RB0A 2VFVA 4DV7F 2VQEJ 1SKUB 3KTQA 2DRDA 1S6QB 1ZH5A 2RKIA 2B8QA 5FIIA 2QF9A 2V0NA 1RT3B 2GVDB 3MEKA 1XK8A 3MMCB 1WJ9A 1B4SA 2DR8A 4RKUC 1O51A 2DIVA 2DGVA 1OSDA 4B3RF 1YJWS 1FXDA 3RU0A 4BC7A 1X0FA 4OJ1A 4LF8F 4JI7F 1VK3A 2AYGA 2FLOA 4FNHA 4B3OB 1K0TA 1WC3A 2PGCA 3O7SA 4TKTA 3MR7A 2I2YA 4ZL6A 1D9FA 1PG5B 2BJ1A 3EZUA 1RABB 2ZG8X 4KHRA 4QCLA 1XWLA 8AT1B 5E3AA 2B9WA 1XNRJ 5M2PA 1KQSR 3QFHA 2J8SA 5E3CA 1RI7A 4KY3A 3CJ8A 2VQFF 5L1LA 2J7UA 4F0KA 1RCXB 3KHHA 4EVCA 2UVUA 1SL1A 2FJDB 5GAGI 1WG1A 4LQ9A 4JI4J 5JKMG 4LIWA 1YZ6A 2YH1A 3R7NB 3G2XA 4GKJJ 4TOAA 2HAIA 3H2LA 1TAUA 1JLFA 3JYTA 4XIUA 5KFQA 2Z0GA 2JOQA 1RAGB 2B8PA 1C0TA 1Q53A 1LWFB 4HI1A 1S9FA 1YDLA 4X65F 5KFBA 2VICA 4KGZB 4MXPA 5J1EA 2HHVA 4I56A 2OPQB 5KAKA 4A8KA 2Y44A 3MTJA 4WP3A 2DGWA 3CMAS 3UDLA 1MG7A 2W2QP 5ETVA 2IC3B 2VOPA 2QA4G 4Y6IA 5LXRA 3ENWA 3DRPA 1HWKA 4R42A 2GAGC 3B6BA 5T7LA 2UU9J 2XMJA 2L9DA 1TKTB 2VG5A 3GFZA 4HHHA 2DO0A 4KPYA 2Z58B 3S6EA 3NS7B 5CH7B 4LFAF 3SYZA 1S30A 2QRRA 3Q8UA 5LSOA 1RU2A 2XHCA 2A18A 4WU2A 2P6SA 1WG5A 5C25A 1ZA2B 5KFDA 2R2TA 5BYQA 3B8HA 3SDEB 2D7SA 2FC9A 3FUYA 1XTZA 1TTHB 2RS8A 3FSYA 2CPFA 1U8WA 4AL5A 1UZDA 3L7OA 4CTAA 3DOLA 5C7PA 3M2RA 2HZAA 1D8ZA 3OJ5A 4GO7X 2VFSA 1X4GA 4TOGA 3PJWA 3UNYA 2LP4A 3RUBL 1VK8A 1JKHB 2C2UA 1UVHA 4H4OB 3EXCX 1JJCB 1RA6A 3JZ9A 5H9FJ 3WC0A 1TU0B 4DV1J 3CD6S 2G9OA 3LP0A 2V8VA 1RAOA 5D0RA 4FF4A 4LVOP 5HJFA 4OMFG 5I3UB 5GAEU 2XZTB 1SIWB 3MR3A 3H0PA 3R2OA 1PC4A 2M8DB 3MM6A 3WDOA 3ZNJ1 4O3QA 3PX6A 1S3QA 3T1HJ 3M9OB 2YNIB 3T6JA 4PG4A 5RUBA 2E1CA 4LFBF 5ETPA 4NOHA 5F41A 2ZNYA 1SJ1A 3NMAA 5DQGA 4M5LA 1FVQA 4DR4J 4HACA 3BKTA 1ZETA 2AJFE 3JTOA 3IGVA 4ZP9A 3TVYA 2B7CB 2H65B 4RW7A 2YJJA 1T3OA 2JJ4D 3OL6A 1PAEX 4OHWA 1FKOA 4OI1A 3FSEA 1OTKA 2CYYA 5IWAJ 3AD7C 4ES2A 4CYAA 1RKIA 2Y0BB 2G0IA 4B3TF 4CCHA 1X4BA 2BJDA 4FNIA 1FHTA 3QYYA 4CO5A 1QSSA 3F32A 1S6OA 4IOAQ 4LRCA 8ATCB 3ADAC 3CCVS 2AWZA 4JI0J 2ASYA 3PHEA 4MMOA 3I9V9 2V2SA 1TL3A 3V4IB 2R42A 3N79A 3ULHA 4F4WA 1IUJA 5AXKA 2F4VF 3EDQB 4NLUA 2M7SA 2OTJS 2CN6A 4DE6A 5IOLA 4ZS6A 2ZZNA 3H4DA 1VJQA 2M70A 4OLPA 2XSFA 5JVHQ 3KXDA 3GV5B 2YKPA 3BKFA 1VC0A 1O5JA 1JXVA 2N82B 2CPXA 5KT2A 4C0HA 4IDKA 1C2PA 3I87A 1HHTP 2VU5A 1KRPA 5D4PA 4JI6J 2KXFA 1MFRA 1JREA 4U7UD 3VHQA 3G71S 2BVZA 2O5DA 3UFCX 3ET6A 1VLYA 2FJAB 4CYBA 2UXCJ 4ZMMA 3C16B 4EYHB 3VAKA 2RILA 3HJVA 1WOPA 2WTLA 3Q4QA 2PI5A 2ZUGA 1X4HA 3A13A 3DOKB 5CABA 5KFRA 4CVSA 5L1JA 4EMDA 1UEKA 4PXDA 4RBVA 4D3GA 1R3NA 3W62A 2Z5QA 5KFAA 1G7CB 1CULA 3DC2A 2JC0A 2Q6CA 1NKBA 3PM9A