3EZUA

Crystal structure of multidomain protein of unknown function with ggdef-domain (np_951600.1) from geobacter sulfurreducens at 1.95 a resolution
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
342
structure length
336
Chain Sequence
GMSGDILNDIVAACLELERKASSVFKMFAAHAGSDEARRFWETVADETRHHSAVYERLQERGGRENLPIIIYKPAETLEELEMIGKSIDEQVERYTEAPSSEAACLLGFRLQLYLLHPAFASLCRLTRDASEDLPDIGYGRYLRRFIDGIGSCGLATAETELLGEALFRLWNEARQLAAQSHFDALTGVMTRAGFFKTVGSLAYAAQRSGSNVGIMLIDLDYFKLVGQTGDRILQLVAETITSHLRRSDVVGRYDGDEFVVYLSPVEPASLRTVAENLRRSIEEESARMVPVTASIGVAQGILGTDVDGGIEELVRLADECLMQAKYTGKNKVVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GGDEF domain protein
publication title Crystal structure of multidomain protein of unknown function with GGDEF-domain (NP_951600.1) from GEOBACTER SULFURREDUCENS at 1.95 A resolution
rcsb
source organism Geobacter sulfurreducens
molecule tags Signaling protein
total genus 133
structure length 336
sequence length 342
ec nomenclature
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ezuA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ezuA02
3R2KA 5E1UA 1SH3A 3U90A 2YNHB 3OLAA 3QHBA 1KHWA 4XGSA 3Q8PB 1S1VA 1RT6A 1LW0B 5KFHA 1HNIA 2B5JB 1N5YB 2OH2A 2V15A 3MR3A 5J2PB 5L1JA 3NAIA 3CJ3A 4IH6A 1T3NA 3EPIA 2CIHA 4YR2A 4RW4A 4IR9A 4ZP7A 3M8QA 1MU2B 1BQMB 3DI6A 4Q45A 5DLFA 3NP2X 4EVBA 5L9XA 5J1EA 3PWQA 1HQEA 3DRPA 4NLPA 3RB0A 3IQ1A 4MK7A 4M94A 2D3UA 4O3RA 4WZMA 4MY7A 4J9RA 3F35A 2OC5A 2D5KA 3MR6A 5JUMA 3VNXA 2R8KA 3OSNA 2AU0A 3QIPA 4JV2A 4MKAA 3BSAA 4ID5B 3R2LA 3F34A 1RT5B 4TQSA 3D28A 1RTJA 4WYWA 3BKNA 3SH6A 4O3PA 1IKYB 4ZPCA 2V2JA 4LQJA 3H5YA 2QQYA 3H4BA 3NMAA 4K4VA 2Z5PA 2IMWP 4CY9A 3AF7X 2ITBA 1JKUA 3V81B 2B6AA 4ISMA 1S4FA 2JEGA 3Q8SB 2V2RA 5FFEA 3LP2A 4ED6A 2XGQA 3I0RB 3MEEA 4PWDB 5KFZA 2IAJB 1S49A 4ZP6A 3WVUA 4MIAA 3QGIA 3E51A 4DASA 2WLAA 2RKIA 4AM5A 2FJVA 2ATLA 2FHAA 2XI2A 4TOHA 3DRSA 3KHRA 4LPJA 4DYZA 2IJNA 2VA3A 1HPZB 2HMIB 2QF9A 3V6DB 1REVB 4CYBA 5DG9A 3Q4OA 5KFMA 2WLUA 3KA8A 5C24B 1HYSB 4ZVEA 4MN9A 3NBPB 2IY4A 3M8PB 2CN7A 4RC8A 4ZP9A 4KE5A 5EWGA 4TOAA 4DL5A 2YKNB 5KFWA 2B5JA 1S1TB 4H4MB 5J9VA 5KFNA 3UOIA 2C41A 3SHXA 3RGDA 4ZKWA 4B3OB 1S9GB 2VG6A 2V4QA 1S6QB 5I4JA 4HKQA 3H2LA 4E6KA 2WONB 5GU0X 4X2BA 1SUQA 2WB4A 4NLRA 4CVRA 2RBDA 1TV6B 3MEGB 3QGHA 3TA8A 4PGKA 4TO9A 4ED0A 3BSCA 1BQMA 4TODA 5EWEA 2CF7A 1C0TB 4RC5B 4I7FA 2C2UA 2IM1A 5LG8A 4KFBB 3NOZX 4ECRA 4IRKA 3AK8A 1R03A 2HNYB 4IWKA 2IU2A 4RNHA 1LWFB 4KV8A 1J5OB 2JLEA 5C42A 4ED8A 4RC6A 1VRTA 2CHPA 3IS8A 4IH7A 3IS9B 3MTKA 4ID5A 3D5MA 3IRXA 3RBEA 2BANB 4NLSA 1VRUB 4K4SA 1IKYA 2HNDB 1MOJA 2X170 5KT5A 5KG0A 3F32A 3BVLA 2YNFB 1OS5A 4TYBA 3V6HA 1R0AB 2FLLA 4R42A 3JYTB 1JI5A 3PW7A 5KFRA 3FFIA 3DMJB 3RB6A 2ZG9X 3R2HA 2VG7A 5KG1A 1HRSA 3UPFA 1YVFA 2C2JA 3Q4RA 5GN8A 3HL1A 3BQ0A 2ZKUA 1LKOA 5J93A 5KFGA 2GIRA 1JLQB 1JLGB 2YNIB 4CVSA 4XKUA 4F4WA 4NCGA 1C1BB 2CN6A 3O7RA 1LKMA 2ILYA 1NNQA 2JC0A 3CDEA 1TKPA 2ZA8A 4ECVA 3T1AA 1LWEA 4NLTA 4XKTA 3UNOA 5C24A 1HYSA 1UWBA 3M9NB 5KG2A 5I3UB 1RTDA 4RNMA 4EBCA 2RDJA 3KLIA 2YKNA 3QZ8A 2BJYA 4KKOA 3UOFA 4TY8A 2XCAA 3PHEA 3QD8A 2HWHA 2E9TA 2FVQA 5F8LA 2OPPA 4O3NA 1RT6B 2QV6A 1VJXA 4K50A 1NFVA 1HNIB 1L8IA 2D3ZA 3R2RA 5KFVA 1TV6A 3ISNC 4ZVFA 1YUXA 1N4LA 1NF6A 3FDSA 3I0SA 2FVRA 3DOLA 5KFKA 2BW1A 3QO9A 3RAVA 5L1LA 1S0MA 5J2QA 3BVKA 3R2MA 3M8QB 2AX1A 3DI6B 4P18A 1RYTA 3QVDA 1JKHA 4EEYA 2UUWA 5J1EB 1HQEB 2I1RA 3CJ2A 1GWGA 4DE6A 2YW6A 3DLEA 1DVBA 4WXOA 3KA9A 2V2PA 3NGDA 3SFGA 4IOBA 1VRUA 3R2SA 1RT3A 2HNDA 5J2MA 3C6UB 2F8EX 2JD60 4TOBA 5T14A 1FKOA 2FJWA 5D8QA 3MPSA 1TP7A 3GE4A 3HVTB 3KK2A 3KLEA 2UVUA 2ASJA 3N6NA 1S1UB 3KLHB 4K4YA 5HQOA 4KHMA 2UVRA 4IQXA 4OYNA 3PW1A 4M34A 3QZ3A 5KG5A 3G6XA 2JD80 3LALA 2B6AB 4YP3A 2VG5A 2AX0A 2J6UA 4YMEA 5FDLA 3LP2B 1TKOA 3BSNA 5KFTA 3MEEB 1JXLA 1RT2B 3F38A 4PGIA 2IM3A 4FBUA 1RTIB 3GVYA 2RKIB 3H5XA 2C6RA 2ALZA 1DLOA 4I2QA 3T5HA 4U7CA 3DRSB 4RW7A 1BFRA 4F4XA 3OGHA 2HWIA 2R8GA 3QIDA 4IFVA 2FL0A 3KK3A 3SI8A 3RAQA 5DQGA 4QWEA 1RT7B 3PW5A 1NF4A 3ISND 3QGGA 5DLGA 4RZRA 1LB3A 1SV5A 4URQU 5EUHA 4NLUA 4KO0A 5D8PA 5CYMA 3KHLA 4DEZA 1YUZA 3DLKB 3CWJA 5AXSA 2ZG7X 2VG6B 2AQ4A 5CZUA 5HJHA 5KT4A 4LSLA 4O4RA 3FSIA 4ED2A 5KFEA 1SUQB 1EETA 4CYAA 3V6KA 2YJJA 3PW8A 4IXKA 3OJ5A 5F8HA 5JKMA 3QB9A 3PWFA 2HNZA 3FVBA 5KFCA 3A9QA 4I7FB 4R8UA 4MH8A 3KMQA 2CHIA 3KA4A 5L1KA 3RD0A 1NHUA 3DLGB 4NLWA 4AM2A 5HJFA 3BVEA 2Z5QA 4J9MA 4KV8B 5C42B 1IKWA 4TQRA 4RC6B 1VRTB 3T5LA 3C6UA 4JV0A 2W9AA 5HLFA 4NLGA 3IRXB 5C25A 2OPSA 2ZD1A 3BQ2A 5KFPA 1SQ3A 4KBIA 3HVTA 1TVRA 3PW2A 4REUA 1S1UA 3KLHA 3KHHA 4MFBA 1J30A 2DPJA 3MECA 3PJWA 4RNFA 4U3GA 3FFIB 1CSJA 2IJFA 3BQ1A 2VG7B 2ZA6A 4CVTA 2XJOA 3M9OB 2BE2A 1S9EB 5GN8B 3E1OA 1JTSA 1RT2A 1KLMB 3MR5A 1S0NA 1RTIA 3G6YA 4NLOA 3QZ7A 4Q8EA 4NCGB 2B43A 1IM4A 2BRKA 3IN5A 3KHGA 1LWEB 1JREA 2ASLA 1OTKA 5D8RA 2W8LA 4ECYA 2GC8A 2WK4A 2UX1A 4H54A 5F8JA 4MK8A 3E1QA 4PG0A 1RT7A 1UWBB 1ZTTA 4NLXA 3OSPA 3AJPA 3A68A 1RTDB 5JKLA 4RUAA 4QW9A 5LS9A 3KLIB 2I5JA 5C5JA 4KKOB 2RF2A 1RYSA 4TY8B 4QWBA 1TKZA 3DLKA 5FEJA 3OLBA 4MKBA 2WTFA 3H98A 2OPPB 4A25A 3BREA 1U09A 3LAKA 1BG7A 3GQCA 1JIGA 3E1JA 2XI3A 3IG1A 4AM4A 3IS7A 5KT3A 1JIHA 4RW6B 5CMRA 3M9MB 5FFAA 3H59A 4LQHA 3WNWA 3I0SB 3DOLB 1JLFA 2XKQA 2AWZA 3QO9B 2C2FA 2GYQA 5J2QB 1RDRA 1JKVA 3DOKA 4IFYA 3DLGA 5KFUA 5KFIA 3KWOA 4O3OA 1JKHB 1DATA 3BGRA 3E1MA 4XPEA 4LQ3A 1TKTB 1S1XB 3OL8A 3F33A 5KFAA 3C6TB 1LKPA 3DLEB 2Y3QA 3PVTA 4ML5A 5KFFA 1EP4A 5KFXA 2FJXA 5FFCA 1RT3B 5J2MB 4NLVA 1FKOB 5KFDA 4O4GB 1S10A 4O3QA 4ZMCA 4TN2A 3KK2B 4RC7B 3KLEB 2OPRA 4K4XA 2WTLA 3FI6A 1S9EA 1IERA 3GHQA 2V2NA 3LP0A 4J9OA 3PW1B 3QHCA 3F36A 1KLMA 3FRZA 4QPXA 2VG5B 2E9ZA 1RCGA 2FFXJ 5FDLB 2ZG8X 4Y3CA 2Z6MA 2GS4A 5EDWA 5K52A 3T5JA 4M95A 4F50A 1QAIA 1JLEA 4Q44A 3N6LA 1TKXA 2W8KA 4R5PA 5DGAA 4GC7A 1DTQA 4RU9A 2C28A 4KVQA 1IKVA 5JKMG 3AF9X 4K4ZA 3EZUA 4RNOA 3OL7A 1DLOB 4I2QB 1IESA 4RW7B 3T9JA 2W9BA 1DTTA 4IFVB 3KK3B 3FQLA 1S97A 2WRMA 4ZL5A 1RTHA 1WNEA 3E6RA 4Y08A 1SV5B 4IG3B 2EC0A 3PZAA 3GILA 4KO0B 4RW9A 4RUCA 5CYMB 4WE1A 2CKWA 2GIQA 4GC6A 4G1QA 1QE1A 3PR5B 3HIUA 1XR6A 2R8IA 2AGOA 4YR3A 3GV7B 4J9NA 5CYQA 5KT7A 4RW6A 2JD70 5I42A 3ICLA 4ZJKA 4LSLB 2R2TA 4M32A 2J6SA 5J2NA 5CMQA 1EETB 3GIIA 1XR5A 2Z5RA 4FS1A 4EBDA 1YV1A 1NNDA 3QLHA 3UR0A 1C0UB 1Z4UA 4U6PA 1LWCA 2HNZB 3WVVA 1I6JA 3CO9A 4R8UB 4PG1A 4ZHRA 4URGA 1H96A 1S1WA 1Z6OM 1TKTA 1S1XA 3PVRA 3LP1B 1SH0A 4F4YA 4ED3A 2OPQA 1Z4AA 5D8SA 3C6TA 1RYRA 1AEWA 2FVCA 1N1QA 3TVKA 4WFYA 4ZMMA 1IKWB 1RA7A 1S6PB 1QGHA 4NZ0A 4R0EA 2WHOA 2R8HA 1TL3A 3PW0A 5E2DA 5HLFB 2YKMA 2BRLA 4NLYA 4Y2CA 4DYXA 5C25B 1F30A 2OPSB 2ZD1B 5J8WA 4M33A 1N56A 4O4GA 4ZTTA 1RT4A 4YQWA 4IG0A 1TVRB 3NAHA 4RC7A 3TAMA 3V4IA 2VXIA 2UVVA 4MFBB 3PJXA 4J9QA 4ZPBA 2FJCA 4ZPDA 3N6MA 3MECB 3DRRA 2V2MA 4TOEA 2BQUA 3EZ0A 3JSMB 2FVSA 1T03A 1S30A 2JEJA 3KK1A 2BE2B 1JI4A 5F9LA 2V2IA 1C1CA 5F8IA 1RCCA 1MMLA 2VA2A 1HNVA 3BSOA 1FHAA 3E1LA 2UUTA 4Z3BA 5JACA 1UVHA 5FFBA 4J9SA 1BQNB 1SH2A 4Q43A 4IR1A 3Q8RB 3DYAA 1T94A 3GV8B 4DYUA 3RE7A 4DI0A 5KG7A 2R2UA 4Q0BA 4LSNB 5DQHA 5D8OA 1D1UA 4ECWA 2IA6A 4ITTA 2QE5A 3MEDA 4YR0A 4KVRA 5DQIA 4K4WA 1QAJA 5ERJA 4PQUA 1XZ3A 4CMYV 3MF5A 5D3GA 3LAMA 4YKHA 4IG3A 2I5JB 4ECTA 1ZS3A 4KB7A 2RF2B 1JLAB 1JLBA 4K4UA 3ITHA 4NLQA 1TKZB 3SIDA 2CEIA 3G86A 1O9IA 2IM2A 2IC3A 5HBMA 2BKCA 4TOFA 5HP1B 2BR0A 2PYBA 3FSEA 4TY9A 4MKUA 3IG1B 1HARA 4QUWA 3UDLA 1FKPA 1C0UA 3PVXA 4MJYA 1JLCB 2XJMA 2O5DA 2FG4A 1JLFB 3GYNA 3LP1A 4IDKB 2UVWA 1TL1A 3DOKB 1S0OA 2HAIA 3HVWA 4IFYB 1DPSA 3TQ1A 3UQSA 1RCDA 3ERZA 5K53A 3O7SA 1KHVA 2R2SA 2YNGA 3BGRB 3KA3A 3F39A 1N6QA 2BQRA 1S6PA 1JX4A 4ECZA 3PVYA 2VZBA 4EBEA 4IWJA 3PVTB 2XGWA 5KFJA 2ASDA 5F9NA 5KG4A 1S2ZA 1LW2A 1S3QA 1EP4B 4DYYA 3Q4QA 3KA6A 4MUDA 2YW7A 4IH5A 4ECUA 4XPCA 1IKXA 3JSMA 1JGCA 2WCXA 3KLFB 4O44A 2OPRB 4EYIB 5F8NA 1C2PA 4HYKA 3AJQA 1GX5A 1ZTWA 4DL4A 4DL3A 4MK9A 3LP0B 5HROA 3DM2A 4ZKXA 4NLDA 4EVEA 2C2DA 2F7NA 3E01A 2XC9A 2ZE2A 3KLGA 1BQNA 1EUMA 4G3IA 5DGBA 3ES3A 4FBTA 3KLVA 3WVWA 4H4OA 1RT1A 2WOMB 4WXWA 1TK6A 4OL8A 4KSEB 1JLEB 1XZ1A 1TKXB 4LSNA 4R5PB 1DTQB 3CJ5A 5EWFA 1IKVB 4Y34A 4EVDA 2W9CA 3E1NA 3KOAA 4I2PA 4DZ0A 4ICLA 2V2LA 3EGMA 5K14A 2W9BB 2JC1A 4ZVGA 1B71A 4ETRA 4ECQA 3AK9A 4II4A 4ERUA 1DTTB 2G4HA 5ERKA 4XO0A 1HQUB 1RCEA 4K4TA 3H7GA 1XR7A 4XKSA 3BVFA 1JLAA 1RTHB 5C6FA 4J9PA 4PUOB 4ZL6A 2YNHA 3PW8C 3H4DA 4MIBA 3PZPA 2DPIA 1LW0A 1RCIA 4J9LA 2D7SA 5HP1A 1N5YA 4RW9B 3R2OA 2HTNA 2CLBA 4WE1B 2R8JA 4G1QB 1QE1B 3VQSA 3CJ4A 5J2PA 3PWQC 3BJYA 2XJNA 5LBHA 4KVSA 2CJQA 5CYQB 4DL7A 5I42B 4EVCA 3PW4A 5JXSA 5DG7A 4NRUA 1JLCA 2HR5A 5J2NB 3Q8QB 5KFQA 1K1SA 4IDKA 3ISFA 4WFXA 5L1IA 3QLHB 3IGNA 2V4RA 2VXXA 4ED1A 4QWCA 5KG6A 3T19A 4LYXA 1LWCB 1MU2A 4ZVHA 4M35A 4ZHRB 5GU3X 1S1WB 1FK9B 3PVRB 1JYBA 2OPQB 2V9WA 4Y2AA 1L8HA 5KFSA 2JEFA 5J8SA 2IM0A 5LG2A 3OL9A 3H5UA 3G6VA 3OHBA 1TL3B 4RNNA 2YKMB 2BK6A 4NRTA 4DL6A 1RT5A 1VEQA 3I5AA 2V0NA 4ZP8A 2ZA7A 1K1QA 1RT4B 4IG0B 3KLFA 2JEIA 3V4IB 3TAMB 4ISPA 4QWAA 3BT5A 1MFRA 1T05B 3I5CA 3GIKA 4ZPAA 4TW3A 3DRRB 5KFOA 4CMYA 4RW8B 3V81A 1ZETA 4ED7A 2V2OA 1T03B 4EYHB 4LQVA 2OH3A 3KK1B 5GU1X 4IKAA 1C1CB 3CVKA 3SE1A 3I0RA 4KHRA 4PWDA 1RA6A 4FS2A 2WOMA 3RB3A 1HNVB 4EO6A 2IAJA 3KJVB 2Z90A 4Q8FA 3DDKA 4JUZA 1S9FA 3CIZA 3DYAB 2RDIA 1VLGA 4WFZA 4ZLWA 1TJOA 1VELA 3H5SA 3Q4NA 1HMVB 3AJOA 2XCPA 3F37A 4Q0BB 3RB4A 1TQLA 4F4ZA 1HPZA 2HMIA 1HQUA 5IX6A 4ECXA 3V6DA 1GX6A 3MEDB 1REVA 2FKZA 4KAIA 3PR4A 3GIMA 3KXUA 5KFYA 1D0EA 1KRQA 4PQUB 4TXSA 4ECSA 3NBPA 1N48A 4PUOA 3M8PA 2E9RX 3RAXA 5D3GB 5GU2X 4IRCA 2ILZA 4DG1B 2AGQA 2ZURX 4LPMA 1S1TA 1Z6OA 5F8GA 4H4MA 1JLBB 5KFLA 3ITHB 3IGVA 3I5BA 3QYYA 4LYUA 3BVIA 4TYAA 4B3OA 2W0OA 1S9GA 1S6QA 3LANA 2IC3B 5HBMB 4TOGA 1S1VB 5GOUA 3CDUA 4LPNA 5DG8A 4URSA 5FFDA 2WONA 2J6TA 2C2RA 3OHAA 4O3SA 2FVPA 4ITWA 3ISEA 5KT2A 2IB0A 3MEGA 1FKPB 1O9RA 4ZKHA 1ZUJA 3T5KA 2W7PA 4TLRA 1C0TA 4RC5A 4LQNA 1FK9A 4RW4B 2AGPA 4KFBA 1W25A 4CVPA 1TL1B 1SOFA 1QUVA 3SFUA 1F33A 3KMSA 4QWDA 2W7OA 3H40A 2FLPA 2HNYA 2YNGB 4DL2A 1LWFA 1J5OA 1N6QB 3MFHA 4TOCA 3RBCA 5F8MA 3DRPB 3IS9A 3PVYB 3MFIA 4WZQA 3KNAA 3E2CA 3HVAA 3OL6A 1VEIA 1LW2B 2BANA 5D8YA 3AF8X 2FZFA 3NL0A 3EPGA 4LQ9A 3V6JA 3QIPB 1T05A 3BR9A 2YNFA 5JKLG 2XGPA 1R0AA 1RTJB 2R2RA 3GIJA 1IKXB 3JYTA 2D41A 4RW8A 3DMJA 2BQ3A 4O44B 4J9KA 4IRDA 5KFBA 3NKYA 5KT6A 4JV1A 3E1PA 1UMNA 5HROB 3DM2B 3KJVA 2YJKA 3KX9A 5D8XA 1NHVA 3E01B 2ZE2B 1JLQA 3KLGB 2IBKA 3GV5B 1QYBA 3MR2A 1JLGA 2YNIA 3CDWA 2V2SA 1C1BA 3HHKA 2C2EA 4WYLA 1BCFA 1HMVA 1RT1B 4H4OB 4Z5SA 2CLUA 3NP0X 3RBDA 3HKWA 3E6SA 3CJ0A 2XWYA 4QW8A 5KG3A 2FLNA 2W9CB 4EO8A 2GYDA 4I2PB 4ICLB 5K14B 1RAJA 4II4B 5I3UA 2C22A 2FG8A 4DG1A 3FQKA 4NYZA 1S48A
chains in the Genus database with same CATH superfamily
1CQMA 2H9ZA 1XMBA 1SH3A 3VAFA 1TAUA 3U90A 2YNHB 4WKYA 5ITHA 2LQJA 4MIWA 2VOPA 5DDOC 1U1RA 5IT9Y 4OZ5A 2V15A 5THWA 1PYTA 4A8KA 4LF7J 1F9EB 1HBMA 4ER8A 2CQGA 3NAIA 1U2RA 3PYGA 4IH6A 3JTOA 3CCZA 2CIHA 2KZMA 5LL6d 4JI0J 1H6KX 4R25A 4CNZA 2X7IA 3QJJA 4A46A 1MWQA 3DI6A 3PEHA 3ZFVA 1JXVA 3O1LA 1WEYA 3GWCA 1NDPA 1WDTA 4X65F 3DRXA 2BACA 3FRYA 5IC6B 1FRKA 5D77A 4UOFA 2XLJA 4ETZA 4OZJA 3OD2A 4MY7A 2V8VA 3F35A 2OC5A 3MR6A 3OSNA 2QFIA 4JV2A 3CJKB 3R5JB 1V5IB 4DV1J 3C8YA 1P27B 1RTJA 4Y00A 3AXKA 4WYWA 3BKNA 3SH6A 1RBLA 2NQPA 1MW7A 2K1RB 2V2JA 1DURA 3H5YA 5B7WA 1ZAXA 2XEXA 3C15B 1U7LA 3TQEA 4DF8A 3NRBA 4B17A 1JKUA 4X4PA 4ISMA 4UY8T 2JEGA 1KWMA 3B82A 2A1BA 4PWDB 3OFHA 2J7KA 5KFZA 4OI2A 4ZP6A 1D9DA 1YBTA 2UZAA 1A9NB 3R5CA 4AM5A 4OYIA 1FDDA 1RLCL 4WFAQ 4X62F 2HK2A 2BUNA 3B8HA 3JXOA 4ELUA 1FXLA 2IJNA 4ZKAA 2DK2A 2PDAA 3V6DB 1GNKA 3U02A 2IVYA 1FKAF 4OYZA 5IXUA 3PRVA 3OVSA 1CS4A 2IRUA 3M8PB 2CPJA 4KE5A 4B3MJ 4G1IA 2I2YA 4TOAA 2B5JA 2UU9F 1R27B 2OD4A 2MB0B 3EGWB 2DNGA 2C41A 2EBGA 3RGDA 4YN3B 4ZKWA 3T1YJ 1S9GB 4QIGA 2V4QA 5I4JA 1S59A 3ZZZA 3TZYA 2BX6A 5IM0B 3CCVS 4E6KA 4GKKF 5IFMA 3THTA 3EJMA 1TR0A 2RBDA 5AXLA 3TA8A 2AKWB 4ED0A 1BQMA 2VUGA 1QLNA 1C0TB 2ZJRQ 4RC5B 2BJDA 2FC9A 4KGMA 3IRWP 4DN9A 2DIUA 1W7WA 2QGFB 1UEUA 1G6BA 4ECRA 1B7FA 2V2KA 3AK8A 4YFUA 4PCQA 1Q16B 3CSKA 2DRDA 2JLEA 4ED8A 2GV1A 2CHPA 3IS9B 3MTKA 5CHCB 1VCTA 2APOA 4PXDA 2KT3A 3DCAA 3IA0A 3IRXA 4C0OC 3GFHA 3V2UC 4P7TA 3PHTA 5FLXY 2V63A 4A8QA 1JJHA 1N5TA 5GAGU 5KT5A 4PWUA 3VF0B 1OS5A 2MY7A 1LK7A 3I31A 2FQQB 3N9UC 2AHOB 1JI5A 1W2IA 1S57A 1Q95G 1Q86T 2QSWA 2ZH2A 2DH7A 1BWVA 5HAOA 3Q4RA 5GN8A 2X3GA 2G13A 2GIRA 1HD1A 3M1VA 3M2RA 2EFGA 4F4WA 4FF1A 2JSXA 2HQIA 1MMDA 1LKMA 5ETSA 3BDPA 1BUXA 1NNQA 2B51A 2JC0A 1T9XA 4F04B 1U1MA 4X64J 3T1AA 4NLTA 3TWZA 4B3SF 3NCRA 1TMMA 2AJ1A 2H4YB 3NOCA 1S76D 5C24A 1HYSA 4FYYB 1LOUA 3M9NB 2HBRB 1X5PA 3HD2A 5GADU 3RW7A 4K8RA 2W2NP 5C2GA 2PC6A 1KLNA 4BS2A 3CPWR 2FLOA 3U1LA 2HQ3A 2FTRA 3FJ2A 3KJQB 1VRQC 5K20B 3UI3A 1NFVA 2QX0A 1CC7A 1JJ4A 3WHIA 1TV6A 3ISNC 2VBYA 3QWUA 4DX5A 1MSWD 4J90A 1N4LA 2PO4A 3FDSA 1YZ6A 2VJUA 3GONA 1S0MA 5J2QA 1BLUA 3VGSA 4DQQA 4DV6J 2A2CA 3RRKA 4BDPA 8AT1B 4LFBF 3DI6B 3QVDA 3CTRA 3TA0A 2UUWA 2I1RA 3R27A 1JJCB 3ZZOA 4DR4F 4DE6A 3U7JA 1DVBA 3KA9A 4IOBA 1NH8A 3UE2A 2FGOA 3R2SA 2MLXA 2HNDA 2F8EX 1Y5LB 4TOBA 4OHXA 5T14A 1I94J 8RUCA 4DPXA 1NB2A 4OJ3A 3M4XA 3HVTB 4CT9A 3KLEA 1D9FA 2ASJA 1S1UB 4NI2A 5DO2A 1NJXA 2UVRA 4M63A 4LFCJ 2V8HA 1F2HA 5KG5A 1U1KA 4DDFA 2J6UA 1H72C 5KFTA 1KS2A 1QD1A 2HFOA 1JXLA 3V3KB 3F38A 1WC4A 3FRRA 4FBUA 3GFZA 1SQFA 1T9TA 3ULHA 1J2VA 4HACB 3UW1A 1NZAA 3TEHB 3ENQA 5CQGA 2R8GA 4IFVA 1FX2A 1O5JA 1FJCA 1KQKA 2DITA 2QRRA 1WI6A 3ISND 1NJYA 3PJ9A 2WVBA 3EGVA 3QPIA 4URQU 1U24A 4KO0A 1WSVA 1YKWA 3AFGA 2X3DA 4UUWA 2BJEA 5AXSA 2VIHA 5CZUA 4WBFA 5HJHA 3IBFB 5ETPA 3Q8YA 1YBAA 4ZVSB 1IBLF 2NZCA 3V6KA 3PW8A 4IXKA 4BCAA 5F8HA 3QB9A 2COLA 4ZVTB 1U8SA 2H1YA 1KTQA 4MH8A 3KMQA 3QBCA 5AT1B 4L3KA 2M8DB 3RD0A 2EKNA 4NLWA 4C97A 2RU9A 2AP6A 2N82B 3BVEA 2VQEJ 4S0MA 1IKWA 3MPVA 4X4RA 2XZWA 2DH8A 2B4OA 2DR6A 3UFCX 3HSJA 1WOPA 2GQCA 4NLGA 3IRXB 2KRBA 5C25A 2OPSA 3J81Y 3FBEA 3BQ2A 1XNQJ 1N34J 4R0JA 4KBIA 3R7SB 1RHJB 3LQVA 2KHCA 4YDXA 3PW2A 3K57A 4OHZA 3KHHA 4MFBA 1OIAA 2A6OA 4CDIA 3J7Z5 3F41A 3S8SA 4RNFA 4U3GA 1WI8A 1DRZA 3BQ1A 3PIPQ 2NCKL 2ZA6A 2XJOA 4CM2A 1S9EB 5GN8B 3E1OA 1BQXA 2CPHA 1RTIA 1N33J 3G6YA 3HK2A 3M1VB 2CWXA 3M2RB 3TNVA 2HFUA 4Q8EA 4OV1A 1VQ6S 2IY5B 3FMWA 5B09A 2BRKA 2XS2A 4JOUA 2ASLA 2LA4A 5D8RA 1NK8A 4U7UK 1B7YB 2MHNA 3LGHA 2BW7A 2V69A 4GO5X 4B3RJ 3E1QA 4CLLA 3VAJA 5LS9A 3ILIA 5DZ6A 1XN9A 4CLFA 2XG8A 4QWBA 1VQSA 3DLKA 2YX4A 4USKA 5DDPC 3H98A 3HFZB 3GQCA 1FXRA 1FJGJ 1WKLA 1GMUA 1RB0A 4PPDA 3W7BA 2ZEJA 2PMHA 1U6FA 3LWLA 4P71A 1JLFA 2AWZA 2G1DA 5J2QB 1XQIA 3HZGA 1NO8A 2KXFA 3QNWB 4FNHA 2PA3A 1S77D 1U2CA 2XS7A 2VODA 4O0IA 3BGRA 4XDDA 1TELA 1S1XB 3OL8A 5KFAA 2AV5A 2ZBIA 2G1HA 2IDEA 4F2SA 4ML5A 2IIHA 2DNKA 1L3VA 2KFNA 3AAWB 2KVIA 5AXKA 2DXFA 2MEWA 1EKRA 3EE3A 4GO7X 4K7QA 3EVOA 2M70A 2L9WA 4KT0C 3W8GA 5KFDA 4O4GB 2GVZA 2F4VF 4UY85 4O3QA 4DR6F 1VQYA 2ZM6F 4LF4F 3KLEB 4K4XA 3UD4P 4OJHA 1SC6A 4NI2B 4LF5F 3AQPA 3JQMA 2YWKA 2K3IA 1XWLA 1FD2A 3QHCA 5FJ4A 4GVBA 1RCGA 2ZG8X 1SKUB 3OVAA 2MYFA 4WPAA 2FPHX 4CLZA 5K52A 3QGPA 4F50A 2J8AA 3MHYA 4Q44A 3N6LA 1TKXA 1X4FA 5DGAA 4RU2A 4RU9A 5L8RC 4LIWA 4KVQA 3FEXB 1DAXA 4K4ZA 3EYZA 3EZUA 1WTFA 5AJ3J 4RNOA 2RAQA 3OL7A 2VV5A 4QYRA 5ETTA 2NLWA 4LUBA 1NJWA 1VFJA 1YSJA 4IFVB 3FQLA 1P9QC 2OO4A 2CJYB 3TW0A 4B3TF 1PO6A 3GE9A 3MMBA 1U0SA 1WNEA 3D3BJ 2CPXA 1T8EA 3E6RA 1Y3JA 4Y08A 1YITS 3P4UB 4KO0B 2CNNB 1B99A 4GC6A 2GHWA 2AGOA 4JP8A 4YR3A 3GCXP 4UZCA 1X4AA 2AR0A 5F41A 3ZTOA 1TK0A 2VICA 1B64A 3ZO7A 4DV4J 2Z5RA 2P2CB 3W5ZA 4Y2IA 4U67Q 4FVCA 4GKJF 1LWCA 2Z4PA 1H7XA 1WC6A 3L95X 2VU5A 3RYLA 4CLKA 3RRHA 3WVVA 1GK8A 5H1SV 1I6JA 3K5OA 2VQEF 3LO3A 4DCPB 1Z6OM 1TKTA 5IC4B 4F4YA 2OPQA 2RILA 2FJBB 4DR2J 2HAFA 3LF0A 2V6AA 4W4KB 2K8GA 2FVCA 1N1QA 3GLJA 1IKWB 1QGHA 2GFFA 2WHOA 1NK6A 2KHDA 3DDNA 2HVIA 2BRLA 1KVKA 2IHR1 2KB2A 5C25B 2OPSB 5J8WA 2P6SA 1RT4A 3FCWA 3UN2A 3WX4A 1H74A 3GFXA 2HFVA 5K9FA 1VHFA 4MFBB 2OTJS 4J9QA 3HM9A 1X0FA 2VBXA 4C48A 3AD9C 4TOEA 2JVRA 2C3MA 2XZDB 4DFMA 4K2JA 3KK1A 4OHWA 2V2IA 1C1CA 1RCCA 1MMLA 2E7WA 2YWGA 3G8SA 1FHAA 3E1LA 5E3CA 1M1HA 1UVHA 4Q43A 4YOEA 3B4MA 3GYXB 5B0GA 3K0JA 5KG7A 4DBQA 2R2UA 1R6YA 3G8QA 4BLGA 5DQHA 5D8OA 1WF2A 4ECWA 2ZBRA 2ZBCA 3LA0A 2VDHA 1RWNB 2RJZA 4F4AA 3K5MA 2CNKB 1CBKA 1YJVA 2F8MA 4PQAA 3GPAA 4YKHA 2XZTB 1JLAB 1JLBA 3QRPA 5B0CA 1GTHA 4X4SA 4MKVA 4NLQA 3AY0A 2CEIA 1FVSA 3R5BA 2PFFB 3FSXA 2FHJA 3FZ2A 3QSYB 5HBMA 3JS9A 4QU6A 1X4DA 3DLBA 3N5BA 5HP1B 2RDDA 1QSYA 4B9SA 3J7YI 2V8PA 4QUWA 1RABB 4X4VA 3R1HA 1YX2A 3T1HJ 2EKYA 1JLFB 3HZEA 1K9MT 1NCLA 4P9SA 1R8CA 4I69A 4IDKB 2GVDB 1S0OA 3HVWA 4J5OA 3DRYA 3UQSA 5K8PA 3HJFA 2GJIA 3JTNA 2AJ0A 1KHVA 2R2SA 1OYDA 3BGRB 3KA3A 2DISA 3M8RA 1Y7PA 1S6PA 4QZVB 2QEXS 1RAAB 3PVYA 4NXMJ 3TAQA 2XGWA 3KXDA 5F9NA 5KG4A 1R43A 3KA6A 1FT8A 3VGUA 5LMNJ 2CZ9A 3QFWA 2Y8WA 4KH1B 2YW7A 4IH5A 4DPUA 2XY5A 4I68A 4ECUA 3CD6S 1VC6A 2GVZB 3MGJA 4A4JA 2WCXA 4MMOA 5G4DA 2ACMA 4MK9A 3E2EA 3DM2A 4C3MA 4GVBB 4O0NA 3KLGA 1DBDA 3M2UB 2G2ZA 5DGBA 2CQIA 4FBTA 4X66J 3WVWA 4H4OA 2VC0A 5BR8F 4KSEB 3GJTB 1XZ1A 5D0GA 1TKXB 2X1FA 4U96A 1AXQA 3CJ5A 5CCMA 4Y34A 4JI2J 2BVZA 2CDQA 4ICLA 3PKMA 3EGMA 5E0OA 2JC1A 3BGLA 2CRLA 1UWAA 2LYVA 2EXUA 5ERKA 4XO0A 1HQUB 1LXNA 1VBKA 3CCRS 3H0PA 3TUIC 3DBYA 3BVFA 4LBIA 1M5VC 4ZLLA 1WELA 3MMBB 3PM9A 3DGPB 1N8RT 1PYSB 4M5NA 4A8YA 2VC1A 1LW0A 4J9LA 4DV4F 1N5YA 3R2OA 2CLBA 2R8JA 1VS3A 2W2QP 1V3SA 3BJYA 2LU1A 2A3JA 3Q23A 1XK8A 2HR5A 3OT9A 2LDYA 4TU7A 3JSBA 3Q8QB 1HHSA 4HT5A 3ISFA 2O1PA 5L1IA 1YRTA 3X1LB 3T19A 4LYXA 1LWCB 1VISA 4OX9F 2J5AA 3N28A 4ZVHA 4RWWA 1H98A 2B3TB 4M35A 2OMLA 2AYMA 2B4VA 1FK9B 3IMQJ 3C1YA 3VGVA 2OPQB 2V9WA 4HH1A 4Y2AA 3Q0AA 2RSQA 2A6MA 4ZVUB 3OFFA 3MXHP 5J8SA 5CD4H 1TMJA 2IM0A 2B4UA 1WG4A 2O66A 2DHAA 1SKWA 4DFJA 2J76E 2BK6A 1KVJA 1HWUA 1RT5A 1VEQA 3I5AA 2QLFB 1RT4B 4B02A 1AUDA 3F44A 1T05B 4AQYF 2MQLA 4I6WA 4ED5A 1D9AA 1WJ9A 2J0XA 2VZ9A 5T41A 3W5XA 4DZ6A 2GW8A 2B9EA 4FKYA 4LQVA 3KK1B 2JHEA 2XULA 1VQ9S 2EFPA 1C1CB 1SC3B 3SE1A 4TKTA 4FS2A 4ZLNA 2D3O1 1UJ4A 2RDIA 1YJRA 4WFZA 2WW8A 2UXBJ 1RXOB 1HMVB 3GB0A 3VCDA 4MT1A 2XCPA 3F37A 1L3TA 3FNNA 2HS4A 1NSQA 5IV4A 1WACA 2XMMA 5IX6A 3H2VE 2KT5A 4LFAJ 5HI7A 4OV6A 1G3OA 1EARA 2N3LA 4JYAJ 2GQQA 1FWPA 3MMAA 1D09B 4DG1B 4Y65A 4YB6A 1S1TA 1Z6OA 2YXLA 5F8GA 4YVZA 4H4MA 1JLBB 2OSQA 5KFLA 3QT5A 3I5BA 4LYUA 3UR3C 2DRBA 4B3OA 1S6QA 2ROGA 2KL8A 1VQPS 3LUYA 5HBMB 2QLXA 5LJ3Y 3VVUA 3N01A 4LPNA 3H25A 2C2RA 3IAS9 2FVPA 3ISEA 4PG4A 5B08A 4DR7J 3BF4A 1ZUJA 2DKOB 4DV5F 4ZCMA 5K8OA 1ZM3A 2OI2A 1A0OB 4CVPA 3HI9A 3SFUA 3BGOP 2V2ZA 1HWIA 1M5KC 2MGZB 4CO2A 5E5NA 3TZWA 1J5OA 3UWTA 4ALZA 5F8MA 4QPTA 2UUCJ 3PVYB 4WZQA 1MG7A 5D4NA 4LRCA 1YJ9S 2CJBA 4TNOA 3FC9A 1S5ZA 4P72A 1S99A 4CO4A 2DIVA 1VQ8S 2B0GA 4LQ9A 2XGPA 3AODA 3HX9A 5BYSA 2G9OA 1ZM9A 1R0AA 2R2RA 1SJ3P 3JYTA 1FESA 1HNZJ 3M6WA 1UEVA 2MQMA 3PCOB 5JVGQ 2YQ0A 3DM2B 3KFWX 3KJVA 4DR3F 1NHVA 2OEKA 1JLQA 5I3PA 3KLGB 2B56A 1JLGA 2YNIA 3WBZA 2IJRA 3DLLQ 4LREA 4H4OB 4M1KA 3NP0X 2PGCA 3RBDA 4DOZA 2AEJA 2OKCA 3M05A 2XWYA 1SI9A 3KYLA 1MN9A 2FLNA 3NOGA 3TJ9A 1HI1A 3SBMA 4ICLB 1WDDA 1RAJA 1N36J 3UD3P 4DR5J 1S48A 1H2UX 2CPFA 2C1EB 4ETXA 4HEA9 3R2KA 5E1UA 3QHBA 1KHWA 3GFYA 2IRYA 3MM5B 1S1VA 1LW0B 4DUZJ 3I55S 3GR1A 4NYOA 1N5YB 1P1LA 2OH2A 4DZDA 5A6WA 3MR3A 2DYAA 3CT9A 1U1LA 5GMDA 5L1JA 3ZTQA 4JV5J 1VIXA 4YR2A 1YK9A 4RW4A 3MPUB 5FIIA 4FPRA 2J0QD 1N32J 1TTHB 3BH6B 3UCZP 1IBMJ 4TU9A 2YQ1A 5DLFA 3QT6A 2LECA 3RB0A 3NY0A 4B9MA 2YKPA 4M94A 3GG0A 4EWTA 1P6TA 2CUYA 3GMGA 3MMJA 1WHXA 5JUMA 3AOCA 3CJQA 4B9LA 4RX6A 1K8AT 4ID5B 1JQGA 1DFDA 1RT5B 2LXIA 3AD8C 3D28A 2WSFC 4CLUA 2R4FA 4JI6J 4NASA 1IKYB 4KGXB 4ZPCA 3I87A 4LQJA 2QQYA 3H4BA 1JB0C 3NMAA 1PAUB 4CY9A 3AF7X 2DNZA 1HR0J 2ITBA 3IO1A 3MUTP 2XY6A 3LP2A 4ED6A 4F3MA 1S49A 5J1NA 1QTMA 3ZZRA 2CZ4A 3QGIA 4CYUA 4DASA 2RKIA 3EVWA 2K06A 2XI2A 2YKOA 5G0RB 1DY3A 4JYAF 3DRSA 3KHRA 7FD1A 2DNHA 2VA3A 1XEZA 3IBWA 4N5SA 4JI8F 1Z2ZA 7FDRA 2NXJA 3PX0A 2QL5B 3CW2C 1Q5YA 1HHQA 1FE4A 3ILOA 1FRXA 5HMYA 3D6TB 5H9EK 2D69A 3MMAB 1GFWB 2YKNB 5KFWA 2RNEA 1S1TB 1Y00A 3A3NB 4H4MB 5J9VA 4HHHA 1XNRF 1RTZA 3W2WA 4AXJA 4M5JA 3CCLS 3FSYA 2NZ4A 4ZCLA 4B3OB 2VG6A 1S6QB 1YLXA 2XS5A 4DUYF 4IUFA 1UP1A 1UW9A 4YS2A 4CVRA 3C16A 4QOTA 3IWNC 1PBUA 4PXCA 2BBEA 1REGX 3A8EA 1R31A 4TODA 4M5KA 4LR8A 2CF7A 4I7FA 3R5DA 3HFVA 2C2UA 1WTBA 1HNWF 3S6EA 2AZ1A 5HSPA 1XMQF 2NR0A 3N6OA 1R03A 2B9XA 1PAEX 3BZQA 4LF9J 2W25A 1L3UA 2IU2A 5A6PA 1J5OB 5LJ5Y 4RC6A 3IS8A 2GCFA 1MROA 2M4MA 5GAHI 1B0VA 1VRUB 1KFSA 1HNZF 1ZM2A 4NCAA 1RHRB 2X170 1VQ7S 5BXIA 2QN6B 5D4PA 4X4OA 2CQ1A 5EX3A 3VR1A 2E5GA 1R0AB 2FLLA 5M2RA 4R42A 3JYTB 3Q86A 5KFRA 2ZG9X 2N3OA 2XLKA 2VBWA 3SCJE 1BHNA 2J9DE 4JI1F 1HFEL 3CCWA 5CAAA 1WG5A 3HL1A 3BQ0A 1GMWD 2ZKUA 1NEEA 2Z2YB 5J93A 2OKQA 1JLQB 2RQ4A 1JLGB 2YNIB 4OZLA 4KC5A 3W63A 1RKIA 2ILYA 3OTCA 4ANCA 1LWEA 3P45B 1FX4A 2ZVSA 2BJ7A 5D0EA 4QQBA 1YZ7A 2Z2LA 1KQSR 4KHPF 3ZTPA 1UWBA 1PGZA 5KG2A 4C8OA 2HVHA 2CQ0A 1X5TA 3D6FB 3EDQB 4LR9A 1FRLA 1RTDA 4NA1A 4IO9Q 2FGCA 3KLIA 2BJYA 4DN0A 3BO2A 1KR4A 2ERRA 4TY8A 1X8DA 3BB5A 2XCAA 3PHEA 4Z37A 4YEAA 1UVNA 2HWHA 2WBRA 3FBFA 2E9TA 2FVQA 4NZ7A 1UJ5A 4O3NA 1VJXA 1EAYC 1L8IA 3T6BA 4DV0F 2D3ZA 3R2RA 5KFVA 4LF8J 5LSOA 4M5HA 4OYOA 1F0XA 2BW1A 4HVZA 4OI0A 4DI6A 5B0FA 2OD6A 3BVKA 4LRAA 3NG8A 1WHYA 3R2MA 5H9FJ 2AX1A 5E33A 1HBNA 2HWTA 3JZAB 3VTIA 1S7HA 1R7IA 4DXLA 3CJ2A 2YW6A 4J91A 2KKHA 3DLEA 3SFGA 2NREA 1EQ0A 3A8IA 2XQCA 4JI4F 1H2VZ 1Q0NA 1TUGB 4OZ1A 2JD60 1KTVA 1FF2A 3RJMB 1TP7A 1U48A 1GMVA 3CCSS 2HHHF 2DY1A 3VAHA 2UVUA 3LH2S 3KWMA 4DPWA 2HS0A 3KLHB 5T7LA 2K2PA 3TX0A 1Q7LB 2M88A 3IFEA 2H3EB 2I6WA 4Z7CA 2C2OB 1U6BA 2JD80 3LALA 4YP3A 3D0GE 3IWXA 4YMEA 2I38A 3LP2B 2YQ3A 5HQMA 4QR2A 1VLOA 4DSEA 3KDQA 1SJ1A 4N47A 1PKUA 1MWYA 2Y1LB 2YPYA 1UKUA 4CYUB 3M32A 4PEOA 1E6VA 3GVYA 2RKIB 1I5OB 2CQPA 1FXDA 2ALZA 4I2QA 4U7CA 3DRSB 2OUGA 3HKZD 4RW7A 1BFRA 3EDRB 3OGHA 5GAEI 2HWIA 1X4EA 2FY8A 1IR2A 3NWGA 2PI5A 4M5GA 4QWEA 2CAJA 1RT7B 2CQDA 3CC4S 2EBEA 1GH8A 2HGMA 1JNRB 4RZRA 2BM0A 4B08A 1FRHA 5B0DA 1BXNA 2LMIA 3W2WB 2KXHA 2HHTA 1YUZA 2MKCA 2VG6B 1FEEA 4NMXA 1C4CA 2HHXA 3LPYA 4O4RA 3M30A 3MUVP 3FSIA 4ED2A 3HO1A 4P2MA 3TUJC 1LWXA 1OO0B 3C16B 4CTAA 5JKMA 2CXEA 4WP9A 1VQOS 5KFCA 2IVMA 3A9QA 4I7FB 4R8UA 1K73T 2V34A 4J7CA 3AB2B 3KA4A 1SJQA 5L1KA 2ATCB 2H65B 1VQKS 3DLGB 5HJFA 1R3NA 4OYBA 4QIWD 3ZZPA 5LMUJ 3HHDA 1VOMA 4FVMA 4J9MA 2W01A 2F5GA 4LRFA 4RC6B 4N7TA 3T5LA 3C6UA 2IRXA 2H48B 3W9HA 1MROB 2XMJA 4AFFA 4OHYA 4C2MA 3WC2A 2ZD1A 3BGUA 4QR1A 1SQ3A 3JB9k 1KDNA 1TVRA 4F2RA 2CQ2A 2Q1LA 5ETMA 2VFSA 1S4EA 2B8QA 4QYZK 3MECA 2IYGA 2IJFA 5IT0A 1VIOA 2WSEC 3LWMA 4ZK7M 3M9OB 1PIEA 4WJG4 1PBAA 5DJBA 1UMJA 1JTSA 1RT2A 2M0GB 3TARA 2UV8G 3MR5A 1S0NA 4ITSA 2R42A 3TUZC 1U49A 3CCMS 1IM4A 4ZJOA 1VK8A 3ZTRA 3IN5A 1LWEB 4ECYA 2GC8A 4OJGA 4U9RA 5F8JA 2VDIA 4MK8A 2UUAF 1UWBB 2WWXB 3DOMA 3HHLA 4YHHJ 3OSPA 3IM8A 4FF4A 3A68A 1RTDB 4CT8A 3C14A 1OY6A 3KLIB 2RF2A 1VC5A 4TY8B 2GO8A 3BPDA 3ETOA 1VR6A 3M6XA 1TKZA 5HVFA 5FEJA 2WTFA 1RBAA 1WC0A 4A25A 3BREA 1BG7A 1JIGA 1T7PA 2AJ2A 3QRRA 2AJFE 3IS7A 1RWWB 4PG6A 4ZVQB 2AT1B 3M9MB 2L41A 5FFAA 4RBUA 3WNWA 4UTGA 2NS1B 4Q7AA 5E41A 4C9DA 2C2FA 4W4LB 1YRUA 5KFUA 1HBOB 4F67A 5KFIA 3D1OA 4LRDA 1HBNB 3KWOA 2NPFA 3OTOF 2HIYA 2DD8S 4W92B 4N77A 1DATA 2GAHC 3DN9A 2MZTA 2GMHA 3OW2R 3DLEB 1T9UA 4RR5A 1S12A 2XSFA 1WEZA 1KEKA 1H7WA 2Y9HA 3R2CJ 1F60B 3FGVA 4X65J 2G0CA 3JZ9A 2P6TA 2MKIA 4NLVA 1X9WA 2EFOA 4I1TA 3EICA 4FXWA 4TN2A 2DH9A 1FHTA 5LSRA 5T7LB 5HQ8A 2ZH8A 3UN5A 2HS3A 1IERA 3GHQA 2XMAA 5A8WA 1AFJA 4IYQA 1KLMA 4Y0FA 2E5HA 3I9V9 1IR0A 2C2NA 3T5JA 1NMEB 3THVA 1FNXH 2W8KA 4R5PA 2C28A 3DXBA 3QQCD 4TVAB 1E6VB 5ETKA 1KP6A 1RAEB 4LF1A 4I2QB 4RW7B 3T9JA 2A18A 1YHQS 2CPEA 2BOAA 2MJUA 1DTTA 2QLWA 3E3XA 1S97A 4OZNA 2Q66A 1NK7A 2KJVA 1D8ZA 4DV7F 4OFZA 3CF5Q 3HSZA 4X62J 1FFWB 3G71S 5AXMA 3P3DA 2J7WA 5F0UA 4IG3B 1LK5A 5HMWA 1FFGB 1UTAA 4RW9A 4RUCA 3PY8A 3FKBA 4WE1A 3HIUA 2R8IA 4P2XA 4J9NA 5CYQA 1TL5A 4RW6A 5KT7A 1TFYA 1OYEA 5CCLA 1IXKA 3K58A 1DQAA 1FVQA 3I4PA 2R2TA 1UFKA 3M30B 5J2NA 5CMQA 2UU9J 1SL0A 4QBUA 2C3OA 2ZWPA 3QLHA 4NYPA 3UR0A 1C0UB 4U6PA 4C8ZA 2JL9A 4R8UB 4ZHRA 4URGA 4GKKJ 3LP1B 3UVJA 3A12A 3PYEA 3J7YU 1KC8T 3C6TA 4M5IA 4PYAA 5HMXA 2DO0A 2XMVA 2YWWA 3DLJA 1RHUB 4KR0B 2W7AA 1VQ4S 2DT9A 4NZ0A 4R0EA 1OQ3A 2MSTA 1FTRA 5E2DA 4NOHA 1HKAA 4Y2CA 2ZD1B 1N56A 4ZTTA 1RJJA 4YQWA 1XC9A 1TVRB 4RC7A 3V4IA 1ZA1B 2VXIA 1CULB 3R9LA 3PJXA 3MCNA 4WTOB 4ZPDA 3N6MA 2FC8A 3MECB 1Q4RA 3FRSA 3EZ0A 1WOSA 2FVSA 2X51A 3TVYA 2Z56B 2F4FA 2VA2A 1OPIA 5M2UA 2UP1A 3BSOA 5GADI 3QT8A 3MCOA 5JACA 5FFBA 1SIWB 4J9SA 1QM9A 1BQNB 4IR1A 3SYZA 4LJMA 3DYAA 3GV8B 1SQGA 2CQ4A 4DYUA 3RE7A 2HGLA 3S01A 3KTQA 3OXFA 1H3DA 4YB5A 4L73A 4Q0BA 3HLUA 5E3PA 2ZC4A 1K47A 4XIUA 5AE1A 5IS2A 4K5RA 1N88A 4YR0A 4IQMA 4K4WA 1CVJA 3DOMB 3P49B 1AFIA 1XZ3A 2ZH5A 3MF5A 3ZTSA 4B3SJ 2HBQB 4ECTA 2LP4A 2RF2B 3QATA 3ITHA 4P6QA 4W4MA 1TKZB 4I64A 4UZBA 2IC3A 2DB1A 4TOFA 5E7OB 5E3AA 2LVWA 3JAMU 2PFDA 5CZXA 2PYBA 5B0BA 4ZLJA 2DHHA 4FKXA 3FUYA 1OWXA 4DHVA 4HI2A 2HHQA 1TFWA 2CWKA 2O5DA 3GYNA 4FDFA 1KVIA 2UVWA 3KNGA 1DPSA 1QDUB 2HHSA 2DGQA 5K53A 2HHUA 3GP9A 2N4DA 2BKPA 2YNGA 5DS7A 2XBPA 4NA3A 3G6ES 1HW9A 3NGSA 3EXYA 1ZPVA 2BQRA 1JX4A 4LMZA 3HT0A 5D8HB 2NPIA 2EFQA 2FJAB 3FBCA 4LFBJ 1S3QA 3JAMY 4UF4A 3ILJA 1EIYB 2CQ3A 3GTYX 4DR4J 4MAKA 2D1CA 2FIUA 4XPCA 3JSMA 3KLFB 4O44A 1QTNB 5HL7Q 1ZA2B 2J8SA 4AE5A 4GVLA 4HYKA 5L38A 1GX5A 3AJ2A 1WWHA 2N02A 2Y8YA 4OQJA 1RKJA 5HROA 1G4CA 5A8WB 1IQZA 3ET6A 2F7NA 3E01A 2ZE2A 2DNLA 2QJ3A 4OMFG 5LM7E 4DUTA 1Q53A 4XTTA 2WOMB 1K0VA 4LSNA 4R5PB 3EXCX 2MQNA 4EVDA 1KD1T 3E1NA 4I2PA 3MEKA 5K14A 2HK3A 1B71A 3AK9A 1DTTB 3KDOA 2GMLA 1RCEA 4K4TA 3H7GA 1Y3KA 2CPYA 3Q22A 4L74A 3NWRA 4J9PA 2ROEA 3CJ8A 3L7OA 1RCIA 4C0HA 3ISZA 4EU0A 4I6AA 3A8KA 4RW9B 4WE1B 3SXLA 2DNOA 3CJ4A 3CDBA 2GGPA 3JTPA 1GT8A 1QSSA 4KVSA 2CJQA 5CYQB 1ACMB 4DSFA 1CPZA 4DL7A 3MM8A 3PW4A 1ZAWA 5DG7A 1JLCA 4OI1A 5J2NB 2CNOB 1K1SA 1J5EF 4WFXA 3QLHB 5HVHA 5DDRC 2V4RA 5KG6A 1MU2A 4K2XA 3OR2A 4ZHRB 3MOJB 3MM7B 4HTIA 4OX7A 1IBLJ 2POKA 3UVJB 2VFUA 4FYVB 1CC8A 5KFSA 1SBRA 3PYDA 3DLHA 2JEFA 1WSRA 5LG2A 2NYIA 2WB1D 3R5AA 2HBZB 3OL9A 3T3FA 1IVZA 3RZAA 3OHBA 2GNKA 3VVAA 4RNNA 2RU3A 3PFOA 4NRTA 1NSKL 3SCLE 2V0NA 1K1QA 2JEIA 2FHOB 4PKDB 3V4IB 4OI4A 3AOBA 4ZPAA 2VPWB 2Y0SD 3CJRA 4RW8B 1FNOA 2RE1A 4D3HA 2DNQA 2OH3A 1UPPA 1NKBA 1MWZA 3M6VA 5GU1X 4FYDA 2B7BB 4KHRA 4AL5A 1GTEA 1DQ9A 2C42A 2E7VA 1TL4A 3SDEA 3CIZA 3W9IA 3DYAB 1VLGA 1VELA 3H5SA 3MOZA 3Q4NA 5I3QA 1ZOTA 1Q1KA 5HU6D 3NS6A 4Q0BB 3L3CA 3U27A 3RB4A 3PTWA 4ZS6A 1HPZA 4F4ZA 2HMIA 3PG9A 1REVA 1RWMB 4KAIA 2UUBF 4CLSA 2C3YA 3CIMA 2DNYA 3PEJA 1D0EA 3NBPA 1N48A 4PUOA 2E9RX 4CQ1A 3AB4B 3RAXA 4FXVA 4IRCA 2AGQA 2LXFA 2VF3A 2XY7A 3ITHB 2ADBA 4ZCKA 4AL7A 2MZRA 1VGYA 2IC3B 3CD0A 5GOUA 3CDUA 4URSA 2WONA 2J6TA 4EFAC 1N5SA 3ENVA 1WUUA 2IB0A 3MEGA 1DJ0A 1HBMB 1O9RA 4ZKHA 3R2DJ 3MD3A 2PA8D 4ZPTR 4CLPA 4U95A 3AJDA 2AGPA 2V8DA 1NAQA 1SOFA 3HF5A 2RQCA 1QUVA 5D0RA 1F33A 4H4KA 2HNYA 2YNGB 1MN7A 1LWFA 1FA0A 3AQOA 3BYPA 3ZZUA 4TOCA 3ZXWA 4U7UD 1VEIA 2ZDOA 1F6TA 3EPGA 3O5TB 4DV3F 2CNLB 1NU4A 1FD8A 3KJNB 4UOCA 4NEYA 1RTJB 4RBTA 4F3QA 2AYBA 3MURP 1UVMA 3DMJA 2BQ3A 2HLUA 4O44B 4J9KA 2MGYA 5I4MA 5KT6A 4JV1A 3RUBL 1BD6A 1LEOA 1E6YA 5HROB 4V19X 2HHVA 2F4VJ 4DR6J 2ZM6J 4RL1A 3ET6B 3E01B 4LF4J 2ZE2B 2IBKA 1V3ZA 3Q83A 4NPOA 4PXBA 2V2SA 3BKTA 3HHKA 4LF5J 4WYLA 1BCFA 3GZ7A 2DGSA 3U1MA 1A6LA 1PYOB 1X31C 1F1BB 3HP6A 3CJ0A 4LF6F 5KG3A 3CEDA 4BWMA 1NK4A 2GIFA 4I2PB 5K14B 2ZH7A 5I3UA 2OJ3A 4YY3F 2MKYA 1N54B 3TYTA 2ZNYA 2VFTA 4DCOB 1CS4B 3J80U 3BGFA 4E2FB 2CDRB 1KKHA 4XGSA 1ICEB 1RT6A 5KFHA 2B5JB 3THPA 3GG1A 2KU7A 2VB6A 5E3QA 1CJVA 4B3TJ 2AF6A 1VQLS 2CVIA 4ES2A 2GGPB 3IBCB 3HVRA 1NZ8A 3CJ3A 3V4MA 1T3NA 1QVFR 3UD5A 3NXZA 3EPIA 4XAKA 3M6UA 3OJUA 2WBMA 1RQ0A 2KXNB 4IR9A 5A8KA 4WU3A 1FWKA 2YPZA 2JLGA 1G2EA 3AJ1A 4ZP7A 1KN6A 3NS5A 4FPIA 1MU2B 2V8UA 1BQMB 2IFXA 4Q45A 3OR2B 2FY1A 2B8PA 5GVQA 3KUGA 3F0NA 1GEHA 2FJEB 3H20A 3TZXA 3DRPA 4NLPA 3KKFA 4CO3A 2MQQA 3CC2S 1LKZA 4GKJJ 3KG4A 3R6LB 4J9RA 1G7CB 2O01C 3VNXA 2R8KA 2AU0A 2ZH9A 4AD6A 3QIPA 4MKAA 2QA2A 4DSKA 4N41A 1VBYA 1QY7A 3R2LA 2E1MC 2MKKA 1Q81T 3D1HA 3IAM9 1OY8A 3HT3A 3C2PA 4UUXA 4O3PA 2VD3A 2HZVA 1SJ4P 4ED4A 4K4VA 2IMWP 1APSA 1P8GA 5L46A 1HHTP 1Z1ZA 1YDLA 5AE2A 2JNJA 2BYCA 2DR7A 4C11A 1HNXF 2B6AA 2B7CB 3Q8SB 2V2RA 2W4PA 1QAYA 4MIAA 1T9YA 3N0VA 1IUJA 4HDGA 2WLAA 2L9DA 5J1PA 2ALYB 5AXNA 2W1BA 2Q6CA 2JRSA 2JOQA 2KH9A 4E8UA 3FZBA 3K5NA 5D4LA 4ZIWA 3CJTA 1HPZB 1XBWA 2HMIB 1U47A 4ILMA 3G4SS 1FTCA 1REVB 5CZVA 2WSCC 5JJBA 1VQMS 5DG9A 2AJQA 2WLUA 5KFMA 3M8ZA 5C24B 1VBZA 1HYSB 1N0VC 4ZVEA 3DXSX 3NBPB 3OUYA 5ETQA 2V50A 2IY4A 2VKZG 3HMJG 1UW4A 2XHCA 3TOQA 4C7QA 3N79A 2ASYA 2ZNZA 5HQLA 1TAQA 3PX4A 2MHEA 1HI8A 4L6V3 5KFNA 1ZAVA 2W4DA 4L76A 5H9FK 3W5YA 4HKQA 3H2LA 2ZHBA 2WONB 1RZMA 4X2BA 2DNRA 2WB4A 1VI7A 2E1CA 5SZTA 4NX9A 1XIQA 7AT1B 1EB0A 1NPKA 1NH7A 1TV6B 3MEGB 4LBPA 3K59A 3GSDA 4PGKA 4TO9A 4O23A 3BSCA 4E0DA 5EWEA 4PWWA 3W3SA 1QSLA 4K59A 3BBCA 3KG0A 1RUSA 3NOZX 1VYAA 1SVDA 2VPXB 3RW6A 3MZIA 2EK1A 2MY8A 4M5MA 3PXGa 4F25A 4JI7F 2HNYB 1B0PA 4RWXA 1LWFB 4WWSA 4NWBA 5C42A 2FDNA 1SCJB 4IH7A 2DR9A 3D2WA 3NCQA 4F0MA 4C8YA 4NLSA 3SEOA 3D66A 3DKDA 2HNDB 3SQGA 5KG0A 1R8AA 3NEKA 3BVLA 2PI4A 1ZH5A 1GXUA 4TYBA 4CLWA 1RE1B 1KSPA 1X9SA 3V6HA 2BJ1A 4B9VA 1U8WA 2DR5A 3PW7A 1T0TV 2NYHA 3FFIA 3DMJB 2DCLA 1NPPA 3R2HA 2VG7A 5KG1A 2Y44A 3NNHA 3US5A 6FD1A 1YVFA 2C2JA 4FNIA 1LNQA 3C21A 1E6YB 1Q79A 2V94A 4QIEA 4NCBA 3MR7A 2R7OA 3VAGA 1Z2LA 1YJNS 4NCGA 4RKUC 1H0HB 4C4WA 5A2QU 4HHJA 1XERA 1TKPA 2ZA8A 2MKJA 2EI5A 4RUHA 1V5VA 3HDSA 2HQGA 1OQ6A 4M5DA 4CO1A 2RVJA 1HWLA 1ZM4A 2DJWA 3GJSB 5BR8J 5I3UB 2CPDA 4RNMA 4EBCA 2RDJA 2A2DA 3QZ8A 3UOFA 1X4CA 2XMTA 3IR6B 2E5IA 3QD8A 4NXNF 5GAEU 1URNA 5F8LA 3W8PA 1RT6B 1RWOB 4K50A 1LQ9A 2PEBA 1CJVB 4WFBQ 2NSCA 4ZVFA 4QR0A 3GYGA 3GU0A 3I0SA 3DOLA 5KFKA 2HGNA 3RAVA 3QO9A 5A8KB 4ANDA 5L1LA 4LT6A 2DEIA 2QC3A 3SV4A 2IDLA 2KO1A 4OZ3A 1B0TA 4EEYA 5EHHA 2V8GA 4JI5F 5IWAF 1GWGA 1XMOF 4J37A 1T9WA 3R7NB 3M8WA 1N5VA 3F73A 2R7WA 1KFDA 3WQPA 4OX9J 2V2PA 2W4CA 1VLYA 3H7HB 3O6QA 1U25A 1RCXB 2YH0A 1RT3A 3CO0P 2VQFF 2FJWA 5D8QA 1KRPA 3L0MA 4KGKA 2DVIA 4ZN1A 3BYRA 2PD1A 2ROPA 3GE4A 4EMDA 4ERDA 1Q5VA 2ZOGA 2HFSA 2QL7B 4EZ9A 5HJXA 3R6GB 4KHMA 4IQXA 4DV2F 4M34A 4C11B 3G6XA 5DETA 3I6PA 1Q8LA 2B6AB 3VV2B 5D78A 1OSDA 3BSNA 3BDEA 4AQYJ 2BM1A 1RBOB 1RWUA 4PGIA 1RTIB 2CPZA 2HQCA 2HFNA 1BGXT 4F4XA 3S7RA 2BZ2A 4WIQA 2QT7A 3QIDA 2FD2A 2FL0A 1PJ7A 3KK3A 4FP9A 3RAQA 1UFWA 3W62A 1UEKA 3DNCA 3WZ0A 2UXDF 5JDOA 4FXDA 3OUYB 3MI7X 3QGGA 5DLGA 4GRSA 2OTLS 5EN1A 2LCWA 5CYMA 1NKEA 3CGIA 2JX2A 5DM6Q 3DLKB 3MUMP 3POTA 2ZG7X 2UXCF 2WVEA 2KZZA 2R7RA 1CJUA 2F9DA 2C2KB 4J9VA 4A8XA 4UQTA 4KJIA 4P7VA 6AT1B 1T95A 3OJ5A 4F8RA 2HNZA 4BWJA 1HL6A 2IVFB 3FVBA 2BA9A 5CD4A 4K0KF 2Z57B 3IM9A 3K5LA 3BM7A 3P6YC 2CHIA 5ETOA 4EZ6A 1M90T 4ZCIA 4ELTA 2VFVA 2CQCA 4V1Ak 2BOPA 2QTWA 4DV5J 1QVGR 5C42B 3EUNA 4JV0A 2W9AA 3M7VA 1FDNA 5LSLA 5HLFA 2Z2ZA 5DRKA 1EHWA 1RLDA 2PMZD 1BC6A 5F0WA 3HVTA 3FEYB 3SQGB 5CH7B 1S1UA 4CLYA 4W90B 4FZVA 4CIOA 1HWKA 2D9PA 1T9VA 3GJQB 2EWHA 3FFIB 1PC4A 3BBFA 2VG7B 2QA4G 4F3OA 1MMNA 4CVTA 2CFXA 1M0SA 5MAOA 5E2QA 4CI0B 4ZLPA 1X9MA 2D9OA 1WC5A 4NLOA 3QZ7A 4NCGB 2R7TA 4DCJB 1U1QA 1YTYA 3TJAA 4HACA 1I1GA 2H5EA 4DR3J 1A7GE 3KHGA 1OTKA 3BR8A 2W8LA 2UX1A 1UCNA 2XNQA 4CH7A 5IQ6A 4PG0A 4M5DB 1ZTTA 3AJPA 3K89A 3EM1A 2I5JA 5C5JA 3C1ZA 3IXQA 3D1QA 1Y5IB 2KDOA 3TP2A 2RQKA 4MKBA 3H90A 1U09A 3VGTA 5FLXU 3SCKE 2FHMA 3T9NA 4AM4A 8ATCB 3QJLA 1JIHA 3RU0A 2L3MA 3ADAC 5LT5A 3I0SB 1B4SA 3DOLB 4C8NA 5BYRA 4HH0A 2XKQA 3QO9B 1UZHA 1RDRA 1JKVA 3DOKA 5EX0A 4ANEA 2ZZNA 5LXYA 4P2FA 4P73A 2G2OA 3PO4A 4KQZA 3E1MA 4XPEA 3CNQP 4DSLA 1TKTB 1C4AA 1LKPA 1DHMA 2Y3QA 3PVTA 4ID8A 2DHGA 5KFFA 2RHSB 4A8SA 2EVZA 1QUPA 2BJ3A 1EP4A 2RMLA 2FJXA 1Q8IA 1R8BA 1RT3B 3CXCR 2OP5A 9RUBA 5E3RA 2VASA 4A8OA 3IR7B 2HZCA 4XK8C 1WKJA 2XYHB 2VONA 2X1BA 2Y1JA 4Z7YA 4ZMCA 2E5LF 3PRDA 3CJSA 4M5LA 4Y6IA 4JBCA 4C98A 2WTLA 3FI6A 1S9EA 2KN4A 4F02A 1BMQB 4ZVRB 4CWBA 1X0PA 4QPXA 1RWKB 2E9ZA 2FFXJ 1NJZA 4N8OA 2HEKA 2Z6MA 2B4PA 1YI2S 2ZHOA 3OQ2A 2O67A 2QA1A 1D8YA 1QAIA 1JLEA 4JI3F 1JWWA 2V2VA 1UVLA 1IKVA 3B78A 3O8WA 3IR5B 2W9BA 5HK4A 3F56A 1ZS6A 1TZ0A 1UL3A 3KK3B 1S79A 4CNYA 3I9ZA 2WRMA 4LF7F 5JDOB 4ZL5A 1RTHA 1FNMA 3R7BB 4WFNQ 4BBYA 5IZHA 1R89A 3A1YG 2F3JA 4JI0F 2OHDA 4JI8J 1AZSA 5CYMB 1M5HA 2CKWA 2DGWA 2GIQA 4G1QA 4ZVPB 3PR5B 1XR6A 2VJVA 3POTB 3DC2A 2QMWA 1EZZB 1CJUB 4WK3A 5H9EJ 1OPZA 2ZBPA 3QT7A 2J6SA 4LIRA 1XR5A 1I51B 4N8NA 1XNRJ 4EBDA 1YV1A 1NNDA 4X4TA 1Z4UA 2E1PA 2P5VA 1U2FA 3BKUA 4W98A 2HNZB 3CO9A 1GXLA 2Y1RI 1S1WA 4DUYJ 2YBVA 1S1XA 4YXJA 4ED3A 5IQQA 3A3OB 3UNYA 2FZCB 3TR5A 4DV1F 1AEWA 4CRJA 1RHKB 3CE8A 3MPYA 4DX6A 1BWEA 2ZH1A 3TVKA 4ZMMA 1HNWJ 1RA7A 1S6PB 2PE8A 2R8HA 1TL3A 5HLFB 2YX7A 1XMQJ 1IBCB 4DYXA 1F30A 3ILLA 3Q24A 4O4GA 4IG0A 3MM6A 3TAMA 2QYGA 4OYMA 4WK1A 4OYWA 1YWXA 4C6AA 2FJCA 2N7YA 2Q43A 2E44A 2V2MA 2QMUB 4P75A 1WHWA 2HKEA 2BQUA 2OMOA 4AUKA 4NEZA 3D9BA 1T03A 1X60A 2F63A 2JEJA 3KHKA 2G2YA 4HTJA 1JI4A 2OEJA 4ZJQA 2UUTA 1R0CB 4Z3BA 1B3TA 3GGZA 1NLKL 5C2CA 3SZ2A 3Q8RB 4DX7A 2BJ9A 4JI1J 3D68A 1WD6A 4B3MF 2ZZMA 1JXEA 3NCPA 2L08A 1D1UA 1R6VA 3K8WA 4ITTA 2QE5A 3MEDA 5CABA 4KVRA 2WW4A 5DQIA 1IM6A 4ZIVA 4RO0A 5ERJA 1VK3A 4PQUA 3T1YF 4CMYV 3W1YC 4DU8A 5D3GA 4DSJA 1YIJS 4C0BA 1TU0B 2RS8A 2I5JB 1JMTA 2IA0A 1ZS3A 1GMWA 1WOOA 4KHPJ 3L09A 3OBIA 3G86A 2JFKA 3CD5A 1OY9A 2HPUA 1FEHA 3J81U 4H4KC 2BEFA 2BKCA 1RAFB 4TY9A 4MKUA 1F5AA 4USJC 2RIJA 3O44A 1HARA 1FKPA 2EEYA 3BO4A 3G96A 3PVXA 5K8MA 4NE9C 1UFLA 3TJ8A 2XJMA 1RACB 3I4HX 3W61A 1NK5A 3PO5A 3Q2SC 4DV0J 3DOKB 2HAIA 4A8MP 3NGUA 3TQ1A 3EZ5A 3EX7B 3ERZA 2R9LA 1RWXB 1VQ5S 2DRAA 1U1NA 3PDNA 2Z8QA 1Q8KA 3TA1A 4EBEA 3PVTB 5KFJA 5A8RA 3B4DA 1X5SA 4B9TA 1LW2A 1EP4B 4DYYA 3Q4QA 3P5TL 4PPZA 3NGRA 1WHVA 3PRBA 2E7XA 4MUDA 1ZZFA 5EGYA 2LEPA 1S0VA 4PYDA 2RQMA 4OYXA 4Y28C 1F9HA 3QJPA 1RWVB 1K44A 4P52A 1SB6A 5F8NA 2RHQB 4JI4J 1I3OB 2DCUB 3AJQA 2YWHA 2E5JA 3TX8A 1ZTWA 2OGUA 5JVHQ 1QAXA 1H73A 4X4QA 1DQ8A 2HHHJ 1JK9B 4X64F 2QO3A 4NLDA 2NSBA 4G3IA 4C3KA 2QMXA 2YX1A 2HVEA 3ES3A 3L9ZA 3NNAA 4HR2A 1RT1A 2DEJA 5MLCV 4WXWA 1JLEB 2BDPA 5M2PA 3HULA 2FZGB 2CQHA 1IKVB 2XO6A 2B9YA 4EGLA 4E40A 2W9CA 3BS9A 3CCTA 3FEZA 4DZ0A 1KQGB 2W9BB 4ZVGA 2E1RA 4ECQA 2D74B 4ERUA 4PZVA 3TUPA 4ELVA 2EK6A 4XKSA 2ZHAA 1VBXA 1JLAA 2HVZA 3W64A 3K7RA 1RTHB 5C6FA 2WVCA 3RR7A 4OYPA 3PW8C 2AIRB 3H4DA 3OV7A 4KTQA 2GJFA 2MTLA 2M9KA 4F36A 2QL9B 2ADCA 2D7SA 5HP1A 1AZSB 4I6YA 3OJSA 3VWSA 2QFJA 4G1QB 3VAKA 5J2PA 2XJNA 2DHSA 4WCEQ 4DV6F 3MAAA 2OFHX 3IWLA 4KGZB 2YWFA 3D6MB 2CQBA 5JXSA 3TVZA 2KYXA 9ATCB 5ETRA 1HD0A 4IDKA 2GVDA 3IGNA 3AXMA 3PV8A 1U45A 3M8YA 5GU3X 1S1WB 5LXRA 2XYPB 2W2PP 1WKKA 2FHKA 3AH6A 1I94F 4CH1A 4AL6A 1YJUA 4K5SA 2ZJPQ 1IWGA 4U8VA 5U47A 2DGUA 2HRYA 4DQIA 1TL3B 1FJ7A 4B9NA 3KUHA 4LFCF 3FMBA 3H2UB 4FYXB 4ZP8A 2ZA7A 3N4WA 4EK2A 1RU2A 2P9GA 4IG0B 2OIHA 3MM6B 3TAMB 4ISPA 2VL1A 4QWAA 3SSSA 3GIKA 5KOXA 4TW3A 1IR1A 2MZSA 2VKRA 3S1TA 5KFOA 4CMYA 3VAMA 3V81A 4RUBA 3CD7A 1ZETA 1T03B 4EYHB 3QAEA 4ZVOB 4CH0S 3M2UA 3OFEA 4ZDNA 3CVKA 3I0RA 4QYZJ 1RA6A 3QRQA 1TK8A 3RB3A 4EO6A 2IAJA 3K5PA 3KJVB 2CIMA 2Z90A 3DDKA 4X4NA 3H8YA 4OZ0A 2R3VA 3SSRA 3B6BA 1TJOA 2G38B 1W26A 1CJKA 2GZOA 3AJOA 1AROP 2RUGA 1TQLA 2V2QA 1HQUA 1Q7YT 4Y2MA 3MEDB 2EC2A 3PR4A 2FJDB 3GIMA 5KFYA 2Z2MA 1H2TZ 4PABA 1KRQA 4PQUB 4TXSA 4ECSA 3DGPA 1PILA 2NXUA 3VQTA 5D3GB 4A8FA 2ILZA 3I56S 3NGTA 4DLEA 2UUAJ 4TYAA 2W0OA 3ZC4A 1U4BA 5D15A 2G0JA 1F5CA 2GO9A 3LANA 1S1VB 4OI3A 1ROFA 3PACA 2Z30B 3OHAA 4O3SA 2LEBA 4ITWA 1YJTA 2V5HG 4AT1B 4J9UE 1FKPB 4WTYA 2KFZA 2DXDA 2LDIA 3T5KA 4DMZA 2W7PA 3PX6A 1U26A 4USMA 3O3LA 3UDVA 2MDAA 1FK9A 1WF0A 4RW4B 4KFBA 2VBZA 2LQ5A 1UVKA 3QWPA 2LKZA 4QWDA 2LEAA 2HURA 5GMKa 4V19J 1VHIA 2FLPA 4ES3A 2YWEA 2AJ4A 1XNQF 1N34F 4DL2A 4LVOP 1LXJA 3UDCA 4IOAQ 2NUHA 3RBCA 3MFIA 4F4KA 3HVAA 5A8RB 1LW2B 2BANA 3OTOJ 5D8YA 5D6GA 3AF8X 1U0HA 3NL0A 1HQ2A 1N0UA 4RLEA 1RAOA 2ZDPA 4HLBA 1FRIA 1T05A 4DQPA 2YNFA 2JJ4D 1X4BA 2V68A 4PG8A 4G1PA 2VHGA 1N33F 1RADB 2W2OP 1L5UA 4ZITA 5KFBA 3NKYA 1FE0A 2KYZA 1FO1A 4Q2MA 1EQMA 1SJFA 2E1AA 2KVQE 4DF4A 2Q6BA 5D8XA 2RS2A 1IJFB 3M2VA 3GV5B 1QYBA 1R0BG 4FYWB 3CC7S 4B3RF 1C1BA 2C2EA 1HMVA 1RT1B 4Z5SA 2CLUA 3J7AN 3HKWA 3E6SA 2NXCA 3CUNA 4RBVA 3QMQA 2W9CB 4EO8A 1PCAA 2JFDA 3BN4A 2MJNA 4CO5A 3TANA 2C22A 2FG8A 4DG1A 3FQKA 5CA5A 3UO0A 1FJGF 1ZYQA 4Q2LA 1UA0A 2CYYA 2ZVIA 3OLAA 2KM8B 1UPMB 3VZIA 3Q8PB 1HNIA 1SKSA 4PG5A 4WP3A 2LFVA 2DY9A 2CJAA 5J2PB 4DV7J 2EPIA 3MAAB 4L72B 2HSEB 4DL0C 3G8TA 1Y0HA 3C3LA 3GJRB 3K2YA 3M8QA 2R7UA 4DFPA 2E66A 2MGZA 1K0TA 2MPUA 5CXTA 3NP2X 2C3UA 3LPEA 3RAMA 4EVBA 5L9XA 5J1EA 3PWQA 1HQEA 1TKDA 4MKYA 3FK4A 3IQ1A 2BMBA 4MK7A 2D3UA 4O3RA 4WZMA 1SKRA 3RGIA 2YY3A 2D5KA 2C3PA 2BJ8A 3LGMA 2G0IA 3C46A 2JZ5A 4L75A 3BSAA 4GMKA 2RRBA 4EUVA 1NSPA 3F34A 1PJ6A 2MSSA 2C2MB 4TQSA 2EFVA 1LFPA 3I82A 4KY3A 3SIPB 1KOOA 5DZ7A 2Z5PA 5HATA 2P9EA 1PG5B 4HL9A 4I4BA 1UJ6A 3V5RA 6FDRA 3V81B 2H5IB 1S4FA 1S6UA 5AJ3F 5FFEA 2ZKTA 2J9CA 2BABA 2XGQA 2DNPA 3I0RB 3MEEA 4DS4A 3MWBA 4ZPWR 1IJEB 1SL2A 2IAJB 2KG0A 5HN0A 3WVUA 1QJHA 1UA1A 1HI0P 3E51A 4PG7A 3KG1A 1HLWA 3TA2A 3W54A 2ZOMA 3HD1A 3OR1A 4PAAA 1VJWA 2FJVA 5DM7Q 2ATLA 2FHAA 1CJKB 4TOHA 2WVFA 4LPJA 4DYZA 1HIYA 2NUUG 2QF9A 4I56A 2HW3A 3ZZTA 2NXNA 4CYBA 5HANA 3Q4OA 3KA8A 4MN9A 2MKSA 2CN7A 4RC8A 4ZP9A 2M2BA 5EWGA 2PIIA 4QCLA 4USTA 3MM5A 4DL5A 1NDCA 5IV3A 2HZAA 2HG4A 2EG1A 5IT4A 4C3LA 1GQEA 1URRA 3UOIA 1NK0A 3SHXA 3M6JA 1VQNS 3A4TA 3BV8A 2M8HA 1NSAA 2Y0BB 3SCIE 5GU0X 3SQOP 2AW0A 1SUQA 4NLRA 3WX8A 2X1AA 4F0HA 4DR2F 3QGHA 3TEGA 2VFRA 2PN6A 2R7QA 1O8BA 2IM1A 5LG8A 2OSRA 4KFBB 1U02A 4CM0A 1HW8A 2F9JA 4IRKA 5KOWA 4IWKA 3OFGA 2IPOB 2A10A 4TU8A 4RNHA 1T02A 4KV8A 2DGXA 1VRTA 2H54B 2ZC3A 3D3CJ 4USHA 3RRGA 4ID5A 3D5MA 3RBEA 2BANB 4K4SA 1U0HB 1IKYA 1RAGB 5CYJA 1MOJA 2DTJA 4DR1J 2HYIB 3F32A 4KRWA 2YNFB 2EG2A 1VC0A 5KAKA 3ELHA 2FZKB 2I9SA 1SIZA 1LV5A 4F0KA 4ZOSA 2IYIA 3VHQA 2HQFA 3GIRA 3NS7B 2M7SA 3RB6A 1AA1B 5BJRA 1HRSA 3UPFA 3ZZ0A 1LKOA 5KFGA 4LR7A 3M2VB 3I96A 4CVSA 4XKUA 3Q8VA 1C1BB 2CN6A 3O7RA 2FHJD 1UVIA 5G0RA 3C19A 3R1LA 1KBRA 2MLZA 3CDEA 3D67A 4ECVA 3WDOA 2AMCB 4XKTA 3M32B 3UNOA 4P10A 2BKOA 1RU1A 4KPYA 3NMRA 4I0WA 1Q82T 3D19A 2J7UA 3FCVA 5SUHA 1ZPWX 2M52A 2V8TA 2YKNA 1RAHB 4KKOA 3C23A 3EGZA 1YBUA 1OJ4A 3R3TA 3T1HF 1ELOA 1R8PA 2CG8A 2OPPA 5B0AA 2QV6A 4OHVA 1HNIB 2LQBA 3DHWC 3OTEA 3WIVA 3AOAA 4JB8B 2LQ9A 3GCWP 2UV8A 1BY9A 2PT0A 3ZNUA 1YJWS 1YUXA 2HLTA 2DBBA 3BN7A 2NXEA 1NF6A 3D0IE 2FVRA 1WORA 2RD5C 2RRNA 3MM9A 4BC9A 4NXMF 2YH1A 4CTAB 4U8YA 3M8QB 2QLBB 3ZNJ1 3MPDA 4P18A 4MTPA 1RYTA 1JKHA 3CCJS 1Y4ZB 4C8LA 5J1EB 1HQEB 3VV9A 5LMNF 5GAGI 1J5EJ 2QYCA 4WXOA 2DNMA 3ONQA 3ZZYA 2GA7A 1FDBA 3NGDA 1NJIT 2HRTA 1VRUA 3CMQA 4UW2A 3TRGA 5J2MA 3C6UB 3LKDA 1FKOA 4OYAA 3MPSA 3HSGA 4X4UA 3KK2A 1AUSL 2XMKA 2AEFA 3N6NA 2M3DA 4K4YA 5HQOA 4X66F 4YB7A 4OYNA 3PW1A 3QZ3A 1XJWB 3A3PB 2VG5A 2AX0A 4JI2F 2J9DA 1M1GA 5FDLA 3BBBA 1TKOA 3MEEB 1SC4B 2RT3A 1RT2B 1ITPA 2IM3A 3PNIA 1YG0A 1X4GA 3DU5A 1TUVA 4Q5VA 3UCUP 3H5XA 3OR1B 3LGNA 2C6RA 1DLOA 2QSFA 2YKQA 2RRAA 2I0XA 3T5HA 5ETVA 1RHQB 3B54A 4EI2A 1M5SA 1M5PC 1G1XA 3SI8A 5DQGA 1YQHA 4PRFA 4DLGA 1X4HA 3PW5A 3HHLB 1NF4A 5D0HA 4G65A 1LB3A 1SV5A 3C14B 5EUHA 2U1AA 4M8LA 4NLUA 3RBZA 3VAIA 5D8PA 2MZQA 2UUBJ 2XSJA 3KHLA 4DEZA 2Q3PA 2QLJB 3CWJA 2OAUA 5IOLA 2KTQA 3UNGC 2AQ4A 3BO3A 4OZ2A 5KT4A 4DWIA 4LSZB 4TLQA 4LSLA 5KFEA 1SUQB 1EETA 5F3TA 3HPOA 4CYAA 5HJYA 2YJJA 4USUA 1RI7A 3PIOQ 4AYBD 5BYQA 4PR6A 3PWFA 1F2GA 2CJXB 3OXGA 3UDEA 4ATNA 1RK8A 3L7PA 1NHUA 4AM2A 1NHKL 4A47A 4X0JA 1RHMB 2Z5QA 4KV8B 1IBKJ 4ILLA 2MXYA 4TQRA 3KUEA 4DR1F 1VRTB 1RWPB 1O6XA 1FDAA 4UOHA 5KFPA 1MNEA 2BE7D 2QA4S 3O2IA 4REUA 2MZJA 3OTBA 3KLHA 3P8BB 1J30A 1V9OA 2DPJA 3NP5A 3OTDA 4KGVB 4OIXA 3PJWA 1CSJA 1HBUA 3JSYA 4DV3J 2BE2A 2UXBF 3HHNB 3W66A 4DU7A 2J9EA 3CDAA 2M5YA 1KLMB 1PC5A 4LFAF 4DPTA 1IQTA 2WVDA 2XMWA 3R97A 2B43A 3M8SA 3WC0A 1EX8A 1FERA 2LQ8A 2XO7A 2DR8A 1JREA 2BE9B 2WK4A 2DGOA 4H54A 2K7JA 1RT7A 2HBYB 4NLXA 3N5FA 2RH3A 2ZJQQ 3VALA 3ENWA 2F8HA 5JKLA 1NBEB 4RUAA 4QW9A 3NGKA 1F5BA 5ADZA 3WIUA 3MCSA 4LF6J 3Q2TC 4KKOB 1Q78A 1RYSA 2GMJA 2RUSA 4DR7F 3D4JA 3Q8UA 3OLBA 3W2VA 3AHPA 2OPPB 3LAKA 4YY3J 3E1JA 2XI3A 3IG1A 3W60A 5D4OA 3T6JA 5KT3A 3QAUA 4RW6B 5CMRA 2XLIA 3H59A 4LQHA 3CMAS 1Q8BA 1NB7A 3MM9B 2UUCF 2GYQA 5HO4A 1MLAA 4IFYA 2R7XA 3DLGA 2JH3A 1S72S 4USWA 4O3OA 2CZVC 3FCHA 1FRMA 1JKHB 4Z2XA 4LQ3A 3LTOA 3ENAA 2BV3A 3F33A 3D6HB 4YXMA 3C6TB 3EMTA 4UT4A 3TI0A 2MQOA 4A48A 5KFXA 2DXEA 3RR8A 2LA6A 5FFCA 4LVNP 4WIIA 5J2MB 2R7VA 1YGYA 2Y1IA 1FKOB 3G82A 2CJ9A 2QIFA 2YTCA 1AB8A 2P9CA 1HA1A 3UCGA 1S10A 2HFZA 3BEGB 1KQFB 3G87A 3KK2B 4RC7B 3G2XA 2OPRA 3DHXA 2XMUA 2ABYA 2V2NA 3LP0A 1ZZNA 4J9OA 3PW1B 3L7UA 3F36A 4WF9Q 3FRZA 2VG5B 4NZ6A 2OELA 5FDLB 2MZ1A 3TAPA 4Y3CA 2GS4A 4HI1A 2YVSA 5EDWA 1L3KA 1X5OA 3UN3A 4M95A 3DGVA 2VPYB 4GC7A 1F3VA 1DTQA 1HNXJ 1N36F 4OLPA 2V4JA 4IOCQ 1Y5NB 2KM8C 4DR5F 1WC3A 5JKMG 1FFSB 3P5BP 3AF9X 3DDIA 1M5OC 2AYGA 1DLOB 3Q89A 4DJBA 1IESA 1ZBTA 2VPZB 1W2BR 1FI4A 1NDLA 1N5QA 4DUZF 4C8MA 1RP5A 4CP5A 4HT7A 2HQDA 2OFGX 5GMEA 1LFWA 2EW9A 1SV5B 2EC0A 4JV5F 3PZAA 4XDCA 3GILA 1NXIA 2KT2A 1N32F 2MMYA 2XSJB 1QE1A 3TZZA 5L39A 4ZA1A 1IBMF 1BE4A 3GV7B 2BW2A 2JD70 2ZITA 4CCHA 5I42A 3ICLA 4ZPVR 4ZJKA 4LSLB 4QIVA 4M32A 3K8VA 2E29A 1EETB 3GIIA 4FS1A 1U1PA 3MPWA 4WKRA 1HBOA 3CULA