3GHQA

Crystal structure of e. coli w35f bfr mutant
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
158
structure length
158
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNFGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Bacterioferritin
publication title Monitoring the iron status of the ferroxidase center of Escherichia coli bacterioferritin using fluorescence spectroscopy.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 72
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2009-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ghqA00
3KA9A 3R2MA 2ZA8A 5D8YA 1UVHA 3F35A 5GU1X 2FKZA 1VEQA 3ERZA 3F34A 1N1QA 4TOGA 1S3QA 3PVRB 2YW7A 4LQNA 2CN7A 1NNQA 3PVTB 2FZFA 3GHQA 5GN8A 4PG0A 3F32A 1S2ZA 1UMNA 2VZBA 1R03A 5FFEA 2FJCA 3EZUA 1BG7A 4IWJA 4XKSA 4DYXA 1B71A 1L8IA 1S30A 3A68A 2X170 1XZ3A 4KVQA 4LYXA 2Z5RA 4AM2A 1MOJA 4RC5A 2FG8A 5I4JA 5FFCA 3AJOA 1TJOA 3E1OA 4RC7B 5J8WA 2VXIA 2CIHA 3PVYA 3VNXA 2C2JA 3Q4QA 1AEWA 1IESA 3PWQA 4TODA 2JD70 4II4B 3FVBA 5E1UA 1TKOA 4YKHA 2C6RA 4TOBA 1LKMA 2C2UA 3UNOA 2V2OA 3NP0X 1Z4AA 2Z6MA 3IS7A 4CMYV 3AF9X 5D8SA 5LBHA 2CHPA 1Z6OM 3F38A 5D8QA 2BKCA 4ZL5A 5JKMG 3OGHA 4M32A 3RE7A 2BW1A 2OH3A 3KA6A 1SQ3A 3E1MA 2WTLA 1TK6A 5J93A 1IERA 3H7GA 5JACA 2XJNA 2CF7A 3FI6A 4PGKA 3WVUA 3UOIA 1DPSA 2FG4A 3IQ1A 2JD80 4TOCA 3PWQC 1VEIA 3BKNA 4TW3A 3HIUA 5CMRA 2ZG9X 3SE1A 5LG8A 4Y08A 2YJKA 5FEJA 5GU0X 2Y3QA 1JKVA 3R2OA 4LQVA 3PW8C 3R2SA 4DYYA 4ML5A 1JI4A 3SIDA 4EVBA 4CY9A 1JYBA 2CEIA 4M35A 2YW6A 1GWGA 3PW1A 1TKPA 4IWKA 2GYQA 4LPJA 4CYBA 3EZ0A 3A9QA 4TOAA 4Z5SA 4CVTA 4AM4A 1RCGA 1JIGA 3AJPA 5JKMA 3Q4NA 4CVPA 2ZURX 4DASA 3BVKA 4DYZA 2F7NA 2QQYA 2V2JA 1JTSA 2V15A 5HJFA 3QB9A 5IX6A 3SH6A 3RD0A 4OYNA 1XZ1A 5GU2X 3AF7X 1JKUA 3R2RA 1YUZA 3PVYB 2WLUA 3PVRA 1YV1A 5ERKA 3PZAA 3Q4RA 1VLGA 3KXUA 2WLAA 3SHXA 3AK9A 3ES3A 4EVEA 3MPSA 3KX9A 1LKPA 4M34A 4ETRA 3RGDA 4LQHA 3EGMA 4DYUA 1RCEA 1ZS3A 2FHAA 4MJYA 3UOFA 1NFVA 2V2MA 1RYTA 4CMYA 3BVFA 3F37A 2QF9A 1VJXA 3OJ5A 4TO9A 1QYBA 3QD8A 5D8RA 3R2HA 4QUWA 3TA8A 3RAVA 2CLUA 5CZUA 3KA3A 4ISPA 3BVEA 5FFBA 3QVDA 4XKTA 3QZ3A 3BVLA 1RCCA 2V2LA 2GYDA 4AM5A 1Z6OA 1F30A 2XGWA 4ITTA 4RC6B 4ZKXA 3F33A 4PG1A 3QHBA 3PW1B 4E6KA 3U90A 4MY7A 4DE6A 2RBDA 4MKUA 4DI0A 3R2KA 3PWFA 3WVWA 3R2LA 1YUXA 4REUA 5JKLA 4Z3BA 2BJYA 4LYUA 4ZKHA 3KWOA 4P18A 4A25A 1LKOA 3E6SA 1FHAA 2Z90A 1BCFA 2PYBA 4CYAA 5FFAA 3FSEA 4MUDA 4TOHA 2V2NA 3O7RA 5GN8B 3BVIA 4PGIA 5LG2A 4KVSA 2IB0A 1O9IA 1O9RA 2HR5A 3GE4A 3KA4A 4ISMA 1NF6A 3O7SA 1L8HA 3NOZX 4RC5B 5ERJA 2ZG8X 3BT5A 5GOUA 3E1NA 2XJMA 1HRSA 4EVCA 4M33A 2ZA6A 3WNWA 4ZJKA 2V2SA 2C41A 3PVTA 2Z5QA 3WVVA 2D5KA 1RCDA 3E2CA 2ZG7X 2HTNA 5K52A 3HL1A 1KRQA 5GU3X 5JKLG 4LQJA 4ZTTA 1DATA 1NF4A 1OTKA 3AJQA 4CVRA 1H96A 4TOEA 2GS4A 5HJHA 3KA8A 1DVBA 3GVYA 4DZ0A 4ZMCA 1JGCA 4XKUA 2ZA7A 1F33A 3F36A 2XJOA 3E1QA 5CMQA 4RC7A 3ISFA 5D8OA 2VXXA 4MN9A 1BFRA 2W0OA 1LB3A 3PW8A 1ZUJA 2CN6A 1EUMA 3QHCA 4R42A 4II4A 3AK8A 1JREA 4ZKWA 4XGSA 4EVDA 1VELA 1RCIA 5C6FA 5LS9A 3E1PA 5AXSA 2UX1A 3AF8X 4ERUA 4KVRA 2BK6A 5J8SA 3F39A 5E2DA 3T9JA 4LPMA 3E1LA 4LPNA 4ITWA 2CLBA 2G4HA 3IS8A 1QGHA 4RC8A 5K53A 3Q4OA 2XKQA 5D8PA 5J9VA 2CHIA 5FFDA 2JD60 2FL0A 2IY4A 3NP2X 4IXKA 4U3GA 2YJJA 5HQOA 2OC5A 4ZLWA 2V2PA 3RBCA 1MFRA 4ZL6A 2FFXJ 1J30A 2V2RA 2Z5PA 2ITBA 2C2FA 3E6RA 1JI5A 4CVSA 4RC6A 5D8XA 3E1JA 3ISEA 2IU2A 2V2IA 1SOFA 4TOFA
chains in the Genus database with same CATH superfamily
3KA9A 3R2MA 2ZA8A 5D8YA 1UVHA 3F35A 5GU1X 2FKZA 1VEQA 3C1YA 3ERZA 3F34A 1N1QA 4TOGA 1S3QA 3PVRB 2YW7A 4LQNA 2CN7A 1NNQA 2MGYA 3PVTB 2FZFA 3GHQA 5GN8A 4PG0A 3F32A 1S2ZA 1UMNA 2VZBA 3C23A 1R03A 5FFEA 2FJCA 3EZUA 4KXRB 1BG7A 4IWJA 4XKSA 4DYXA 3GGYA 1B71A 1L8IA 1S30A 3A68A 2X170 1XZ3A 4KVQA 4LYXA 2Z5RA 4AM2A 1MOJA 4RC5A 2FG8A 2Y44A 5I4JA 5FFCA 3AJOA 3M6JA 1TJOA 3E1OA 4RC7B 5J8WA 2VXIA 2CIHA 3PVYA 3VNXA 2C2JA 3Q4QA 1AEWA 1IESA 3PWQA 4TODA 2JD70 4II4B 3FVBA 5E1UA 1TKOA 4YKHA 2C6RA 4TOBA 1LKMA 2C2UA 3UNOA 2V2OA 3NP0X 1Z4AA 2Z6MA 3VVAA 3IS7A 4CMYV 3AF9X 5D8SA 5LBHA 2CHPA 1Z6OM 3F38A 5D8QA 2BKCA 4YXJA 4ZL5A 5JKMG 3OGHA 4M32A 3RE7A 2BW1A 2OH3A 3KA6A 1SQ3A 3E1MA 2WTLA 1TK6A 5J93A 3L0MA 1IERA 3H7GA 5JACA 2XJNA 2CF7A 5JDOA 3FI6A 4E40A 4PGKA 3WVUA 3UOIA 1DPSA 2FG4A 3IQ1A 2JD80 4TOCA 4WJG4 3PWQC 1VEIA 3BKNA 4TW3A 3HIUA 5CMRA 2ZG9X 3SE1A 5LG8A 4Y08A 2YJKA 4YXMA 5FEJA 5GU0X 3DBYA 2Y3QA 1JKVA 2OKCA 3R2OA 4LQVA 3PW8C 3R2SA 4DYYA 2G38B 4ML5A 1JI4A 3SIDA 4EVBA 3C1ZA 4CY9A 1JYBA 2CEIA 4M35A 2YW6A 1GWGA 3PW1A 1TKPA 4IWKA 2GYQA 4LPJA 4CYBA 3EZ0A 3A9QA 4TOAA 4Z5SA 3GGZA 4CVTA 4AM4A 1RCGA 1JIGA 3AJPA 5JKMA 3Q4NA 4CVPA 2ZURX 4YVZA 3BVKA 4DASA 4DYZA 2F7NA 2QQYA 2V2JA 1JTSA 2V15A 5HJFA 3QB9A 5IX6A 4MXPA 3JZAB 3SH6A 3RD0A 4OYNA 1XZ1A 5GU2X 3AF7X 3JZ9A 1JKUA 3R2RA 1YUZA 3PVYB 2WLUA 3PVRA 1YV1A 5ERKA 3N6OA 3PZAA 3Q4RA 1VLGA 3KXUA 2WLAA 3SHXA 3AK9A 3ES3A 4EVEA 3MPSA 3VV9A 2CWLA 3KX9A 3D19A 1LKPA 4M34A 4ETRA 3RGDA 4LQHA 3EGMA 4DYUA 1RCEA 1ZS3A 2FHAA 3KDQA 4MJYA 3UOFA 1NFVA 2V2MA 3W54A 1RYTA 4CMYA 3BVFA 3F37A 2QF9A 5JDOB 1VJXA 3OJ5A 4TO9A 1QYBA 3QD8A 5D8RA 3R2HA 4QUWA 3TA8A 3UFBA 3RAVA 2CLUA 5CZUA 3KA3A 4ISPA 3BVEA 5FFBA 3QVDA 4XKTA 3QZ3A 3BVLA 3C21A 1RCCA 2V2LA 2GYDA 3V3KB 4AM5A 1Z6OA 4W4KB 1F30A 2XGWA 4ITTA 4RC6B 4ZKXA 3F33A 4PG1A 3QHBA 3PW1B 4E6KA 3U90A 4MY7A 4DE6A 2RBDA 4MKUA 4DI0A 3R2KA 3PWFA 3WVWA 3R2LA 1YUXA 4REUA 5JKLA 4Z3BA 2BJYA 4LYUA 4ZKHA 3KWOA 4P18A 4A25A 1LKOA 3E6SA 1FHAA 2Z90A 1BCFA 2PYBA 4CYAA 5FFAA 3FSEA 4MUDA 4TOHA 2V2NA 3O7RA 5GN8B 3BVIA 4PGIA 5LG2A 4KVSA 2IB0A 1O9IA 1O9RA 2HR5A 2N02A 3GE4A 3KA4A 4ISMA 1NF6A 2V8TA 3O7SA 1L8HA 3NOZX 4RC5B 5ERJA 2ZG8X 3BT5A 5GOUA 3KHKA 3E1NA 2XJMA 1HRSA 4EVCA 4M33A 2ZA6A 3WNWA 4ZJKA 2V2SA 2C41A 3FRRA 3PVTA 2Z5QA 3WVVA 2D5KA 1RCDA 3E2CA 2ZG7X 2HTNA 5K52A 3HL1A 1KRQA 5GU3X 5JKLG 4LQJA 4ZTTA 1DATA 1NF4A 1OTKA 3AJQA 4CVRA 1H96A 4TOEA 2GS4A 5HJHA 3FRSA 3KA8A 1DVBA 3GVYA 4DZ0A 4ZMCA 1JGCA 4XKUA 2ZA7A 1F33A 3F36A 2XJOA 3E1QA 4W4LB 5CMQA 4RC7A 3ISFA 5D8OA 3LKDA 2VXXA 4MN9A 1BFRA 2W0OA 1LB3A 3PW8A 1ZUJA 2CN6A 1EUMA 3QHCA 4R42A 4II4A 3AK8A 1JREA 4ZKWA 4XGSA 4EVDA 1VELA 1RCIA 5C6FA 5LS9A 3E1PA 5AXSA 5HU6D 2UX1A 3AF8X 4X0JA 2V8UA 4KVRA 4ERUA 2BK6A 2WWXB 5J8SA 3F39A 5E2DA 3T9JA 4LPMA 3E1LA 4LPNA 4ITWA 2CLBA 2G4HA 3IS8A 1QGHA 4RC8A 5K53A 3Q4OA 2AR0A 2XKQA 5D8PA 5J9VA 2CHIA 5FFDA 2JD60 2FL0A 2IY4A 3NP2X 4IXKA 4U3GA 2YJJA 5HQOA 2OC5A 4ZLWA 2V2PA 3RBCA 1MFRA 4ZL6A 2FFXJ 1J30A 2V2RA 2Z5PA 2ITBA 2C2FA 3E6RA 1JI5A 4CVSA 4RC6A 5D8XA 3E1JA 3ISEA 2IU2A 2V2IA 1SOFA 4TOFA
chains in the Genus database with same CATH topology
3KA9A 3R2MA 2ZA8A 5D8YA 1UVHA 3F35A 5GU1X 2FKZA 1VEQA 3C1YA 3ERZA 3F34A 1N1QA 4TOGA 1S3QA 3PVRB 2YW7A 4LQNA 2CN7A 1NNQA 2MGYA 3PVTB 2FZFA 3GHQA 5GN8A 4PG0A 3F32A 1S2ZA 1UMNA 2VZBA 3C23A 1R03A 5FFEA 2FJCA 3EZUA 4KXRB 1BG7A 4IWJA 4XKSA 4DYXA 3GGYA 1B71A 1L8IA 1S30A 3A68A 2X170 1XZ3A 4KVQA 4LYXA 2Z5RA 4AM2A 1MOJA 4RC5A 2FG8A 2Y44A 5I4JA 5FFCA 3AJOA 3M6JA 1TJOA 3E1OA 4RC7B 5J8WA 2VXIA 2CIHA 3PVYA 3VNXA 2C2JA 3Q4QA 1AEWA 1IESA 3PWQA 4TODA 2JD70 4II4B 3FVBA 5E1UA 1TKOA 4YKHA 2C6RA 4TOBA 1LKMA 2C2UA 3UNOA 2V2OA 3NP0X 1Z4AA 2Z6MA 3VVAA 3IS7A 4CMYV 3AF9X 5D8SA 5LBHA 2CHPA 1Z6OM 3F38A 5D8QA 2BKCA 4YXJA 4ZL5A 5JKMG 3OGHA 4M32A 3RE7A 2BW1A 2OH3A 3KA6A 1SQ3A 3E1MA 2WTLA 1TK6A 5J93A 3L0MA 1IERA 3H7GA 5JACA 2XJNA 2CF7A 5JDOA 3FI6A 4E40A 4PGKA 3WVUA 3UOIA 1DPSA 2FG4A 3IQ1A 2JD80 4TOCA 4WJG4 3PWQC 1VEIA 3BKNA 4TW3A 3HIUA 5CMRA 2ZG9X 3SE1A 5LG8A 4Y08A 2YJKA 4YXMA 5FEJA 5GU0X 3DBYA 2Y3QA 1JKVA 2OKCA 3R2OA 4LQVA 3PW8C 3R2SA 4DYYA 2G38B 4ML5A 1JI4A 3SIDA 4EVBA 3C1ZA 4CY9A 1JYBA 2CEIA 4M35A 2YW6A 1GWGA 3PW1A 1TKPA 4IWKA 2GYQA 4LPJA 4CYBA 3EZ0A 3A9QA 4TOAA 4Z5SA 3GGZA 4CVTA 4AM4A 1RCGA 1JIGA 3AJPA 5JKMA 3Q4NA 4CVPA 2ZURX 4YVZA 3BVKA 4DASA 4DYZA 2F7NA 2QQYA 2V2JA 1JTSA 2V15A 5HJFA 3QB9A 5IX6A 4MXPA 3JZAB 3SH6A 3RD0A 4OYNA 1XZ1A 5GU2X 3AF7X 3JZ9A 1JKUA 3R2RA 1YUZA 3PVYB 2WLUA 3PVRA 1YV1A 5ERKA 3N6OA 3PZAA 3Q4RA 1VLGA 3KXUA 2WLAA 3SHXA 3AK9A 3ES3A 4EVEA 3MPSA 3VV9A 2CWLA 3KX9A 3D19A 1LKPA 4M34A 4ETRA 3RGDA 4LQHA 3EGMA 4DYUA 1RCEA 1ZS3A 2FHAA 3KDQA 4MJYA 3UOFA 1NFVA 2V2MA 3W54A 1RYTA 4CMYA 3BVFA 3F37A 2QF9A 5JDOB 1VJXA 3OJ5A 4TO9A 1QYBA 3QD8A 5D8RA 3R2HA 4QUWA 3TA8A 3UFBA 3RAVA 2CLUA 5CZUA 3KA3A 4ISPA 3BVEA 5FFBA 3QVDA 4XKTA 3QZ3A 3BVLA 3C21A 1RCCA 2V2LA 2GYDA 3V3KB 4AM5A 1Z6OA 4W4KB 1F30A 2XGWA 4ITTA 4RC6B 4ZKXA 3F33A 4PG1A 3QHBA 3PW1B 4E6KA 3U90A 4MY7A 4DE6A 2RBDA 4MKUA 4DI0A 3R2KA 3PWFA 3WVWA 3R2LA 1YUXA 4REUA 5JKLA 4Z3BA 2BJYA 4LYUA 4ZKHA 3KWOA 4P18A 4A25A 1LKOA 3E6SA 1FHAA 2Z90A 1BCFA 2PYBA 4CYAA 5FFAA 3FSEA 4MUDA 4TOHA 2V2NA 3O7RA 5GN8B 3BVIA 4PGIA 5LG2A 4KVSA 2IB0A 1O9IA 1O9RA 2HR5A 2N02A 3GE4A 3KA4A 4ISMA 1NF6A 2V8TA 3O7SA 1L8HA 3NOZX 4RC5B 5ERJA 2ZG8X 3BT5A 5GOUA 3KHKA 3E1NA 2XJMA 1HRSA 4EVCA 4M33A 2ZA6A 3WNWA 4ZJKA 2V2SA 2C41A 3FRRA 3PVTA 2Z5QA 3WVVA 2D5KA 1RCDA 3E2CA 2ZG7X 2HTNA 5K52A 3HL1A 1KRQA 5GU3X 5JKLG 4LQJA 4ZTTA 1DATA 1NF4A 1OTKA 3AJQA 4CVRA 1H96A 4TOEA 2GS4A 5HJHA 3FRSA 3KA8A 1DVBA 3GVYA 4DZ0A 4ZMCA 1JGCA 4XKUA 2ZA7A 1F33A 3F36A 2XJOA 3E1QA 4W4LB 5CMQA 4RC7A 3ISFA 5D8OA 3LKDA 2VXXA 4MN9A 1BFRA 2W0OA 1LB3A 3PW8A 1ZUJA 2CN6A 1EUMA 3QHCA 4R42A 4II4A 3AK8A 1JREA 4ZKWA 4XGSA 4EVDA 1VELA 1RCIA 5C6FA 5LS9A 3E1PA 5AXSA 5HU6D 2UX1A 3AF8X 4X0JA 2V8UA 4KVRA 4ERUA 2BK6A 2WWXB 5J8SA 3F39A 5E2DA 3T9JA 4LPMA 3E1LA 4LPNA 4ITWA 2CLBA 2G4HA 3IS8A 1QGHA 4RC8A 5K53A 3Q4OA 2AR0A 2XKQA 5D8PA 5J9VA 2CHIA 5FFDA 2JD60 2FL0A 2IY4A 3NP2X 4IXKA 4U3GA 2YJJA 5HQOA 2OC5A 4ZLWA 2V2PA 3RBCA 1MFRA 4ZL6A 2FFXJ 1J30A 2V2RA 2Z5PA 2ITBA 2C2FA 3E6RA 1JI5A 4CVSA 4RC6A 5D8XA 3E1JA 3ISEA 2IU2A 2V2IA 1SOFA 4TOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KA9 A;  3R2M A;  2ZA8 A;  5D8Y A;  1UVH A;  3F35 A;  5GU1 X;  2FKZ A;  1VEQ A;  3ERZ A;  3F34 A;  1N1Q A;  4TOG A;  1S3Q A;  3PVR B;  2YW7 A;  4LQN A;  2CN7 A;  1NNQ A;  3PVT B;  2FZF A;  3GHQ A;  5GN8 A;  4PG0 A;  3F32 A;  1S2Z A;  1UMN A;  2VZB A;  1R03 A;  5FFE A;  2FJC A;  3EZU A;  1BG7 A;  4IWJ A;  4XKS A;  4DYX A;  1B71 A;  1L8I A;  1S30 A;  3A68 A;  2X17 0;  1XZ3 A;  4KVQ A;  4LYX A;  2Z5R A;  4AM2 A;  1MOJ A;  4RC5 A;  2FG8 A;  5I4J A;  5FFC A;  3AJO A;  1TJO A;  3E1O A;  4RC7 B;  5J8W A;  2VXI A;  2CIH A;  3PVY A;  3VNX A;  2C2J A;  3Q4Q A;  1AEW A;  1IES A;  3PWQ A;  4TOD A;  2JD7 0;  4II4 B;  3FVB A;  5E1U A;  1TKO A;  4YKH A;  2C6R A;  4TOB A;  1LKM A;  2C2U A;  3UNO A;  2V2O A;  3NP0 X;  1Z4A A;  2Z6M A;  3IS7 A;  4CMY V;  3AF9 X;  5D8S A;  5LBH A;  2CHP A;  1Z6O M;  3F38 A;  5D8Q A;  2BKC A;  4ZL5 A;  5JKM G;  3OGH A;  4M32 A;  3RE7 A;  2BW1 A;  2OH3 A;  3KA6 A;  1SQ3 A;  3E1M A;  2WTL A;  1TK6 A;  5J93 A;  1IER A;  3H7G A;  5JAC A;  2XJN A;  2CF7 A;  3FI6 A;  4PGK A;  3WVU A;  3UOI A;  1DPS A;  2FG4 A;  3IQ1 A;  2JD8 0;  4TOC A;  3PWQ C;  1VEI A;  3BKN A;  4TW3 A;  3HIU A;  5CMR A;  2ZG9 X;  3SE1 A;  5LG8 A;  4Y08 A;  2YJK A;  5FEJ A;  5GU0 X;  2Y3Q A;  1JKV A;  3R2O A;  4LQV A;  3PW8 C;  3R2S A;  4DYY A;  4ML5 A;  1JI4 A;  3SID A;  4EVB A;  4CY9 A;  1JYB A;  2CEI A;  4M35 A;  2YW6 A;  1GWG A;  3PW1 A;  1TKP A;  4IWK A;  2GYQ A;  4LPJ A;  4CYB A;  3EZ0 A;  3A9Q A;  4TOA A;  4Z5S A;  4CVT A;  4AM4 A;  1RCG A;  1JIG A;  3AJP A;  5JKM A;  3Q4N A;  4CVP A;  2ZUR X;  4DAS A;  3BVK A;  4DYZ A;  2F7N A;  2QQY A;  2V2J A;  1JTS A;  2V15 A;  5HJF A;  3QB9 A;  5IX6 A;  3SH6 A;  3RD0 A;  4OYN A;  1XZ1 A;  5GU2 X;  3AF7 X;  1JKU A;  3R2R A;  1YUZ A;  3PVY B;  2WLU A;  3PVR A;  1YV1 A;  5ERK A;  3PZA A;  3Q4R A;  1VLG A;  3KXU A;  2WLA A;  3SHX A;  3AK9 A;  3ES3 A;  4EVE A;  3MPS A;  3KX9 A;  1LKP A;  4M34 A;  4ETR A;  3RGD A;  4LQH A;  3EGM A;  4DYU A;  1RCE A;  1ZS3 A;  2FHA A;  4MJY A;  3UOF A;  1NFV A;  2V2M A;  1RYT A;  4CMY A;  3BVF A;  3F37 A;  2QF9 A;  1VJX A;  3OJ5 A;  4TO9 A;  1QYB A;  3QD8 A;  5D8R A;  3R2H A;  4QUW A;  3TA8 A;  3RAV A;  2CLU A;  5CZU A;  3KA3 A;  4ISP A;  3BVE A;  5FFB A;  3QVD A;  4XKT A;  3QZ3 A;  3BVL A;  1RCC A;  2V2L A;  2GYD A;  4AM5 A;  1Z6O A;  1F30 A;  2XGW A;  4ITT A;  4RC6 B;  4ZKX A;  3F33 A;  4PG1 A;  3QHB A;  3PW1 B;  4E6K A;  3U90 A;  4MY7 A;  4DE6 A;  2RBD A;  4MKU A;  4DI0 A;  3R2K A;  3PWF A;  3WVW A;  3R2L A;  1YUX A;  4REU A;  5JKL A;  4Z3B A;  2BJY A;  4LYU A;  4ZKH A;  3KWO A;  4P18 A;  4A25 A;  1LKO A;  3E6S A;  1FHA A;  2Z90 A;  1BCF A;  2PYB A;  4CYA A;  5FFA A;  3FSE A;  4MUD A;  4TOH A;  2V2N A;  3O7R A;  5GN8 B;  3BVI A;  4PGI A;  5LG2 A;  4KVS A;  2IB0 A;  1O9I A;  1O9R A;  2HR5 A;  3GE4 A;  3KA4 A;  4ISM A;  1NF6 A;  3O7S A;  1L8H A;  3NOZ X;  4RC5 B;  5ERJ A;  2ZG8 X;  3BT5 A;  5GOU A;  3E1N A;  2XJM A;  1HRS A;  4EVC A;  4M33 A;  2ZA6 A;  3WNW A;  4ZJK A;  2V2S A;  2C41 A;  3PVT A;  2Z5Q A;  3WVV A;  2D5K A;  1RCD A;  3E2C A;  2ZG7 X;  2HTN A;  5K52 A;  3HL1 A;  1KRQ A;  5GU3 X;  5JKL G;  4LQJ A;  4ZTT A;  1DAT A;  1NF4 A;  1OTK A;  3AJQ A;  4CVR A;  1H96 A;  4TOE A;  2GS4 A;  5HJH A;  3KA8 A;  1DVB A;  3GVY A;  4DZ0 A;  4ZMC A;  1JGC A;  4XKU A;  2ZA7 A;  1F33 A;  3F36 A;  2XJO A;  3E1Q A;  5CMQ A;  4RC7 A;  3ISF A;  5D8O A;  2VXX A;  4MN9 A;  1BFR A;  2W0O A;  1LB3 A;  3PW8 A;  1ZUJ A;  2CN6 A;  1EUM A;  3QHC A;  4R42 A;  4II4 A;  3AK8 A;  1JRE A;  4ZKW A;  4XGS A;  4EVD A;  1VEL A;  1RCI A;  5C6F A;  5LS9 A;  3E1P A;  5AXS A;  2UX1 A;  3AF8 X;  4ERU A;  4KVR A;  2BK6 A;  5J8S A;  3F39 A;  5E2D A;  3T9J A;  4LPM A;  3E1L A;  4LPN A;  4ITW A;  2CLB A;  2G4H A;  3IS8 A;  1QGH A;  4RC8 A;  5K53 A;  3Q4O A;  2XKQ A;  5D8P A;  5J9V A;  2CHI A;  5FFD A;  2JD6 0;  2FL0 A;  2IY4 A;  3NP2 X;  4IXK A;  4U3G A;  2YJJ A;  5HQO A;  2OC5 A;  4ZLW A;  2V2P A;  3RBC A;  1MFR A;  4ZL6 A;  2FFX J;  1J30 A;  2V2R A;  2Z5P A;  2ITB A;  2C2F A;  3E6R A;  1JI5 A;  4CVS A;  4RC6 A;  5D8X A;  3E1J A;  3ISE A;  2IU2 A;  2V2I A;  1SOF A;  4TOF A; 
#chains in the Genus database with same CATH topology
 3KA9 A;  3R2M A;  2ZA8 A;  5D8Y A;  1UVH A;  3F35 A;  5GU1 X;  2FKZ A;  1VEQ A;  3C1Y A;  3ERZ A;  3F34 A;  1N1Q A;  4TOG A;  1S3Q A;  3PVR B;  2YW7 A;  4LQN A;  2CN7 A;  1NNQ A;  2MGY A;  3PVT B;  2FZF A;  3GHQ A;  5GN8 A;  4PG0 A;  3F32 A;  1S2Z A;  1UMN A;  2VZB A;  3C23 A;  1R03 A;  5FFE A;  2FJC A;  3EZU A;  4KXR B;  1BG7 A;  4IWJ A;  4XKS A;  4DYX A;  3GGY A;  1B71 A;  1L8I A;  1S30 A;  3A68 A;  2X17 0;  1XZ3 A;  4KVQ A;  4LYX A;  2Z5R A;  4AM2 A;  1MOJ A;  4RC5 A;  2FG8 A;  2Y44 A;  5I4J A;  5FFC A;  3AJO A;  3M6J A;  1TJO A;  3E1O A;  4RC7 B;  5J8W A;  2VXI A;  2CIH A;  3PVY A;  3VNX A;  2C2J A;  3Q4Q A;  1AEW A;  1IES A;  3PWQ A;  4TOD A;  2JD7 0;  4II4 B;  3FVB A;  5E1U A;  1TKO A;  4YKH A;  2C6R A;  4TOB A;  1LKM A;  2C2U A;  3UNO A;  2V2O A;  3NP0 X;  1Z4A A;  2Z6M A;  3VVA A;  3IS7 A;  4CMY V;  3AF9 X;  5D8S A;  5LBH A;  2CHP A;  1Z6O M;  3F38 A;  5D8Q A;  2BKC A;  4YXJ A;  4ZL5 A;  5JKM G;  3OGH A;  4M32 A;  3RE7 A;  2BW1 A;  2OH3 A;  3KA6 A;  1SQ3 A;  3E1M A;  2WTL A;  1TK6 A;  5J93 A;  3L0M A;  1IER A;  3H7G A;  5JAC A;  2XJN A;  2CF7 A;  5JDO A;  3FI6 A;  4E40 A;  4PGK A;  3WVU A;  3UOI A;  1DPS A;  2FG4 A;  3IQ1 A;  2JD8 0;  4TOC A;  4WJG 4;  3PWQ C;  1VEI A;  3BKN A;  4TW3 A;  3HIU A;  5CMR A;  2ZG9 X;  3SE1 A;  5LG8 A;  4Y08 A;  2YJK A;  4YXM A;  5FEJ A;  5GU0 X;  3DBY A;  2Y3Q A;  1JKV A;  2OKC A;  3R2O A;  4LQV A;  3PW8 C;  3R2S A;  4DYY A;  2G38 B;  4ML5 A;  1JI4 A;  3SID A;  4EVB A;  3C1Z A;  4CY9 A;  1JYB A;  2CEI A;  4M35 A;  2YW6 A;  1GWG A;  3PW1 A;  1TKP A;  4IWK A;  2GYQ A;  4LPJ A;  4CYB A;  3EZ0 A;  3A9Q A;  4TOA A;  4Z5S A;  3GGZ A;  4CVT A;  4AM4 A;  1RCG A;  1JIG A;  3AJP A;  5JKM A;  3Q4N A;  4CVP A;  2ZUR X;  4YVZ A;  3BVK A;  4DAS A;  4DYZ A;  2F7N A;  2QQY A;  2V2J A;  1JTS A;  2V15 A;  5HJF A;  3QB9 A;  5IX6 A;  4MXP A;  3JZA B;  3SH6 A;  3RD0 A;  4OYN A;  1XZ1 A;  5GU2 X;  3AF7 X;  3JZ9 A;  1JKU A;  3R2R A;  1YUZ A;  3PVY B;  2WLU A;  3PVR A;  1YV1 A;  5ERK A;  3N6O A;  3PZA A;  3Q4R A;  1VLG A;  3KXU A;  2WLA A;  3SHX A;  3AK9 A;  3ES3 A;  4EVE A;  3MPS A;  3VV9 A;  2CWL A;  3KX9 A;  3D19 A;  1LKP A;  4M34 A;  4ETR A;  3RGD A;  4LQH A;  3EGM A;  4DYU A;  1RCE A;  1ZS3 A;  2FHA A;  3KDQ A;  4MJY A;  3UOF A;  1NFV A;  2V2M A;  3W54 A;  1RYT A;  4CMY A;  3BVF A;  3F37 A;  2QF9 A;  5JDO B;  1VJX A;  3OJ5 A;  4TO9 A;  1QYB A;  3QD8 A;  5D8R A;  3R2H A;  4QUW A;  3TA8 A;  3UFB A;  3RAV A;  2CLU A;  5CZU A;  3KA3 A;  4ISP A;  3BVE A;  5FFB A;  3QVD A;  4XKT A;  3QZ3 A;  3BVL A;  3C21 A;  1RCC A;  2V2L A;  2GYD A;  3V3K B;  4AM5 A;  1Z6O A;  4W4K B;  1F30 A;  2XGW A;  4ITT A;  4RC6 B;  4ZKX A;  3F33 A;  4PG1 A;  3QHB A;  3PW1 B;  4E6K A;  3U90 A;  4MY7 A;  4DE6 A;  2RBD A;  4MKU A;  4DI0 A;  3R2K A;  3PWF A;  3WVW A;  3R2L A;  1YUX A;  4REU A;  5JKL A;  4Z3B A;  2BJY A;  4LYU A;  4ZKH A;  3KWO A;  4P18 A;  4A25 A;  1LKO A;  3E6S A;  1FHA A;  2Z90 A;  1BCF A;  2PYB A;  4CYA A;  5FFA A;  3FSE A;  4MUD A;  4TOH A;  2V2N A;  3O7R A;  5GN8 B;  3BVI A;  4PGI A;  5LG2 A;  4KVS A;  2IB0 A;  1O9I A;  1O9R A;  2HR5 A;  2N02 A;  3GE4 A;  3KA4 A;  4ISM A;  1NF6 A;  2V8T A;  3O7S A;  1L8H A;  3NOZ X;  4RC5 B;  5ERJ A;  2ZG8 X;  3BT5 A;  5GOU A;  3KHK A;  3E1N A;  2XJM A;  1HRS A;  4EVC A;  4M33 A;  2ZA6 A;  3WNW A;  4ZJK A;  2V2S A;  2C41 A;  3FRR A;  3PVT A;  2Z5Q A;  3WVV A;  2D5K A;  1RCD A;  3E2C A;  2ZG7 X;  2HTN A;  5K52 A;  3HL1 A;  1KRQ A;  5GU3 X;  5JKL G;  4LQJ A;  4ZTT A;  1DAT A;  1NF4 A;  1OTK A;  3AJQ A;  4CVR A;  1H96 A;  4TOE A;  2GS4 A;  5HJH A;  3FRS A;  3KA8 A;  1DVB A;  3GVY A;  4DZ0 A;  4ZMC A;  1JGC A;  4XKU A;  2ZA7 A;  1F33 A;  3F36 A;  2XJO A;  3E1Q A;  4W4L B;  5CMQ A;  4RC7 A;  3ISF A;  5D8O A;  3LKD A;  2VXX A;  4MN9 A;  1BFR A;  2W0O A;  1LB3 A;  3PW8 A;  1ZUJ A;  2CN6 A;  1EUM A;  3QHC A;  4R42 A;  4II4 A;  3AK8 A;  1JRE A;  4ZKW A;  4XGS A;  4EVD A;  1VEL A;  1RCI A;  5C6F A;  5LS9 A;  3E1P A;  5AXS A;  5HU6 D;  2UX1 A;  3AF8 X;  4X0J A;  2V8U A;  4KVR A;  4ERU A;  2BK6 A;  2WWX B;  5J8S A;  3F39 A;  5E2D A;  3T9J A;  4LPM A;  3E1L A;  4LPN A;  4ITW A;  2CLB A;  2G4H A;  3IS8 A;  1QGH A;  4RC8 A;  5K53 A;  3Q4O A;  2AR0 A;  2XKQ A;  5D8P A;  5J9V A;  2CHI A;  5FFD A;  2JD6 0;  2FL0 A;  2IY4 A;  3NP2 X;  4IXK A;  4U3G A;  2YJJ A;  5HQO A;  2OC5 A;  4ZLW A;  2V2P A;  3RBC A;  1MFR A;  4ZL6 A;  2FFX J;  1J30 A;  2V2R A;  2Z5P A;  2ITB A;  2C2F A;  3E6R A;  1JI5 A;  4CVS A;  4RC6 A;  5D8X A;  3E1J A;  3ISE A;  2IU2 A;  2V2I A;  1SOF A;  4TOF A; 
#chains in the Genus database with same CATH homology
 3KA9 A;  3R2M A;  2ZA8 A;  5D8Y A;  1UVH A;  3F35 A;  5GU1 X;  2FKZ A;  1VEQ A;  3C1Y A;  3ERZ A;  3F34 A;  1N1Q A;  4TOG A;  1S3Q A;  3PVR B;  2YW7 A;  4LQN A;  2CN7 A;  1NNQ A;  2MGY A;  3PVT B;  2FZF A;  3GHQ A;  5GN8 A;  4PG0 A;  3F32 A;  1S2Z A;  1UMN A;  2VZB A;  3C23 A;  1R03 A;  5FFE A;  2FJC A;  3EZU A;  4KXR B;  1BG7 A;  4IWJ A;  4XKS A;  4DYX A;  3GGY A;  1B71 A;  1L8I A;  1S30 A;  3A68 A;  2X17 0;  1XZ3 A;  4KVQ A;  4LYX A;  2Z5R A;  4AM2 A;  1MOJ A;  4RC5 A;  2FG8 A;  2Y44 A;  5I4J A;  5FFC A;  3AJO A;  3M6J A;  1TJO A;  3E1O A;  4RC7 B;  5J8W A;  2VXI A;  2CIH A;  3PVY A;  3VNX A;  2C2J A;  3Q4Q A;  1AEW A;  1IES A;  3PWQ A;  4TOD A;  2JD7 0;  4II4 B;  3FVB A;  5E1U A;  1TKO A;  4YKH A;  2C6R A;  4TOB A;  1LKM A;  2C2U A;  3UNO A;  2V2O A;  3NP0 X;  1Z4A A;  2Z6M A;  3VVA A;  3IS7 A;  4CMY V;  3AF9 X;  5D8S A;  5LBH A;  2CHP A;  1Z6O M;  3F38 A;  5D8Q A;  2BKC A;  4YXJ A;  4ZL5 A;  5JKM G;  3OGH A;  4M32 A;  3RE7 A;  2BW1 A;  2OH3 A;  3KA6 A;  1SQ3 A;  3E1M A;  2WTL A;  1TK6 A;  5J93 A;  3L0M A;  1IER A;  3H7G A;  5JAC A;  2XJN A;  2CF7 A;  5JDO A;  3FI6 A;  4E40 A;  4PGK A;  3WVU A;  3UOI A;  1DPS A;  2FG4 A;  3IQ1 A;  2JD8 0;  4TOC A;  4WJG 4;  3PWQ C;  1VEI A;  3BKN A;  4TW3 A;  3HIU A;  5CMR A;  2ZG9 X;  3SE1 A;  5LG8 A;  4Y08 A;  2YJK A;  4YXM A;  5FEJ A;  5GU0 X;  3DBY A;  2Y3Q A;  1JKV A;  2OKC A;  3R2O A;  4LQV A;  3PW8 C;  3R2S A;  4DYY A;  2G38 B;  4ML5 A;  1JI4 A;  3SID A;  4EVB A;  3C1Z A;  4CY9 A;  1JYB A;  2CEI A;  4M35 A;  2YW6 A;  1GWG A;  3PW1 A;  1TKP A;  4IWK A;  2GYQ A;  4LPJ A;  4CYB A;  3EZ0 A;  3A9Q A;  4TOA A;  4Z5S A;  3GGZ A;  4CVT A;  4AM4 A;  1RCG A;  1JIG A;  3AJP A;  5JKM A;  3Q4N A;  4CVP A;  2ZUR X;  4YVZ A;  3BVK A;  4DAS A;  4DYZ A;  2F7N A;  2QQY A;  2V2J A;  1JTS A;  2V15 A;  5HJF A;  3QB9 A;  5IX6 A;  4MXP A;  3JZA B;  3SH6 A;  3RD0 A;  4OYN A;  1XZ1 A;  5GU2 X;  3AF7 X;  3JZ9 A;  1JKU A;  3R2R A;  1YUZ A;  3PVY B;  2WLU A;  3PVR A;  1YV1 A;  5ERK A;  3N6O A;  3PZA A;  3Q4R A;  1VLG A;  3KXU A;  2WLA A;  3SHX A;  3AK9 A;  3ES3 A;  4EVE A;  3MPS A;  3VV9 A;  2CWL A;  3KX9 A;  3D19 A;  1LKP A;  4M34 A;  4ETR A;  3RGD A;  4LQH A;  3EGM A;  4DYU A;  1RCE A;  1ZS3 A;  2FHA A;  3KDQ A;  4MJY A;  3UOF A;  1NFV A;  2V2M A;  3W54 A;  1RYT A;  4CMY A;  3BVF A;  3F37 A;  2QF9 A;  5JDO B;  1VJX A;  3OJ5 A;  4TO9 A;  1QYB A;  3QD8 A;  5D8R A;  3R2H A;  4QUW A;  3TA8 A;  3UFB A;  3RAV A;  2CLU A;  5CZU A;  3KA3 A;  4ISP A;  3BVE A;  5FFB A;  3QVD A;  4XKT A;  3QZ3 A;  3BVL A;  3C21 A;  1RCC A;  2V2L A;  2GYD A;  3V3K B;  4AM5 A;  1Z6O A;  4W4K B;  1F30 A;  2XGW A;  4ITT A;  4RC6 B;  4ZKX A;  3F33 A;  4PG1 A;  3QHB A;  3PW1 B;  4E6K A;  3U90 A;  4MY7 A;  4DE6 A;  2RBD A;  4MKU A;  4DI0 A;  3R2K A;  3PWF A;  3WVW A;  3R2L A;  1YUX A;  4REU A;  5JKL A;  4Z3B A;  2BJY A;  4LYU A;  4ZKH A;  3KWO A;  4P18 A;  4A25 A;  1LKO A;  3E6S A;  1FHA A;  2Z90 A;  1BCF A;  2PYB A;  4CYA A;  5FFA A;  3FSE A;  4MUD A;  4TOH A;  2V2N A;  3O7R A;  5GN8 B;  3BVI A;  4PGI A;  5LG2 A;  4KVS A;  2IB0 A;  1O9I A;  1O9R A;  2HR5 A;  2N02 A;  3GE4 A;  3KA4 A;  4ISM A;  1NF6 A;  2V8T A;  3O7S A;  1L8H A;  3NOZ X;  4RC5 B;  5ERJ A;  2ZG8 X;  3BT5 A;  5GOU A;  3KHK A;  3E1N A;  2XJM A;  1HRS A;  4EVC A;  4M33 A;  2ZA6 A;  3WNW A;  4ZJK A;  2V2S A;  2C41 A;  3FRR A;  3PVT A;  2Z5Q A;  3WVV A;  2D5K A;  1RCD A;  3E2C A;  2ZG7 X;  2HTN A;  5K52 A;  3HL1 A;  1KRQ A;  5GU3 X;  5JKL G;  4LQJ A;  4ZTT A;  1DAT A;  1NF4 A;  1OTK A;  3AJQ A;  4CVR A;  1H96 A;  4TOE A;  2GS4 A;  5HJH A;  3FRS A;  3KA8 A;  1DVB A;  3GVY A;  4DZ0 A;  4ZMC A;  1JGC A;  4XKU A;  2ZA7 A;  1F33 A;  3F36 A;  2XJO A;  3E1Q A;  4W4L B;  5CMQ A;  4RC7 A;  3ISF A;  5D8O A;  3LKD A;  2VXX A;  4MN9 A;  1BFR A;  2W0O A;  1LB3 A;  3PW8 A;  1ZUJ A;  2CN6 A;  1EUM A;  3QHC A;  4R42 A;  4II4 A;  3AK8 A;  1JRE A;  4ZKW A;  4XGS A;  4EVD A;  1VEL A;  1RCI A;  5C6F A;  5LS9 A;  3E1P A;  5AXS A;  5HU6 D;  2UX1 A;  3AF8 X;  4X0J A;  2V8U A;  4KVR A;  4ERU A;  2BK6 A;  2WWX B;  5J8S A;  3F39 A;  5E2D A;  3T9J A;  4LPM A;  3E1L A;  4LPN A;  4ITW A;  2CLB A;  2G4H A;  3IS8 A;  1QGH A;  4RC8 A;  5K53 A;  3Q4O A;  2AR0 A;  2XKQ A;  5D8P A;  5J9V A;  2CHI A;  5FFD A;  2JD6 0;  2FL0 A;  2IY4 A;  3NP2 X;  4IXK A;  4U3G A;  2YJJ A;  5HQO A;  2OC5 A;  4ZLW A;  2V2P A;  3RBC A;  1MFR A;  4ZL6 A;  2FFX J;  1J30 A;  2V2R A;  2Z5P A;  2ITB A;  2C2F A;  3E6R A;  1JI5 A;  4CVS A;  4RC6 A;  5D8X A;  3E1J A;  3ISE A;  2IU2 A;  2V2I A;  1SOF A;  4TOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...