1UVHA

X-ray structure of dps from mycobacterium smegmatis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
b'TIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQWFVRAHLESAGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STARVATION-INDUCED DNA PROTECTING PROTEIN
publication title Reassessment of Protein Stability, DNA Binding, and Protection of Mycobacterium Smegmatis Dps.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
total genus 57
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1uvhA00
3PWQC 3HL1A 4IXKA 3RGDA 3RD0A 2YW6A 3KX9A 4CVTA 2FJCA 3PVRB 1O9IA 2G4HA 1TJOA 3R2MA 4LQVA 1EUMA 3NP2X 4MUDA 4PG1A 3KA9A 1S2ZA 5HJFA 2YW7A 4LPNA 4RC5B 2BW1A 3R2OA 3Q4QA 3AJPA 1JYBA 3IS7A 4ZKXA 3PVYB 1JREA 2ZG7X 3E1LA 3RAVA 4LQHA 1YV1A 2IB0A 1O9RA 4IWKA 1RCEA 5JKMG 3WNWA 3E1MA 4PGKA 5J8WA 2CF7A 4EVCA 1SOFA 3E6RA 4TODA 3OGHA 1JKUA 1XZ3A 1QYBA 3O7SA 4TW3A 2GYQA 3R2LA 4ZLWA 2ZURX 3F39A 2XJNA 5GOUA 1S3QA 2CLUA 1RCDA 2JD80 1VELA 2W0OA 3UNOA 3R2HA 3E1NA 2F7NA 2Z5QA 3NP0X 4Y08A 3OJ5A 3PW8A 1UVHA 5D8PA 3QZ3A 3SHXA 2ZG8X 3O7RA 4TOHA 4EVDA 3AK9A 4R42A 4ML5A 3U90A 1TKOA 2Z5PA 5D8RA 3H7GA 5JKLA 3BVIA 2HR5A 2WLAA 4DYZA 5GU0X 3R2RA 4LQNA 3BVKA 1N1QA 3QHCA 1VEQA 2ZA7A 4ERUA 3Q4RA 2C2FA 4CYBA 4LPJA 2CHPA 1LB3A 5D8YA 3T9JA 1L8HA 5K53A 2IY4A 3PWFA 5JKLG 1DVBA 2X170 2D5KA 5HQOA 2VXXA 1BFRA 1RYTA 2Z5RA 4ZL5A 5FFDA 1Z6OA 3FVBA 3WVVA 1XZ1A 3E1PA 3PW8C 4TO9A 3A68A 4YKHA 4ZJKA 2VZBA 1NFVA 4CMYV 4ZKWA 2V2PA 3SH6A 2V2SA 2WTLA 3RE7A 4TOGA 3FSEA 5J9VA 2YJJA 1VEIA 4DI0A 4MKUA 2VXIA 1R03A 5D8SA 5FFCA 4RC7B 5GU1X 1NNQA 3AK8A 1YUXA 3BVEA 5FEJA 3BKNA 4DASA 5ERJA 2V2OA 3PVRA 5AXSA 3HIUA 4ZL6A 2YJKA 4Z3BA 1DATA 3PVTA 4ISPA 5ERKA 4AM4A 3WVWA 2BK6A 3ISFA 4OYNA 2C2UA 1JGCA 4ISMA 3BVFA 3F34A 3ERZA 5JACA 2C6RA 4KVSA 3F35A 4ZTTA 4ITTA 1F33A 4M34A 4CYAA 4Z5SA 4XKTA 1KRQA 4TOFA 1TKPA 1BCFA 4M35A 5J93A 2PYBA 3VNXA 4CVSA 1RCIA 1Z6OM 5FFBA 3Q4NA 5FFAA 5LBHA 5LS9A 1ZS3A 2GS4A 5GN8A 1FHAA 4PGIA 2XJOA 3KWOA 5E1UA 4A25A 4ZKHA 2XKQA 1VLGA 4IWJA 3KA4A 2IU2A 2V2RA 2V2IA 5J8SA 1GWGA 3PW1A 2QF9A 4M33A 5D8XA 3PWQA 2QQYA 2Z6MA 1JI4A 3IS8A 4LYUA 4LQJA 3R2KA 2ITBA 5E2DA 2XGWA 4ETRA 4CMYA 2FFXJ 1F30A 5HJHA 3NOZX 4II4B 2XJMA 1AEWA 4E6KA 3IQ1A 1S30A 3MPSA 3F36A 4MY7A 4ZMCA 2Y3QA 2CN7A 1B71A 4RC6B 2ZG9X 3AF8X 1LKOA 2OC5A 4TOCA 3F38A 1NF4A 1BG7A 2JD60 2ZA8A 4CY9A 1RCGA 1JI5A 3GHQA 4DZ0A 2FG8A 4AM2A 3KA3A 4DYUA 3EZUA 4REUA 5D8OA 2V2JA 4XGSA 4DYXA 2FL0A 2ZA6A 2FHAA 2V2MA 3E1OA 5FFEA 4U3GA 4P18A 4DE6A 3QD8A 4MN9A 2FG4A 2CEIA 1IERA 4EVEA 4RC8A 5JKMA 1DPSA 3SIDA 3KA8A 4PG0A 4RC7A 3PVTB 4DYYA 1HRSA 4RC5A 3PVYA 1SQ3A 2CHIA 1QGHA 3AF9X 4KVQA 3F32A 1UMNA 3EGMA 5D8QA 4EVBA 3ISEA 3F33A 2V15A 4XKSA 1IESA 4MJYA 3BVLA 5C6FA 3WVUA 3QHBA 2CN6A 2FKZA 2FZFA 2CIHA 3AF7X 3UOIA 1LKPA 1ZUJA 4XKUA 2RBDA 4QUWA 1VJXA 1YUZA 3KA6A 1J30A 5K52A 3ES3A 5CMQA 3R2SA 5GN8B 2UX1A 4KVRA 1Z4AA 3KXUA 3SE1A 4TOEA 3A9QA 4LPMA 3E1JA 4TOBA 1LKMA 1RCCA 5GU3X 1JIGA 3GE4A 3PZAA 2V2LA 4CVRA 1H96A 4TOAA 3Q4OA 3F37A 3PW1B 1OTKA 2BKCA 3TA8A 4M32A 5LG2A 5CMRA 3BT5A 2CLBA 3UOFA 3RBCA 2JD70 2C2JA 1JTSA 3E2CA 3QB9A 5LG8A 4CVPA 1TK6A 1MFRA 2BJYA 5CZUA 1JKVA 2C41A 3GVYA 4ITWA 3QVDA 4II4A 3E6SA 5I4JA 2OH3A 2GYDA 2HTNA 3FI6A 3AJOA 3E1QA 5IX6A 5GU2X 1MOJA 2WLUA 4RC6A 1NF6A 3AJQA 1L8IA 3EZ0A 2V2NA 4LYXA 4AM5A 2Z90A
chains in the Genus database with same CATH superfamily
3LKDA 3PWQC 4W4KB 3HL1A 4IXKA 3RGDA 3RD0A 2YW6A 3KX9A 4CVTA 2FJCA 3PVRB 1O9IA 2G4HA 3JZ9A 1TJOA 3R2MA 4LQVA 1EUMA 3NP2X 4MUDA 4PG1A 3KA9A 1S2ZA 5HJFA 2YW7A 4LPNA 4RC5B 2BW1A 3R2OA 3Q4QA 3AJPA 1JYBA 3IS7A 4ZKXA 3PVYB 1JREA 2ZG7X 3E1LA 3RAVA 4LQHA 1YV1A 2IB0A 1O9RA 2Y44A 4IWKA 4KXRB 1RCEA 5JKMG 3DBYA 3WNWA 3E1MA 4PGKA 5J8WA 3C1ZA 2CF7A 4EVCA 1SOFA 3E6RA 3N6OA 4TODA 3OGHA 1JKUA 1XZ3A 1QYBA 3O7SA 4TW3A 2GYQA 3VV9A 3R2LA 2V8TA 4ZLWA 2ZURX 3F39A 2XJNA 5GOUA 1S3QA 2CLUA 1RCDA 2JD80 1VELA 2W0OA 3UNOA 3R2HA 3E1NA 2F7NA 3GGZA 2Z5QA 3NP0X 4X0JA 4Y08A 3OJ5A 3PW8A 1UVHA 5D8PA 3QZ3A 3SHXA 2ZG8X 3O7RA 4TOHA 4EVDA 3AK9A 4R42A 4ML5A 3U90A 1TKOA 2Z5PA 5D8RA 3H7GA 5JKLA 3V3KB 3BVIA 2HR5A 2WLAA 4DYZA 5GU0X 3R2RA 4LQNA 3BVKA 1N1QA 3QHCA 1VEQA 2ZA7A 4ERUA 4YXJA 3Q4RA 2C2FA 4CYBA 5HU6D 4LPJA 2CHPA 1LB3A 5D8YA 3T9JA 3VVAA 1L8HA 5K53A 2IY4A 3PWFA 5JKLG 1DVBA 2X170 2D5KA 5HQOA 2VXXA 1BFRA 5JDOB 1RYTA 2Z5RA 4ZL5A 5FFDA 1Z6OA 3FVBA 3WVVA 1XZ1A 3E1PA 3PW8C 4TO9A 3A68A 4YKHA 2N02A 4ZJKA 2VZBA 1NFVA 4CMYV 4ZKWA 2V2PA 3SH6A 2V2SA 4YVZA 2AR0A 2WTLA 3FRSA 3RE7A 4TOGA 3KDQA 3FSEA 5J9VA 2YJJA 1VEIA 4DI0A 4MKUA 2VXIA 1R03A 5D8SA 5FFCA 4RC7B 5GU1X 3C23A 1NNQA 3AK8A 1YUXA 3BVEA 5FEJA 3BKNA 4DASA 5ERJA 2V2OA 3PVRA 4MXPA 5AXSA 3HIUA 4ZL6A 2OKCA 2YJKA 4Z3BA 1DATA 3PVTA 3M6JA 4ISPA 5ERKA 4AM4A 3WVWA 2BK6A 3ISFA 3UFBA 3C1YA 4OYNA 2C2UA 1JGCA 4ISMA 3BVFA 3F34A 3ERZA 5JACA 2C6RA 4KVSA 3F35A 4ZTTA 4ITTA 1F33A 4M34A 4CYAA 4Z5SA 4XKTA 1KRQA 4TOFA 1TKPA 1BCFA 4M35A 5J93A 2PYBA 3VNXA 4CVSA 1RCIA 1Z6OM 5FFBA 3Q4NA 5FFAA 5LBHA 5LS9A 1ZS3A 2GS4A 5GN8A 1FHAA 4PGIA 2XJOA 3KWOA 5E1UA 4A25A 4ZKHA 2XKQA 1VLGA 4IWJA 3KA4A 2IU2A 2V2RA 2V2IA 5J8SA 1GWGA 3PW1A 2QF9A 4M33A 5D8XA 3PWQA 2QQYA 2Z6MA 1JI4A 3IS8A 4LYUA 4LQJA 3R2KA 2ITBA 5E2DA 2XGWA 4ETRA 4CMYA 2FFXJ 1F30A 5HJHA 3NOZX 4II4B 2XJMA 1AEWA 4E6KA 3IQ1A 1S30A 3MPSA 3F36A 4MY7A 4ZMCA 2Y3QA 2CN7A 1B71A 3FRRA 4RC6B 4W4LB 2ZG9X 3AF8X 1LKOA 2OC5A 4TOCA 2MGYA 3F38A 1NF4A 1BG7A 3W54A 2JD60 2ZA8A 4CY9A 5JDOA 1RCGA 1JI5A 3GHQA 4DZ0A 2FG8A 4AM2A 3KA3A 4DYUA 3EZUA 4REUA 5D8OA 2V2JA 4XGSA 4DYXA 2FL0A 2ZA6A 2FHAA 2V2MA 3E1OA 5FFEA 4U3GA 4P18A 4DE6A 3QD8A 4MN9A 2FG4A 2CEIA 1IERA 4EVEA 4RC8A 5JKMA 1DPSA 3SIDA 4WJG4 3KA8A 4PG0A 4RC7A 3JZAB 3PVTB 4DYYA 1HRSA 4RC5A 3PVYA 1SQ3A 4E40A 2CHIA 3KHKA 1QGHA 3AF9X 4KVQA 3F32A 1UMNA 3EGMA 5D8QA 4EVBA 3ISEA 3F33A 2V15A 4XKSA 1IESA 4MJYA 3BVLA 5C6FA 3WVUA 3QHBA 2CN6A 2FKZA 2FZFA 2CIHA 2G38B 3AF7X 3UOIA 1LKPA 1ZUJA 4XKUA 2RBDA 4QUWA 1VJXA 1YUZA 3KA6A 3L0MA 1J30A 5K52A 3ES3A 5CMQA 3R2SA 5GN8B 2UX1A 4KVRA 1Z4AA 3KXUA 3SE1A 4TOEA 3D19A 3A9QA 3GGYA 4LPMA 3E1JA 4TOBA 1LKMA 1RCCA 2V8UA 5GU3X 1JIGA 3GE4A 3PZAA 2V2LA 4CVRA 1H96A 4TOAA 3Q4OA 3F37A 3PW1B 1OTKA 2BKCA 3TA8A 4M32A 5LG2A 5CMRA 3BT5A 2CLBA 3UOFA 3RBCA 2JD70 2C2JA 1JTSA 3E2CA 3QB9A 5LG8A 4CVPA 1TK6A 1MFRA 2BJYA 2WWXB 5CZUA 1JKVA 2C41A 3GVYA 4ITWA 4YXMA 3QVDA 4II4A 3E6SA 5I4JA 2OH3A 2GYDA 2HTNA 3FI6A 3AJOA 2CWLA 3C21A 3E1QA 5IX6A 5GU2X 1MOJA 2WLUA 4RC6A 1NF6A 3AJQA 1L8IA 3EZ0A 2V2NA 4LYXA 4AM5A 2Z90A
chains in the Genus database with same CATH topology
3LKDA 3PWQC 4W4KB 3HL1A 4IXKA 3RGDA 3RD0A 2YW6A 3KX9A 4CVTA 2FJCA 3PVRB 1O9IA 2G4HA 3JZ9A 1TJOA 3R2MA 4LQVA 1EUMA 3NP2X 4MUDA 4PG1A 3KA9A 1S2ZA 5HJFA 2YW7A 4LPNA 4RC5B 2BW1A 3R2OA 3Q4QA 3AJPA 1JYBA 3IS7A 4ZKXA 3PVYB 1JREA 2ZG7X 3E1LA 3RAVA 4LQHA 1YV1A 2IB0A 1O9RA 2Y44A 4IWKA 4KXRB 1RCEA 5JKMG 3DBYA 3WNWA 3E1MA 4PGKA 5J8WA 3C1ZA 2CF7A 4EVCA 1SOFA 3E6RA 3N6OA 4TODA 3OGHA 1JKUA 1XZ3A 1QYBA 3O7SA 4TW3A 2GYQA 3VV9A 3R2LA 2V8TA 4ZLWA 2ZURX 3F39A 2XJNA 5GOUA 1S3QA 2CLUA 1RCDA 2JD80 1VELA 2W0OA 3UNOA 3R2HA 3E1NA 2F7NA 3GGZA 2Z5QA 3NP0X 4X0JA 4Y08A 3OJ5A 3PW8A 1UVHA 5D8PA 3QZ3A 3SHXA 2ZG8X 3O7RA 4TOHA 4EVDA 3AK9A 4R42A 4ML5A 3U90A 1TKOA 2Z5PA 5D8RA 3H7GA 5JKLA 3V3KB 3BVIA 2HR5A 2WLAA 4DYZA 5GU0X 3R2RA 4LQNA 3BVKA 1N1QA 3QHCA 1VEQA 2ZA7A 4ERUA 4YXJA 3Q4RA 2C2FA 4CYBA 5HU6D 4LPJA 2CHPA 1LB3A 5D8YA 3T9JA 3VVAA 1L8HA 5K53A 2IY4A 3PWFA 5JKLG 1DVBA 2X170 2D5KA 5HQOA 2VXXA 1BFRA 5JDOB 1RYTA 2Z5RA 4ZL5A 5FFDA 1Z6OA 3FVBA 3WVVA 1XZ1A 3E1PA 3PW8C 4TO9A 3A68A 4YKHA 2N02A 4ZJKA 2VZBA 1NFVA 4CMYV 4ZKWA 2V2PA 3SH6A 2V2SA 4YVZA 2AR0A 2WTLA 3FRSA 3RE7A 4TOGA 3KDQA 3FSEA 5J9VA 2YJJA 1VEIA 4DI0A 4MKUA 2VXIA 1R03A 5D8SA 5FFCA 4RC7B 5GU1X 3C23A 1NNQA 3AK8A 1YUXA 3BVEA 5FEJA 3BKNA 4DASA 5ERJA 2V2OA 3PVRA 4MXPA 5AXSA 3HIUA 4ZL6A 2OKCA 2YJKA 4Z3BA 1DATA 3PVTA 3M6JA 4ISPA 5ERKA 4AM4A 3WVWA 2BK6A 3ISFA 3UFBA 3C1YA 4OYNA 2C2UA 1JGCA 4ISMA 3BVFA 3F34A 3ERZA 5JACA 2C6RA 4KVSA 3F35A 4ZTTA 4ITTA 1F33A 4M34A 4CYAA 4Z5SA 4XKTA 1KRQA 4TOFA 1TKPA 1BCFA 4M35A 5J93A 2PYBA 3VNXA 4CVSA 1RCIA 1Z6OM 5FFBA 3Q4NA 5FFAA 5LBHA 5LS9A 1ZS3A 2GS4A 5GN8A 1FHAA 4PGIA 2XJOA 3KWOA 5E1UA 4A25A 4ZKHA 2XKQA 1VLGA 4IWJA 3KA4A 2IU2A 2V2RA 2V2IA 5J8SA 1GWGA 3PW1A 2QF9A 4M33A 5D8XA 3PWQA 2QQYA 2Z6MA 1JI4A 3IS8A 4LYUA 4LQJA 3R2KA 2ITBA 5E2DA 2XGWA 4ETRA 4CMYA 2FFXJ 1F30A 5HJHA 3NOZX 4II4B 2XJMA 1AEWA 4E6KA 3IQ1A 1S30A 3MPSA 3F36A 4MY7A 4ZMCA 2Y3QA 2CN7A 1B71A 3FRRA 4RC6B 4W4LB 2ZG9X 3AF8X 1LKOA 2OC5A 4TOCA 2MGYA 3F38A 1NF4A 1BG7A 3W54A 2JD60 2ZA8A 4CY9A 5JDOA 1RCGA 1JI5A 3GHQA 4DZ0A 2FG8A 4AM2A 3KA3A 4DYUA 3EZUA 4REUA 5D8OA 2V2JA 4XGSA 4DYXA 2FL0A 2ZA6A 2FHAA 2V2MA 3E1OA 5FFEA 4U3GA 4P18A 4DE6A 3QD8A 4MN9A 2FG4A 2CEIA 1IERA 4EVEA 4RC8A 5JKMA 1DPSA 3SIDA 4WJG4 3KA8A 4PG0A 4RC7A 3JZAB 3PVTB 4DYYA 1HRSA 4RC5A 3PVYA 1SQ3A 4E40A 2CHIA 3KHKA 1QGHA 3AF9X 4KVQA 3F32A 1UMNA 3EGMA 5D8QA 4EVBA 3ISEA 3F33A 2V15A 4XKSA 1IESA 4MJYA 3BVLA 5C6FA 3WVUA 3QHBA 2CN6A 2FKZA 2FZFA 2CIHA 2G38B 3AF7X 3UOIA 1LKPA 1ZUJA 4XKUA 2RBDA 4QUWA 1VJXA 1YUZA 3KA6A 3L0MA 1J30A 5K52A 3ES3A 5CMQA 3R2SA 5GN8B 2UX1A 4KVRA 1Z4AA 3KXUA 3SE1A 4TOEA 3D19A 3A9QA 3GGYA 4LPMA 3E1JA 4TOBA 1LKMA 1RCCA 2V8UA 5GU3X 1JIGA 3GE4A 3PZAA 2V2LA 4CVRA 1H96A 4TOAA 3Q4OA 3F37A 3PW1B 1OTKA 2BKCA 3TA8A 4M32A 5LG2A 5CMRA 3BT5A 2CLBA 3UOFA 3RBCA 2JD70 2C2JA 1JTSA 3E2CA 3QB9A 5LG8A 4CVPA 1TK6A 1MFRA 2BJYA 2WWXB 5CZUA 1JKVA 2C41A 3GVYA 4ITWA 4YXMA 3QVDA 4II4A 3E6SA 5I4JA 2OH3A 2GYDA 2HTNA 3FI6A 3AJOA 2CWLA 3C21A 3E1QA 5IX6A 5GU2X 1MOJA 2WLUA 4RC6A 1NF6A 3AJQA 1L8IA 3EZ0A 2V2NA 4LYXA 4AM5A 2Z90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PWQ C;  3HL1 A;  4IXK A;  3RGD A;  3RD0 A;  2YW6 A;  3KX9 A;  4CVT A;  2FJC A;  3PVR B;  1O9I A;  2G4H A;  1TJO A;  3R2M A;  4LQV A;  1EUM A;  3NP2 X;  4MUD A;  4PG1 A;  3KA9 A;  1S2Z A;  5HJF A;  2YW7 A;  4LPN A;  4RC5 B;  2BW1 A;  3R2O A;  3Q4Q A;  3AJP A;  1JYB A;  3IS7 A;  4ZKX A;  3PVY B;  1JRE A;  2ZG7 X;  3E1L A;  3RAV A;  4LQH A;  1YV1 A;  2IB0 A;  1O9R A;  4IWK A;  1RCE A;  5JKM G;  3WNW A;  3E1M A;  4PGK A;  5J8W A;  2CF7 A;  4EVC A;  1SOF A;  3E6R A;  4TOD A;  3OGH A;  1JKU A;  1XZ3 A;  1QYB A;  3O7S A;  4TW3 A;  2GYQ A;  3R2L A;  4ZLW A;  2ZUR X;  3F39 A;  2XJN A;  5GOU A;  1S3Q A;  2CLU A;  1RCD A;  2JD8 0;  1VEL A;  2W0O A;  3UNO A;  3R2H A;  3E1N A;  2F7N A;  2Z5Q A;  3NP0 X;  4Y08 A;  3OJ5 A;  3PW8 A;  1UVH A;  5D8P A;  3QZ3 A;  3SHX A;  2ZG8 X;  3O7R A;  4TOH A;  4EVD A;  3AK9 A;  4R42 A;  4ML5 A;  3U90 A;  1TKO A;  2Z5P A;  5D8R A;  3H7G A;  5JKL A;  3BVI A;  2HR5 A;  2WLA A;  4DYZ A;  5GU0 X;  3R2R A;  4LQN A;  3BVK A;  1N1Q A;  3QHC A;  1VEQ A;  2ZA7 A;  4ERU A;  3Q4R A;  2C2F A;  4CYB A;  4LPJ A;  2CHP A;  1LB3 A;  5D8Y A;  3T9J A;  1L8H A;  5K53 A;  2IY4 A;  3PWF A;  5JKL G;  1DVB A;  2X17 0;  2D5K A;  5HQO A;  2VXX A;  1BFR A;  1RYT A;  2Z5R A;  4ZL5 A;  5FFD A;  1Z6O A;  3FVB A;  3WVV A;  1XZ1 A;  3E1P A;  3PW8 C;  4TO9 A;  3A68 A;  4YKH A;  4ZJK A;  2VZB A;  1NFV A;  4CMY V;  4ZKW A;  2V2P A;  3SH6 A;  2V2S A;  2WTL A;  3RE7 A;  4TOG A;  3FSE A;  5J9V A;  2YJJ A;  1VEI A;  4DI0 A;  4MKU A;  2VXI A;  1R03 A;  5D8S A;  5FFC A;  4RC7 B;  5GU1 X;  1NNQ A;  3AK8 A;  1YUX A;  3BVE A;  5FEJ A;  3BKN A;  4DAS A;  5ERJ A;  2V2O A;  3PVR A;  5AXS A;  3HIU A;  4ZL6 A;  2YJK A;  4Z3B A;  1DAT A;  3PVT A;  4ISP A;  5ERK A;  4AM4 A;  3WVW A;  2BK6 A;  3ISF A;  4OYN A;  2C2U A;  1JGC A;  4ISM A;  3BVF A;  3F34 A;  3ERZ A;  5JAC A;  2C6R A;  4KVS A;  3F35 A;  4ZTT A;  4ITT A;  1F33 A;  4M34 A;  4CYA A;  4Z5S A;  4XKT A;  1KRQ A;  4TOF A;  1TKP A;  1BCF A;  4M35 A;  5J93 A;  2PYB A;  3VNX A;  4CVS A;  1RCI A;  1Z6O M;  5FFB A;  3Q4N A;  5FFA A;  5LBH A;  5LS9 A;  1ZS3 A;  2GS4 A;  5GN8 A;  1FHA A;  4PGI A;  2XJO A;  3KWO A;  5E1U A;  4A25 A;  4ZKH A;  2XKQ A;  1VLG A;  4IWJ A;  3KA4 A;  2IU2 A;  2V2R A;  2V2I A;  5J8S A;  1GWG A;  3PW1 A;  2QF9 A;  4M33 A;  5D8X A;  3PWQ A;  2QQY A;  2Z6M A;  1JI4 A;  3IS8 A;  4LYU A;  4LQJ A;  3R2K A;  2ITB A;  5E2D A;  2XGW A;  4ETR A;  4CMY A;  2FFX J;  1F30 A;  5HJH A;  3NOZ X;  4II4 B;  2XJM A;  1AEW A;  4E6K A;  3IQ1 A;  1S30 A;  3MPS A;  3F36 A;  4MY7 A;  4ZMC A;  2Y3Q A;  2CN7 A;  1B71 A;  4RC6 B;  2ZG9 X;  3AF8 X;  1LKO A;  2OC5 A;  4TOC A;  3F38 A;  1NF4 A;  1BG7 A;  2JD6 0;  2ZA8 A;  4CY9 A;  1RCG A;  1JI5 A;  3GHQ A;  4DZ0 A;  2FG8 A;  4AM2 A;  3KA3 A;  4DYU A;  3EZU A;  4REU A;  5D8O A;  2V2J A;  4XGS A;  4DYX A;  2FL0 A;  2ZA6 A;  2FHA A;  2V2M A;  3E1O A;  5FFE A;  4U3G A;  4P18 A;  4DE6 A;  3QD8 A;  4MN9 A;  2FG4 A;  2CEI A;  1IER A;  4EVE A;  4RC8 A;  5JKM A;  1DPS A;  3SID A;  3KA8 A;  4PG0 A;  4RC7 A;  3PVT B;  4DYY A;  1HRS A;  4RC5 A;  3PVY A;  1SQ3 A;  2CHI A;  1QGH A;  3AF9 X;  4KVQ A;  3F32 A;  1UMN A;  3EGM A;  5D8Q A;  4EVB A;  3ISE A;  3F33 A;  2V15 A;  4XKS A;  1IES A;  4MJY A;  3BVL A;  5C6F A;  3WVU A;  3QHB A;  2CN6 A;  2FKZ A;  2FZF A;  2CIH A;  3AF7 X;  3UOI A;  1LKP A;  1ZUJ A;  4XKU A;  2RBD A;  4QUW A;  1VJX A;  1YUZ A;  3KA6 A;  1J30 A;  5K52 A;  3ES3 A;  5CMQ A;  3R2S A;  5GN8 B;  2UX1 A;  4KVR A;  1Z4A A;  3KXU A;  3SE1 A;  4TOE A;  3A9Q A;  4LPM A;  3E1J A;  4TOB A;  1LKM A;  1RCC A;  5GU3 X;  1JIG A;  3GE4 A;  3PZA A;  2V2L A;  4CVR A;  1H96 A;  4TOA A;  3Q4O A;  3F37 A;  3PW1 B;  1OTK A;  2BKC A;  3TA8 A;  4M32 A;  5LG2 A;  5CMR A;  3BT5 A;  2CLB A;  3UOF A;  3RBC A;  2JD7 0;  2C2J A;  1JTS A;  3E2C A;  3QB9 A;  5LG8 A;  4CVP A;  1TK6 A;  1MFR A;  2BJY A;  5CZU A;  1JKV A;  2C41 A;  3GVY A;  4ITW A;  3QVD A;  4II4 A;  3E6S A;  5I4J A;  2OH3 A;  2GYD A;  2HTN A;  3FI6 A;  3AJO A;  3E1Q A;  5IX6 A;  5GU2 X;  1MOJ A;  2WLU A;  4RC6 A;  1NF6 A;  3AJQ A;  1L8I A;  3EZ0 A;  2V2N A;  4LYX A;  4AM5 A;  2Z90 A; 
#chains in the Genus database with same CATH topology
 3LKD A;  3PWQ C;  4W4K B;  3HL1 A;  4IXK A;  3RGD A;  3RD0 A;  2YW6 A;  3KX9 A;  4CVT A;  2FJC A;  3PVR B;  1O9I A;  2G4H A;  3JZ9 A;  1TJO A;  3R2M A;  4LQV A;  1EUM A;  3NP2 X;  4MUD A;  4PG1 A;  3KA9 A;  1S2Z A;  5HJF A;  2YW7 A;  4LPN A;  4RC5 B;  2BW1 A;  3R2O A;  3Q4Q A;  3AJP A;  1JYB A;  3IS7 A;  4ZKX A;  3PVY B;  1JRE A;  2ZG7 X;  3E1L A;  3RAV A;  4LQH A;  1YV1 A;  2IB0 A;  1O9R A;  2Y44 A;  4IWK A;  4KXR B;  1RCE A;  5JKM G;  3DBY A;  3WNW A;  3E1M A;  4PGK A;  5J8W A;  3C1Z A;  2CF7 A;  4EVC A;  1SOF A;  3E6R A;  3N6O A;  4TOD A;  3OGH A;  1JKU A;  1XZ3 A;  1QYB A;  3O7S A;  4TW3 A;  2GYQ A;  3VV9 A;  3R2L A;  2V8T A;  4ZLW A;  2ZUR X;  3F39 A;  2XJN A;  5GOU A;  1S3Q A;  2CLU A;  1RCD A;  2JD8 0;  1VEL A;  2W0O A;  3UNO A;  3R2H A;  3E1N A;  2F7N A;  3GGZ A;  2Z5Q A;  3NP0 X;  4X0J A;  4Y08 A;  3OJ5 A;  3PW8 A;  1UVH A;  5D8P A;  3QZ3 A;  3SHX A;  2ZG8 X;  3O7R A;  4TOH A;  4EVD A;  3AK9 A;  4R42 A;  4ML5 A;  3U90 A;  1TKO A;  2Z5P A;  5D8R A;  3H7G A;  5JKL A;  3V3K B;  3BVI A;  2HR5 A;  2WLA A;  4DYZ A;  5GU0 X;  3R2R A;  4LQN A;  3BVK A;  1N1Q A;  3QHC A;  1VEQ A;  2ZA7 A;  4ERU A;  4YXJ A;  3Q4R A;  2C2F A;  4CYB A;  5HU6 D;  4LPJ A;  2CHP A;  1LB3 A;  5D8Y A;  3T9J A;  3VVA A;  1L8H A;  5K53 A;  2IY4 A;  3PWF A;  5JKL G;  1DVB A;  2X17 0;  2D5K A;  5HQO A;  2VXX A;  1BFR A;  5JDO B;  1RYT A;  2Z5R A;  4ZL5 A;  5FFD A;  1Z6O A;  3FVB A;  3WVV A;  1XZ1 A;  3E1P A;  3PW8 C;  4TO9 A;  3A68 A;  4YKH A;  2N02 A;  4ZJK A;  2VZB A;  1NFV A;  4CMY V;  4ZKW A;  2V2P A;  3SH6 A;  2V2S A;  4YVZ A;  2AR0 A;  2WTL A;  3FRS A;  3RE7 A;  4TOG A;  3KDQ A;  3FSE A;  5J9V A;  2YJJ A;  1VEI A;  4DI0 A;  4MKU A;  2VXI A;  1R03 A;  5D8S A;  5FFC A;  4RC7 B;  5GU1 X;  3C23 A;  1NNQ A;  3AK8 A;  1YUX A;  3BVE A;  5FEJ A;  3BKN A;  4DAS A;  5ERJ A;  2V2O A;  3PVR A;  4MXP A;  5AXS A;  3HIU A;  4ZL6 A;  2OKC A;  2YJK A;  4Z3B A;  1DAT A;  3PVT A;  3M6J A;  4ISP A;  5ERK A;  4AM4 A;  3WVW A;  2BK6 A;  3ISF A;  3UFB A;  3C1Y A;  4OYN A;  2C2U A;  1JGC A;  4ISM A;  3BVF A;  3F34 A;  3ERZ A;  5JAC A;  2C6R A;  4KVS A;  3F35 A;  4ZTT A;  4ITT A;  1F33 A;  4M34 A;  4CYA A;  4Z5S A;  4XKT A;  1KRQ A;  4TOF A;  1TKP A;  1BCF A;  4M35 A;  5J93 A;  2PYB A;  3VNX A;  4CVS A;  1RCI A;  1Z6O M;  5FFB A;  3Q4N A;  5FFA A;  5LBH A;  5LS9 A;  1ZS3 A;  2GS4 A;  5GN8 A;  1FHA A;  4PGI A;  2XJO A;  3KWO A;  5E1U A;  4A25 A;  4ZKH A;  2XKQ A;  1VLG A;  4IWJ A;  3KA4 A;  2IU2 A;  2V2R A;  2V2I A;  5J8S A;  1GWG A;  3PW1 A;  2QF9 A;  4M33 A;  5D8X A;  3PWQ A;  2QQY A;  2Z6M A;  1JI4 A;  3IS8 A;  4LYU A;  4LQJ A;  3R2K A;  2ITB A;  5E2D A;  2XGW A;  4ETR A;  4CMY A;  2FFX J;  1F30 A;  5HJH A;  3NOZ X;  4II4 B;  2XJM A;  1AEW A;  4E6K A;  3IQ1 A;  1S30 A;  3MPS A;  3F36 A;  4MY7 A;  4ZMC A;  2Y3Q A;  2CN7 A;  1B71 A;  3FRR A;  4RC6 B;  4W4L B;  2ZG9 X;  3AF8 X;  1LKO A;  2OC5 A;  4TOC A;  2MGY A;  3F38 A;  1NF4 A;  1BG7 A;  3W54 A;  2JD6 0;  2ZA8 A;  4CY9 A;  5JDO A;  1RCG A;  1JI5 A;  3GHQ A;  4DZ0 A;  2FG8 A;  4AM2 A;  3KA3 A;  4DYU A;  3EZU A;  4REU A;  5D8O A;  2V2J A;  4XGS A;  4DYX A;  2FL0 A;  2ZA6 A;  2FHA A;  2V2M A;  3E1O A;  5FFE A;  4U3G A;  4P18 A;  4DE6 A;  3QD8 A;  4MN9 A;  2FG4 A;  2CEI A;  1IER A;  4EVE A;  4RC8 A;  5JKM A;  1DPS A;  3SID A;  4WJG 4;  3KA8 A;  4PG0 A;  4RC7 A;  3JZA B;  3PVT B;  4DYY A;  1HRS A;  4RC5 A;  3PVY A;  1SQ3 A;  4E40 A;  2CHI A;  3KHK A;  1QGH A;  3AF9 X;  4KVQ A;  3F32 A;  1UMN A;  3EGM A;  5D8Q A;  4EVB A;  3ISE A;  3F33 A;  2V15 A;  4XKS A;  1IES A;  4MJY A;  3BVL A;  5C6F A;  3WVU A;  3QHB A;  2CN6 A;  2FKZ A;  2FZF A;  2CIH A;  2G38 B;  3AF7 X;  3UOI A;  1LKP A;  1ZUJ A;  4XKU A;  2RBD A;  4QUW A;  1VJX A;  1YUZ A;  3KA6 A;  3L0M A;  1J30 A;  5K52 A;  3ES3 A;  5CMQ A;  3R2S A;  5GN8 B;  2UX1 A;  4KVR A;  1Z4A A;  3KXU A;  3SE1 A;  4TOE A;  3D19 A;  3A9Q A;  3GGY A;  4LPM A;  3E1J A;  4TOB A;  1LKM A;  1RCC A;  2V8U A;  5GU3 X;  1JIG A;  3GE4 A;  3PZA A;  2V2L A;  4CVR A;  1H96 A;  4TOA A;  3Q4O A;  3F37 A;  3PW1 B;  1OTK A;  2BKC A;  3TA8 A;  4M32 A;  5LG2 A;  5CMR A;  3BT5 A;  2CLB A;  3UOF A;  3RBC A;  2JD7 0;  2C2J A;  1JTS A;  3E2C A;  3QB9 A;  5LG8 A;  4CVP A;  1TK6 A;  1MFR A;  2BJY A;  2WWX B;  5CZU A;  1JKV A;  2C41 A;  3GVY A;  4ITW A;  4YXM A;  3QVD A;  4II4 A;  3E6S A;  5I4J A;  2OH3 A;  2GYD A;  2HTN A;  3FI6 A;  3AJO A;  2CWL A;  3C21 A;  3E1Q A;  5IX6 A;  5GU2 X;  1MOJ A;  2WLU A;  4RC6 A;  1NF6 A;  3AJQ A;  1L8I A;  3EZ0 A;  2V2N A;  4LYX A;  4AM5 A;  2Z90 A; 
#chains in the Genus database with same CATH homology
 3LKD A;  3PWQ C;  4W4K B;  3HL1 A;  4IXK A;  3RGD A;  3RD0 A;  2YW6 A;  3KX9 A;  4CVT A;  2FJC A;  3PVR B;  1O9I A;  2G4H A;  3JZ9 A;  1TJO A;  3R2M A;  4LQV A;  1EUM A;  3NP2 X;  4MUD A;  4PG1 A;  3KA9 A;  1S2Z A;  5HJF A;  2YW7 A;  4LPN A;  4RC5 B;  2BW1 A;  3R2O A;  3Q4Q A;  3AJP A;  1JYB A;  3IS7 A;  4ZKX A;  3PVY B;  1JRE A;  2ZG7 X;  3E1L A;  3RAV A;  4LQH A;  1YV1 A;  2IB0 A;  1O9R A;  2Y44 A;  4IWK A;  4KXR B;  1RCE A;  5JKM G;  3DBY A;  3WNW A;  3E1M A;  4PGK A;  5J8W A;  3C1Z A;  2CF7 A;  4EVC A;  1SOF A;  3E6R A;  3N6O A;  4TOD A;  3OGH A;  1JKU A;  1XZ3 A;  1QYB A;  3O7S A;  4TW3 A;  2GYQ A;  3VV9 A;  3R2L A;  2V8T A;  4ZLW A;  2ZUR X;  3F39 A;  2XJN A;  5GOU A;  1S3Q A;  2CLU A;  1RCD A;  2JD8 0;  1VEL A;  2W0O A;  3UNO A;  3R2H A;  3E1N A;  2F7N A;  3GGZ A;  2Z5Q A;  3NP0 X;  4X0J A;  4Y08 A;  3OJ5 A;  3PW8 A;  1UVH A;  5D8P A;  3QZ3 A;  3SHX A;  2ZG8 X;  3O7R A;  4TOH A;  4EVD A;  3AK9 A;  4R42 A;  4ML5 A;  3U90 A;  1TKO A;  2Z5P A;  5D8R A;  3H7G A;  5JKL A;  3V3K B;  3BVI A;  2HR5 A;  2WLA A;  4DYZ A;  5GU0 X;  3R2R A;  4LQN A;  3BVK A;  1N1Q A;  3QHC A;  1VEQ A;  2ZA7 A;  4ERU A;  4YXJ A;  3Q4R A;  2C2F A;  4CYB A;  5HU6 D;  4LPJ A;  2CHP A;  1LB3 A;  5D8Y A;  3T9J A;  3VVA A;  1L8H A;  5K53 A;  2IY4 A;  3PWF A;  5JKL G;  1DVB A;  2X17 0;  2D5K A;  5HQO A;  2VXX A;  1BFR A;  5JDO B;  1RYT A;  2Z5R A;  4ZL5 A;  5FFD A;  1Z6O A;  3FVB A;  3WVV A;  1XZ1 A;  3E1P A;  3PW8 C;  4TO9 A;  3A68 A;  4YKH A;  2N02 A;  4ZJK A;  2VZB A;  1NFV A;  4CMY V;  4ZKW A;  2V2P A;  3SH6 A;  2V2S A;  4YVZ A;  2AR0 A;  2WTL A;  3FRS A;  3RE7 A;  4TOG A;  3KDQ A;  3FSE A;  5J9V A;  2YJJ A;  1VEI A;  4DI0 A;  4MKU A;  2VXI A;  1R03 A;  5D8S A;  5FFC A;  4RC7 B;  5GU1 X;  3C23 A;  1NNQ A;  3AK8 A;  1YUX A;  3BVE A;  5FEJ A;  3BKN A;  4DAS A;  5ERJ A;  2V2O A;  3PVR A;  4MXP A;  5AXS A;  3HIU A;  4ZL6 A;  2OKC A;  2YJK A;  4Z3B A;  1DAT A;  3PVT A;  3M6J A;  4ISP A;  5ERK A;  4AM4 A;  3WVW A;  2BK6 A;  3ISF A;  3UFB A;  3C1Y A;  4OYN A;  2C2U A;  1JGC A;  4ISM A;  3BVF A;  3F34 A;  3ERZ A;  5JAC A;  2C6R A;  4KVS A;  3F35 A;  4ZTT A;  4ITT A;  1F33 A;  4M34 A;  4CYA A;  4Z5S A;  4XKT A;  1KRQ A;  4TOF A;  1TKP A;  1BCF A;  4M35 A;  5J93 A;  2PYB A;  3VNX A;  4CVS A;  1RCI A;  1Z6O M;  5FFB A;  3Q4N A;  5FFA A;  5LBH A;  5LS9 A;  1ZS3 A;  2GS4 A;  5GN8 A;  1FHA A;  4PGI A;  2XJO A;  3KWO A;  5E1U A;  4A25 A;  4ZKH A;  2XKQ A;  1VLG A;  4IWJ A;  3KA4 A;  2IU2 A;  2V2R A;  2V2I A;  5J8S A;  1GWG A;  3PW1 A;  2QF9 A;  4M33 A;  5D8X A;  3PWQ A;  2QQY A;  2Z6M A;  1JI4 A;  3IS8 A;  4LYU A;  4LQJ A;  3R2K A;  2ITB A;  5E2D A;  2XGW A;  4ETR A;  4CMY A;  2FFX J;  1F30 A;  5HJH A;  3NOZ X;  4II4 B;  2XJM A;  1AEW A;  4E6K A;  3IQ1 A;  1S30 A;  3MPS A;  3F36 A;  4MY7 A;  4ZMC A;  2Y3Q A;  2CN7 A;  1B71 A;  3FRR A;  4RC6 B;  4W4L B;  2ZG9 X;  3AF8 X;  1LKO A;  2OC5 A;  4TOC A;  2MGY A;  3F38 A;  1NF4 A;  1BG7 A;  3W54 A;  2JD6 0;  2ZA8 A;  4CY9 A;  5JDO A;  1RCG A;  1JI5 A;  3GHQ A;  4DZ0 A;  2FG8 A;  4AM2 A;  3KA3 A;  4DYU A;  3EZU A;  4REU A;  5D8O A;  2V2J A;  4XGS A;  4DYX A;  2FL0 A;  2ZA6 A;  2FHA A;  2V2M A;  3E1O A;  5FFE A;  4U3G A;  4P18 A;  4DE6 A;  3QD8 A;  4MN9 A;  2FG4 A;  2CEI A;  1IER A;  4EVE A;  4RC8 A;  5JKM A;  1DPS A;  3SID A;  4WJG 4;  3KA8 A;  4PG0 A;  4RC7 A;  3JZA B;  3PVT B;  4DYY A;  1HRS A;  4RC5 A;  3PVY A;  1SQ3 A;  4E40 A;  2CHI A;  3KHK A;  1QGH A;  3AF9 X;  4KVQ A;  3F32 A;  1UMN A;  3EGM A;  5D8Q A;  4EVB A;  3ISE A;  3F33 A;  2V15 A;  4XKS A;  1IES A;  4MJY A;  3BVL A;  5C6F A;  3WVU A;  3QHB A;  2CN6 A;  2FKZ A;  2FZF A;  2CIH A;  2G38 B;  3AF7 X;  3UOI A;  1LKP A;  1ZUJ A;  4XKU A;  2RBD A;  4QUW A;  1VJX A;  1YUZ A;  3KA6 A;  3L0M A;  1J30 A;  5K52 A;  3ES3 A;  5CMQ A;  3R2S A;  5GN8 B;  2UX1 A;  4KVR A;  1Z4A A;  3KXU A;  3SE1 A;  4TOE A;  3D19 A;  3A9Q A;  3GGY A;  4LPM A;  3E1J A;  4TOB A;  1LKM A;  1RCC A;  2V8U A;  5GU3 X;  1JIG A;  3GE4 A;  3PZA A;  2V2L A;  4CVR A;  1H96 A;  4TOA A;  3Q4O A;  3F37 A;  3PW1 B;  1OTK A;  2BKC A;  3TA8 A;  4M32 A;  5LG2 A;  5CMR A;  3BT5 A;  2CLB A;  3UOF A;  3RBC A;  2JD7 0;  2C2J A;  1JTS A;  3E2C A;  3QB9 A;  5LG8 A;  4CVP A;  1TK6 A;  1MFR A;  2BJY A;  2WWX B;  5CZU A;  1JKV A;  2C41 A;  3GVY A;  4ITW A;  4YXM A;  3QVD A;  4II4 A;  3E6S A;  5I4J A;  2OH3 A;  2GYD A;  2HTN A;  3FI6 A;  3AJO A;  2CWL A;  3C21 A;  3E1Q A;  5IX6 A;  5GU2 X;  1MOJ A;  2WLU A;  4RC6 A;  1NF6 A;  3AJQ A;  1L8I A;  3EZ0 A;  2V2N A;  4LYX A;  4AM5 A;  2Z90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...