1UVHA

X-ray structure of dps from mycobacterium smegmatis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
TIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQWFVRAHLESAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STARVATION-INDUCED DNA PROTECTING PROTEIN
publication title Reassessment of Protein Stability, DNA Binding, and Protection of Mycobacterium Smegmatis Dps.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
total genus 57
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1uvhA00
2IU2A 5K52A 4LQVA 4IWJA 2FZFA 1UVHA 3Q4NA 2RBDA 1LKOA 1TJOA 4KVSA 4LPJA 2YJJA 4M33A 2WLUA 2Z6MA 5GU1X 3GVYA 1QGHA 3QVDA 3RE7A 2ZG9X 1S3QA 2V2PA 2C2UA 3PW8A 4MN9A 2C6RA 2IY4A 3AK9A 3MPSA 1J30A 2BJYA 3FVBA 1BG7A 5GN8B 3QD8A 5D8YA 3FSEA 3PWQC 3PWQA 2C41A 3BKNA 4U3GA 2HR5A 3ERZA 1JI4A 2ITBA 3TA8A 2CF7A 4XKSA 4DYXA 2FHAA 4ZKWA 3R2MA 1L8HA 3H7GA 1XZ1A 4TOEA 4EVCA 1DPSA 4CYBA 1Z6OM 3AJOA 3BT5A 4AM2A 1F30A 4M35A 4KVQA 3HIUA 4KVRA 2Z5QA 5HQOA 2XJNA 1RCIA 3F39A 3ISFA 5ERKA 4ZL6A 4ZMCA 1Z4AA 5JACA 4CYAA 4EVEA 4AM5A 3OGHA 4DYUA 5J93A 5FFBA 3IQ1A 3UOFA 5FFDA 1R03A 3EGMA 3O7RA 4RC7A 4PGKA 3A68A 2ZA8A 4RC5B 1KRQA 5J8WA 2VXXA 2XGWA 3PVRB 3QZ3A 2CHIA 3E1NA 2C2FA 3RD0A 2PYBA 1LKPA 2ZA6A 3AF8X 5LG2A 3PW1A 5CMQA 1JREA 3AF9X 4Y08A 2Y3QA 1YUXA 3E2CA 3R2HA 3WVWA 1HRSA 5J8SA 4ML5A 4DI0A 3QHCA 4ETRA 4II4A 1AEWA 1ZS3A 3PVRA 4MUDA 4TW3A 3KXUA 4LQHA 3E1PA 1F33A 5GU0X 1TKPA 3SHXA 2YJKA 4EVDA 2BK6A 3E6SA 2GS4A 3BVIA 1XZ3A 3SE1A 2CHPA 4CY9A 2C2JA 2CN7A 1Z6OA 5HJFA 2V2JA 4XGSA 3PVYB 2YW6A 4MKUA 4MJYA 3F33A 4QUWA 2OC5A 4IXKA 4PG1A 2V2NA 2XJOA 1JKUA 4ZLWA 4LPNA 4ZKHA 3F38A 1VEQA 4TOGA 5IX6A 1RCEA 3HL1A 2G4HA 3R2LA 3R2KA 3PVYA 3F37A 1YUZA 3IS7A 4PGIA 4ISPA 3KA6A 3QHBA 2CN6A 1SOFA 2BW1A 1LKMA 4OYNA 3KA3A 4AM4A 1O9RA 4DZ0A 3BVKA 5GOUA 4CVSA 3AK8A 5CZUA 4MY7A 5D8PA 2D5KA 2FKZA 1H96A 5JKMG 2IB0A 1DATA 4RC7B 1TK6A 4CVPA 3E1QA 4CVRA 2Z90A 4M34A 2CLBA 5D8XA 4LYXA 3NP2X 3Q4RA 3PVTB 4TOHA 4Z5SA 2ZURX 3PW1B 3PZAA 2FG4A 2JD60 3Q4OA 3SIDA 1VEIA 3BVLA 3ISEA 2Z5RA 1S30A 4XKTA 2VZBA 5D8SA 3NP0X 2V2OA 4II4B 2BKCA 3EZ0A 3KX9A 2V2SA 3E1LA 4RC8A 1BFRA 3IS8A 3AJPA 2Z5PA 3PVTA 1RCGA 3UOIA 3Q4QA 5D8RA 4DE6A 1O9IA 2V2MA 3KWOA 3AF7X 5C6FA 4TOCA 2FFXJ 3WNWA 4LQJA 4ZKXA 2V15A 1B71A 4ZJKA 5FFCA 3R2OA 3E1MA 1RCDA 3E1JA 1JGCA 4XKUA 4LYUA 4TOFA 5LS9A 3GHQA 5J9VA 4M32A 3PWFA 2YW7A 1IESA 5ERJA 4CMYA 1VELA 5HJHA 1MFRA 5K53A 2GYDA 4ISMA 4CMYV 4ERUA 2XKQA 5FFEA 3R2RA 4REUA 3RGDA 5FFAA 3KA9A 2X170 4ITWA 1TKOA 3F32A 2WTLA 4DASA 1L8IA 1QYBA 2JD80 4E6KA 3E1OA 1OTKA 3R2SA 2V2LA 4ITTA 3ES3A 4Z3BA 5JKLA 4RC6B 4ZTTA 3GE4A 4DYYA 3BVFA 2CEIA 4LQNA 3RAVA 3AJQA 3PW8C 3VNXA 1JKVA 1JIGA 3EZUA 1DVBA 2OH3A 1RYTA 5AXSA 3KA8A 3O7SA 3RBCA 3SH6A 3BVEA 1SQ3A 1FHAA 4R42A 3F34A 2UX1A 3F35A 4RC6A 1LB3A 4P18A 2FJCA 2W0OA 3QB9A 2WLAA 2CLUA 4TOBA 4IWKA 5E1UA 2VXIA 5I4JA 1RCCA 2XJMA 2ZG8X 3WVVA 3KA4A 4TOAA 4DYZA 5GN8A 1NF4A 2HTNA 1EUMA 3WVUA 2V2IA 4TODA 2V2RA 4CVTA 1MOJA 4PG0A 2GYQA 5GU2X 1S2ZA 2F7NA 1ZUJA 4YKHA 2QQYA 3OJ5A 4A25A 2FG8A 4LPMA 1GWGA 5JKMA 5D8QA 1NFVA 1VLGA 1BCFA 4EVBA 3U90A 1JI5A 3A9QA 5CMRA 5LBHA 1IERA 1YV1A 1NNQA 2QF9A 3FI6A 1UMNA 5LG8A 1VJXA 2JD70 3NOZX 5GU3X 3E6RA 5E2DA 3F36A 1JTSA 3UNOA 5JKLG 1JYBA 4TO9A 5FEJA 4RC5A 1N1QA 4ZL5A 5D8OA 3T9JA 2ZA7A 1NF6A 2ZG7X 2CIHA 2FL0A
chains in the Genus database with same CATH superfamily
2IU2A 5K52A 4LQVA 4IWJA 2FZFA 1UVHA 3Q4NA 2RBDA 1LKOA 1TJOA 4KVSA 4LPJA 2YJJA 4M33A 2WLUA 2Z6MA 5GU1X 3GVYA 1QGHA 3QVDA 3RE7A 2ZG9X 1S3QA 5JDOA 5HU6D 2V2PA 2C2UA 3PW8A 4MN9A 2C6RA 2IY4A 3AK9A 3MPSA 1J30A 2BJYA 3FVBA 1BG7A 5GN8B 3C1ZA 3N6OA 3QD8A 5D8YA 3FSEA 3PWQC 3PWQA 2C41A 3BKNA 4U3GA 2HR5A 3ERZA 1JI4A 2ITBA 3TA8A 2CF7A 3M6JA 4XKSA 4DYXA 2FHAA 2MGYA 4ZKWA 3R2MA 1L8HA 3H7GA 3W54A 1XZ1A 2AR0A 4TOEA 4EVCA 1DPSA 4CYBA 1Z6OM 3AJOA 3BT5A 4AM2A 1F30A 4M35A 4KVQA 3HIUA 4KVRA 2Z5QA 5HQOA 2XJNA 1RCIA 3F39A 3ISFA 5ERKA 4ZL6A 4ZMCA 1Z4AA 5JACA 4CYAA 4EVEA 4X0JA 3V3KB 4AM5A 3OGHA 4DYUA 5J93A 5FFBA 3IQ1A 3UOFA 5FFDA 1R03A 3EGMA 3O7RA 2G38B 4RC7A 4PGKA 3A68A 2ZA8A 4RC5B 1KRQA 5J8WA 2VXXA 2XGWA 3PVRB 3QZ3A 2CHIA 3E1NA 2C2FA 3RD0A 2PYBA 1LKPA 2ZA6A 3AF8X 5LG2A 3PW1A 3VVAA 5CMQA 1JREA 3AF9X 4Y08A 2Y3QA 1YUXA 3E2CA 3R2HA 3C1YA 3WVWA 1HRSA 5J8SA 4WJG4 4ML5A 4DI0A 3QHCA 4ETRA 4II4A 3UFBA 1AEWA 1ZS3A 3PVRA 4MUDA 4TW3A 3KXUA 4LQHA 3E1PA 1F33A 5GU0X 1TKPA 2WWXB 3SHXA 2YJKA 4EVDA 2BK6A 3E6SA 2GS4A 3BVIA 1XZ3A 3SE1A 2CHPA 4CY9A 2C2JA 2CN7A 1Z6OA 5HJFA 2V2JA 4XGSA 3PVYB 2YW6A 4MKUA 4MJYA 3F33A 4QUWA 2OC5A 4IXKA 4PG1A 2V2NA 2XJOA 1JKUA 4ZLWA 4LPNA 4W4LB 4ZKHA 3F38A 1VEQA 4TOGA 5IX6A 1RCEA 3HL1A 2G4HA 3R2LA 3R2KA 3PVYA 3F37A 1YUZA 3IS7A 4PGIA 4ISPA 3KA6A 3QHBA 2CN6A 4KXRB 1SOFA 2BW1A 1LKMA 4OYNA 3KA3A 4AM4A 1O9RA 4DZ0A 3BVKA 5GOUA 4CVSA 3AK8A 4E40A 5CZUA 3GGYA 2N02A 4MY7A 5D8PA 2V8TA 2V8UA 2D5KA 2FKZA 1H96A 5JKMG 2IB0A 1DATA 3KDQA 3C21A 4RC7B 1TK6A 4CVPA 3E1QA 4CVRA 2Z90A 4M34A 2CLBA 5D8XA 4LYXA 3NP2X 3Q4RA 3PVTB 4TOHA 4Z5SA 2ZURX 3PW1B 3PZAA 2FG4A 2JD60 3Q4OA 3SIDA 1VEIA 3BVLA 3ISEA 2Z5RA 1S30A 4XKTA 2Y44A 2VZBA 5D8SA 3NP0X 2V2OA 4II4B 2BKCA 3EZ0A 2OKCA 3KX9A 2V2SA 3E1LA 4RC8A 1BFRA 3IS8A 3AJPA 2Z5PA 3PVTA 1RCGA 3UOIA 3Q4QA 5D8RA 4DE6A 1O9IA 2V2MA 3KWOA 3AF7X 5C6FA 4TOCA 2FFXJ 3WNWA 4LQJA 4ZKXA 2V15A 1B71A 4ZJKA 4MXPA 5FFCA 3R2OA 3E1MA 1RCDA 3E1JA 1JGCA 4XKUA 4LYUA 4TOFA 5LS9A 3GHQA 5J9VA 4M32A 3JZ9A 3PWFA 2YW7A 1IESA 5ERJA 4CMYA 1VELA 5HJHA 1MFRA 5K53A 2GYDA 4ISMA 4CMYV 4ERUA 2XKQA 5FFEA 3R2RA 4REUA 3RGDA 5FFAA 3KA9A 2X170 4ITWA 1TKOA 3F32A 2WTLA 4DASA 1L8IA 1QYBA 2JD80 4E6KA 3E1OA 1OTKA 3R2SA 2V2LA 4ITTA 3ES3A 3GGZA 4Z3BA 5JKLA 4RC6B 4ZTTA 3GE4A 4DYYA 3BVFA 2CEIA 4LQNA 3RAVA 3AJQA 3PW8C 3VNXA 1JKVA 1JIGA 3EZUA 1DVBA 2OH3A 1RYTA 5AXSA 3KA8A 3O7SA 3RBCA 3SH6A 3BVEA 1SQ3A 1FHAA 4R42A 3VV9A 3F34A 2UX1A 3F35A 3JZAB 4RC6A 1LB3A 4P18A 2FJCA 2W0OA 4YXJA 3QB9A 4YVZA 2WLAA 2CLUA 3KHKA 4TOBA 4IWKA 5E1UA 2VXIA 5I4JA 1RCCA 2XJMA 2ZG8X 3WVVA 3KA4A 4TOAA 4DYZA 5GN8A 1NF4A 2HTNA 1EUMA 3WVUA 2V2IA 3LKDA 2V2RA 4TODA 4CVTA 4W4KB 1MOJA 3DBYA 3L0MA 4PG0A 2GYQA 5GU2X 1S2ZA 3FRRA 2F7NA 1ZUJA 4YKHA 3FRSA 3C23A 4YXMA 2QQYA 3OJ5A 4A25A 2FG8A 3D19A 2CWLA 4LPMA 1GWGA 5JKMA 5D8QA 1NFVA 1VLGA 1BCFA 4EVBA 3U90A 1JI5A 3A9QA 5CMRA 5LBHA 1IERA 1YV1A 1NNQA 2QF9A 3FI6A 1UMNA 5LG8A 1VJXA 2JD70 3NOZX 5GU3X 3E6RA 5E2DA 3F36A 1JTSA 3UNOA 5JKLG 1JYBA 4TO9A 5FEJA 4RC5A 1N1QA 4ZL5A 5D8OA 3T9JA 5JDOB 2ZA7A 1NF6A 2ZG7X 2CIHA 2FL0A
chains in the Genus database with same CATH topology
2IU2A 5K52A 4LQVA 4IWJA 2FZFA 1UVHA 3Q4NA 2RBDA 1LKOA 1TJOA 4KVSA 4LPJA 2YJJA 4M33A 2WLUA 2Z6MA 5GU1X 3GVYA 1QGHA 3QVDA 3RE7A 2ZG9X 1S3QA 5JDOA 5HU6D 2V2PA 2C2UA 3PW8A 4MN9A 2C6RA 2IY4A 3AK9A 3MPSA 1J30A 2BJYA 3FVBA 1BG7A 5GN8B 3C1ZA 3N6OA 3QD8A 5D8YA 3FSEA 3PWQC 3PWQA 2C41A 3BKNA 4U3GA 2HR5A 3ERZA 1JI4A 2ITBA 3TA8A 2CF7A 3M6JA 4XKSA 4DYXA 2FHAA 2MGYA 4ZKWA 3R2MA 1L8HA 3H7GA 3W54A 1XZ1A 2AR0A 4TOEA 4EVCA 1DPSA 4CYBA 1Z6OM 3AJOA 3BT5A 4AM2A 1F30A 4M35A 4KVQA 3HIUA 4KVRA 2Z5QA 5HQOA 2XJNA 1RCIA 3F39A 3ISFA 5ERKA 4ZL6A 4ZMCA 1Z4AA 5JACA 4CYAA 4EVEA 4X0JA 3V3KB 4AM5A 3OGHA 4DYUA 5J93A 5FFBA 3IQ1A 3UOFA 5FFDA 1R03A 3EGMA 3O7RA 2G38B 4RC7A 4PGKA 3A68A 2ZA8A 4RC5B 1KRQA 5J8WA 2VXXA 2XGWA 3PVRB 3QZ3A 2CHIA 3E1NA 2C2FA 3RD0A 2PYBA 1LKPA 2ZA6A 3AF8X 5LG2A 3PW1A 3VVAA 5CMQA 1JREA 3AF9X 4Y08A 2Y3QA 1YUXA 3E2CA 3R2HA 3C1YA 3WVWA 1HRSA 5J8SA 4WJG4 4ML5A 4DI0A 3QHCA 4ETRA 4II4A 3UFBA 1AEWA 1ZS3A 3PVRA 4MUDA 4TW3A 3KXUA 4LQHA 3E1PA 1F33A 5GU0X 1TKPA 2WWXB 3SHXA 2YJKA 4EVDA 2BK6A 3E6SA 2GS4A 3BVIA 1XZ3A 3SE1A 2CHPA 4CY9A 2C2JA 2CN7A 1Z6OA 5HJFA 2V2JA 4XGSA 3PVYB 2YW6A 4MKUA 4MJYA 3F33A 4QUWA 2OC5A 4IXKA 4PG1A 2V2NA 2XJOA 1JKUA 4ZLWA 4LPNA 4W4LB 4ZKHA 3F38A 1VEQA 4TOGA 5IX6A 1RCEA 3HL1A 2G4HA 3R2LA 3R2KA 3PVYA 3F37A 1YUZA 3IS7A 4PGIA 4ISPA 3KA6A 3QHBA 2CN6A 4KXRB 1SOFA 2BW1A 1LKMA 4OYNA 3KA3A 4AM4A 1O9RA 4DZ0A 3BVKA 5GOUA 4CVSA 3AK8A 4E40A 5CZUA 3GGYA 2N02A 4MY7A 5D8PA 2V8TA 2V8UA 2D5KA 2FKZA 1H96A 5JKMG 2IB0A 1DATA 3KDQA 3C21A 4RC7B 1TK6A 4CVPA 3E1QA 4CVRA 2Z90A 4M34A 2CLBA 5D8XA 4LYXA 3NP2X 3Q4RA 3PVTB 4TOHA 4Z5SA 2ZURX 3PW1B 3PZAA 2FG4A 2JD60 3Q4OA 3SIDA 1VEIA 3BVLA 3ISEA 2Z5RA 1S30A 4XKTA 2Y44A 2VZBA 5D8SA 3NP0X 2V2OA 4II4B 2BKCA 3EZ0A 2OKCA 3KX9A 2V2SA 3E1LA 4RC8A 1BFRA 3IS8A 3AJPA 2Z5PA 3PVTA 1RCGA 3UOIA 3Q4QA 5D8RA 4DE6A 1O9IA 2V2MA 3KWOA 3AF7X 5C6FA 4TOCA 2FFXJ 3WNWA 4LQJA 4ZKXA 2V15A 1B71A 4ZJKA 4MXPA 5FFCA 3R2OA 3E1MA 1RCDA 3E1JA 1JGCA 4XKUA 4LYUA 4TOFA 5LS9A 3GHQA 5J9VA 4M32A 3JZ9A 3PWFA 2YW7A 1IESA 5ERJA 4CMYA 1VELA 5HJHA 1MFRA 5K53A 2GYDA 4ISMA 4CMYV 4ERUA 2XKQA 5FFEA 3R2RA 4REUA 3RGDA 5FFAA 3KA9A 2X170 4ITWA 1TKOA 3F32A 2WTLA 4DASA 1L8IA 1QYBA 2JD80 4E6KA 3E1OA 1OTKA 3R2SA 2V2LA 4ITTA 3ES3A 3GGZA 4Z3BA 5JKLA 4RC6B 4ZTTA 3GE4A 4DYYA 3BVFA 2CEIA 4LQNA 3RAVA 3AJQA 3PW8C 3VNXA 1JKVA 1JIGA 3EZUA 1DVBA 2OH3A 1RYTA 5AXSA 3KA8A 3O7SA 3RBCA 3SH6A 3BVEA 1SQ3A 1FHAA 4R42A 3VV9A 3F34A 2UX1A 3F35A 3JZAB 4RC6A 1LB3A 4P18A 2FJCA 2W0OA 4YXJA 3QB9A 4YVZA 2WLAA 2CLUA 3KHKA 4TOBA 4IWKA 5E1UA 2VXIA 5I4JA 1RCCA 2XJMA 2ZG8X 3WVVA 3KA4A 4TOAA 4DYZA 5GN8A 1NF4A 2HTNA 1EUMA 3WVUA 2V2IA 3LKDA 2V2RA 4TODA 4CVTA 4W4KB 1MOJA 3DBYA 3L0MA 4PG0A 2GYQA 5GU2X 1S2ZA 3FRRA 2F7NA 1ZUJA 4YKHA 3FRSA 3C23A 4YXMA 2QQYA 3OJ5A 4A25A 2FG8A 3D19A 2CWLA 4LPMA 1GWGA 5JKMA 5D8QA 1NFVA 1VLGA 1BCFA 4EVBA 3U90A 1JI5A 3A9QA 5CMRA 5LBHA 1IERA 1YV1A 1NNQA 2QF9A 3FI6A 1UMNA 5LG8A 1VJXA 2JD70 3NOZX 5GU3X 3E6RA 5E2DA 3F36A 1JTSA 3UNOA 5JKLG 1JYBA 4TO9A 5FEJA 4RC5A 1N1QA 4ZL5A 5D8OA 3T9JA 5JDOB 2ZA7A 1NF6A 2ZG7X 2CIHA 2FL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IU2 A;  5K52 A;  4LQV A;  4IWJ A;  2FZF A;  1UVH A;  3Q4N A;  2RBD A;  1LKO A;  1TJO A;  4KVS A;  4LPJ A;  2YJJ A;  4M33 A;  2WLU A;  2Z6M A;  5GU1 X;  3GVY A;  1QGH A;  3QVD A;  3RE7 A;  2ZG9 X;  1S3Q A;  2V2P A;  2C2U A;  3PW8 A;  4MN9 A;  2C6R A;  2IY4 A;  3AK9 A;  3MPS A;  1J30 A;  2BJY A;  3FVB A;  1BG7 A;  5GN8 B;  3QD8 A;  5D8Y A;  3FSE A;  3PWQ C;  3PWQ A;  2C41 A;  3BKN A;  4U3G A;  2HR5 A;  3ERZ A;  1JI4 A;  2ITB A;  3TA8 A;  2CF7 A;  4XKS A;  4DYX A;  2FHA A;  4ZKW A;  3R2M A;  1L8H A;  3H7G A;  1XZ1 A;  4TOE A;  4EVC A;  1DPS A;  4CYB A;  1Z6O M;  3AJO A;  3BT5 A;  4AM2 A;  1F30 A;  4M35 A;  4KVQ A;  3HIU A;  4KVR A;  2Z5Q A;  5HQO A;  2XJN A;  1RCI A;  3F39 A;  3ISF A;  5ERK A;  4ZL6 A;  4ZMC A;  1Z4A A;  5JAC A;  4CYA A;  4EVE A;  4AM5 A;  3OGH A;  4DYU A;  5J93 A;  5FFB A;  3IQ1 A;  3UOF A;  5FFD A;  1R03 A;  3EGM A;  3O7R A;  4RC7 A;  4PGK A;  3A68 A;  2ZA8 A;  4RC5 B;  1KRQ A;  5J8W A;  2VXX A;  2XGW A;  3PVR B;  3QZ3 A;  2CHI A;  3E1N A;  2C2F A;  3RD0 A;  2PYB A;  1LKP A;  2ZA6 A;  3AF8 X;  5LG2 A;  3PW1 A;  5CMQ A;  1JRE A;  3AF9 X;  4Y08 A;  2Y3Q A;  1YUX A;  3E2C A;  3R2H A;  3WVW A;  1HRS A;  5J8S A;  4ML5 A;  4DI0 A;  3QHC A;  4ETR A;  4II4 A;  1AEW A;  1ZS3 A;  3PVR A;  4MUD A;  4TW3 A;  3KXU A;  4LQH A;  3E1P A;  1F33 A;  5GU0 X;  1TKP A;  3SHX A;  2YJK A;  4EVD A;  2BK6 A;  3E6S A;  2GS4 A;  3BVI A;  1XZ3 A;  3SE1 A;  2CHP A;  4CY9 A;  2C2J A;  2CN7 A;  1Z6O A;  5HJF A;  2V2J A;  4XGS A;  3PVY B;  2YW6 A;  4MKU A;  4MJY A;  3F33 A;  4QUW A;  2OC5 A;  4IXK A;  4PG1 A;  2V2N A;  2XJO A;  1JKU A;  4ZLW A;  4LPN A;  4ZKH A;  3F38 A;  1VEQ A;  4TOG A;  5IX6 A;  1RCE A;  3HL1 A;  2G4H A;  3R2L A;  3R2K A;  3PVY A;  3F37 A;  1YUZ A;  3IS7 A;  4PGI A;  4ISP A;  3KA6 A;  3QHB A;  2CN6 A;  1SOF A;  2BW1 A;  1LKM A;  4OYN A;  3KA3 A;  4AM4 A;  1O9R A;  4DZ0 A;  3BVK A;  5GOU A;  4CVS A;  3AK8 A;  5CZU A;  4MY7 A;  5D8P A;  2D5K A;  2FKZ A;  1H96 A;  5JKM G;  2IB0 A;  1DAT A;  4RC7 B;  1TK6 A;  4CVP A;  3E1Q A;  4CVR A;  2Z90 A;  4M34 A;  2CLB A;  5D8X A;  4LYX A;  3NP2 X;  3Q4R A;  3PVT B;  4TOH A;  4Z5S A;  2ZUR X;  3PW1 B;  3PZA A;  2FG4 A;  2JD6 0;  3Q4O A;  3SID A;  1VEI A;  3BVL A;  3ISE A;  2Z5R A;  1S30 A;  4XKT A;  2VZB A;  5D8S A;  3NP0 X;  2V2O A;  4II4 B;  2BKC A;  3EZ0 A;  3KX9 A;  2V2S A;  3E1L A;  4RC8 A;  1BFR A;  3IS8 A;  3AJP A;  2Z5P A;  3PVT A;  1RCG A;  3UOI A;  3Q4Q A;  5D8R A;  4DE6 A;  1O9I A;  2V2M A;  3KWO A;  3AF7 X;  5C6F A;  4TOC A;  2FFX J;  3WNW A;  4LQJ A;  4ZKX A;  2V15 A;  1B71 A;  4ZJK A;  5FFC A;  3R2O A;  3E1M A;  1RCD A;  3E1J A;  1JGC A;  4XKU A;  4LYU A;  4TOF A;  5LS9 A;  3GHQ A;  5J9V A;  4M32 A;  3PWF A;  2YW7 A;  1IES A;  5ERJ A;  4CMY A;  1VEL A;  5HJH A;  1MFR A;  5K53 A;  2GYD A;  4ISM A;  4CMY V;  4ERU A;  2XKQ A;  5FFE A;  3R2R A;  4REU A;  3RGD A;  5FFA A;  3KA9 A;  2X17 0;  4ITW A;  1TKO A;  3F32 A;  2WTL A;  4DAS A;  1L8I A;  1QYB A;  2JD8 0;  4E6K A;  3E1O A;  1OTK A;  3R2S A;  2V2L A;  4ITT A;  3ES3 A;  4Z3B A;  5JKL A;  4RC6 B;  4ZTT A;  3GE4 A;  4DYY A;  3BVF A;  2CEI A;  4LQN A;  3RAV A;  3AJQ A;  3PW8 C;  3VNX A;  1JKV A;  1JIG A;  3EZU A;  1DVB A;  2OH3 A;  1RYT A;  5AXS A;  3KA8 A;  3O7S A;  3RBC A;  3SH6 A;  3BVE A;  1SQ3 A;  1FHA A;  4R42 A;  3F34 A;  2UX1 A;  3F35 A;  4RC6 A;  1LB3 A;  4P18 A;  2FJC A;  2W0O A;  3QB9 A;  2WLA A;  2CLU A;  4TOB A;  4IWK A;  5E1U A;  2VXI A;  5I4J A;  1RCC A;  2XJM A;  2ZG8 X;  3WVV A;  3KA4 A;  4TOA A;  4DYZ A;  5GN8 A;  1NF4 A;  2HTN A;  1EUM A;  3WVU A;  2V2I A;  4TOD A;  2V2R A;  4CVT A;  1MOJ A;  4PG0 A;  2GYQ A;  5GU2 X;  1S2Z A;  2F7N A;  1ZUJ A;  4YKH A;  2QQY A;  3OJ5 A;  4A25 A;  2FG8 A;  4LPM A;  1GWG A;  5JKM A;  5D8Q A;  1NFV A;  1VLG A;  1BCF A;  4EVB A;  3U90 A;  1JI5 A;  3A9Q A;  5CMR A;  5LBH A;  1IER A;  1YV1 A;  1NNQ A;  2QF9 A;  3FI6 A;  1UMN A;  5LG8 A;  1VJX A;  2JD7 0;  3NOZ X;  5GU3 X;  3E6R A;  5E2D A;  3F36 A;  1JTS A;  3UNO A;  5JKL G;  1JYB A;  4TO9 A;  5FEJ A;  4RC5 A;  1N1Q A;  4ZL5 A;  5D8O A;  3T9J A;  2ZA7 A;  1NF6 A;  2ZG7 X;  2CIH A;  2FL0 A; 
#chains in the Genus database with same CATH topology
 2IU2 A;  5K52 A;  4LQV A;  4IWJ A;  2FZF A;  1UVH A;  3Q4N A;  2RBD A;  1LKO A;  1TJO A;  4KVS A;  4LPJ A;  2YJJ A;  4M33 A;  2WLU A;  2Z6M A;  5GU1 X;  3GVY A;  1QGH A;  3QVD A;  3RE7 A;  2ZG9 X;  1S3Q A;  5JDO A;  5HU6 D;  2V2P A;  2C2U A;  3PW8 A;  4MN9 A;  2C6R A;  2IY4 A;  3AK9 A;  3MPS A;  1J30 A;  2BJY A;  3FVB A;  1BG7 A;  5GN8 B;  3C1Z A;  3N6O A;  3QD8 A;  5D8Y A;  3FSE A;  3PWQ C;  3PWQ A;  2C41 A;  3BKN A;  4U3G A;  2HR5 A;  3ERZ A;  1JI4 A;  2ITB A;  3TA8 A;  2CF7 A;  3M6J A;  4XKS A;  4DYX A;  2FHA A;  2MGY A;  4ZKW A;  3R2M A;  1L8H A;  3H7G A;  3W54 A;  1XZ1 A;  2AR0 A;  4TOE A;  4EVC A;  1DPS A;  4CYB A;  1Z6O M;  3AJO A;  3BT5 A;  4AM2 A;  1F30 A;  4M35 A;  4KVQ A;  3HIU A;  4KVR A;  2Z5Q A;  5HQO A;  2XJN A;  1RCI A;  3F39 A;  3ISF A;  5ERK A;  4ZL6 A;  4ZMC A;  1Z4A A;  5JAC A;  4CYA A;  4EVE A;  4X0J A;  3V3K B;  4AM5 A;  3OGH A;  4DYU A;  5J93 A;  5FFB A;  3IQ1 A;  3UOF A;  5FFD A;  1R03 A;  3EGM A;  3O7R A;  2G38 B;  4RC7 A;  4PGK A;  3A68 A;  2ZA8 A;  4RC5 B;  1KRQ A;  5J8W A;  2VXX A;  2XGW A;  3PVR B;  3QZ3 A;  2CHI A;  3E1N A;  2C2F A;  3RD0 A;  2PYB A;  1LKP A;  2ZA6 A;  3AF8 X;  5LG2 A;  3PW1 A;  3VVA A;  5CMQ A;  1JRE A;  3AF9 X;  4Y08 A;  2Y3Q A;  1YUX A;  3E2C A;  3R2H A;  3C1Y A;  3WVW A;  1HRS A;  5J8S A;  4WJG 4;  4ML5 A;  4DI0 A;  3QHC A;  4ETR A;  4II4 A;  3UFB A;  1AEW A;  1ZS3 A;  3PVR A;  4MUD A;  4TW3 A;  3KXU A;  4LQH A;  3E1P A;  1F33 A;  5GU0 X;  1TKP A;  2WWX B;  3SHX A;  2YJK A;  4EVD A;  2BK6 A;  3E6S A;  2GS4 A;  3BVI A;  1XZ3 A;  3SE1 A;  2CHP A;  4CY9 A;  2C2J A;  2CN7 A;  1Z6O A;  5HJF A;  2V2J A;  4XGS A;  3PVY B;  2YW6 A;  4MKU A;  4MJY A;  3F33 A;  4QUW A;  2OC5 A;  4IXK A;  4PG1 A;  2V2N A;  2XJO A;  1JKU A;  4ZLW A;  4LPN A;  4W4L B;  4ZKH A;  3F38 A;  1VEQ A;  4TOG A;  5IX6 A;  1RCE A;  3HL1 A;  2G4H A;  3R2L A;  3R2K A;  3PVY A;  3F37 A;  1YUZ A;  3IS7 A;  4PGI A;  4ISP A;  3KA6 A;  3QHB A;  2CN6 A;  4KXR B;  1SOF A;  2BW1 A;  1LKM A;  4OYN A;  3KA3 A;  4AM4 A;  1O9R A;  4DZ0 A;  3BVK A;  5GOU A;  4CVS A;  3AK8 A;  4E40 A;  5CZU A;  3GGY A;  2N02 A;  4MY7 A;  5D8P A;  2V8T A;  2V8U A;  2D5K A;  2FKZ A;  1H96 A;  5JKM G;  2IB0 A;  1DAT A;  3KDQ A;  3C21 A;  4RC7 B;  1TK6 A;  4CVP A;  3E1Q A;  4CVR A;  2Z90 A;  4M34 A;  2CLB A;  5D8X A;  4LYX A;  3NP2 X;  3Q4R A;  3PVT B;  4TOH A;  4Z5S A;  2ZUR X;  3PW1 B;  3PZA A;  2FG4 A;  2JD6 0;  3Q4O A;  3SID A;  1VEI A;  3BVL A;  3ISE A;  2Z5R A;  1S30 A;  4XKT A;  2Y44 A;  2VZB A;  5D8S A;  3NP0 X;  2V2O A;  4II4 B;  2BKC A;  3EZ0 A;  2OKC A;  3KX9 A;  2V2S A;  3E1L A;  4RC8 A;  1BFR A;  3IS8 A;  3AJP A;  2Z5P A;  3PVT A;  1RCG A;  3UOI A;  3Q4Q A;  5D8R A;  4DE6 A;  1O9I A;  2V2M A;  3KWO A;  3AF7 X;  5C6F A;  4TOC A;  2FFX J;  3WNW A;  4LQJ A;  4ZKX A;  2V15 A;  1B71 A;  4ZJK A;  4MXP A;  5FFC A;  3R2O A;  3E1M A;  1RCD A;  3E1J A;  1JGC A;  4XKU A;  4LYU A;  4TOF A;  5LS9 A;  3GHQ A;  5J9V A;  4M32 A;  3JZ9 A;  3PWF A;  2YW7 A;  1IES A;  5ERJ A;  4CMY A;  1VEL A;  5HJH A;  1MFR A;  5K53 A;  2GYD A;  4ISM A;  4CMY V;  4ERU A;  2XKQ A;  5FFE A;  3R2R A;  4REU A;  3RGD A;  5FFA A;  3KA9 A;  2X17 0;  4ITW A;  1TKO A;  3F32 A;  2WTL A;  4DAS A;  1L8I A;  1QYB A;  2JD8 0;  4E6K A;  3E1O A;  1OTK A;  3R2S A;  2V2L A;  4ITT A;  3ES3 A;  3GGZ A;  4Z3B A;  5JKL A;  4RC6 B;  4ZTT A;  3GE4 A;  4DYY A;  3BVF A;  2CEI A;  4LQN A;  3RAV A;  3AJQ A;  3PW8 C;  3VNX A;  1JKV A;  1JIG A;  3EZU A;  1DVB A;  2OH3 A;  1RYT A;  5AXS A;  3KA8 A;  3O7S A;  3RBC A;  3SH6 A;  3BVE A;  1SQ3 A;  1FHA A;  4R42 A;  3VV9 A;  3F34 A;  2UX1 A;  3F35 A;  3JZA B;  4RC6 A;  1LB3 A;  4P18 A;  2FJC A;  2W0O A;  4YXJ A;  3QB9 A;  4YVZ A;  2WLA A;  2CLU A;  3KHK A;  4TOB A;  4IWK A;  5E1U A;  2VXI A;  5I4J A;  1RCC A;  2XJM A;  2ZG8 X;  3WVV A;  3KA4 A;  4TOA A;  4DYZ A;  5GN8 A;  1NF4 A;  2HTN A;  1EUM A;  3WVU A;  2V2I A;  3LKD A;  2V2R A;  4TOD A;  4CVT A;  4W4K B;  1MOJ A;  3DBY A;  3L0M A;  4PG0 A;  2GYQ A;  5GU2 X;  1S2Z A;  3FRR A;  2F7N A;  1ZUJ A;  4YKH A;  3FRS A;  3C23 A;  4YXM A;  2QQY A;  3OJ5 A;  4A25 A;  2FG8 A;  3D19 A;  2CWL A;  4LPM A;  1GWG A;  5JKM A;  5D8Q A;  1NFV A;  1VLG A;  1BCF A;  4EVB A;  3U90 A;  1JI5 A;  3A9Q A;  5CMR A;  5LBH A;  1IER A;  1YV1 A;  1NNQ A;  2QF9 A;  3FI6 A;  1UMN A;  5LG8 A;  1VJX A;  2JD7 0;  3NOZ X;  5GU3 X;  3E6R A;  5E2D A;  3F36 A;  1JTS A;  3UNO A;  5JKL G;  1JYB A;  4TO9 A;  5FEJ A;  4RC5 A;  1N1Q A;  4ZL5 A;  5D8O A;  3T9J A;  5JDO B;  2ZA7 A;  1NF6 A;  2ZG7 X;  2CIH A;  2FL0 A; 
#chains in the Genus database with same CATH homology
 2IU2 A;  5K52 A;  4LQV A;  4IWJ A;  2FZF A;  1UVH A;  3Q4N A;  2RBD A;  1LKO A;  1TJO A;  4KVS A;  4LPJ A;  2YJJ A;  4M33 A;  2WLU A;  2Z6M A;  5GU1 X;  3GVY A;  1QGH A;  3QVD A;  3RE7 A;  2ZG9 X;  1S3Q A;  5JDO A;  5HU6 D;  2V2P A;  2C2U A;  3PW8 A;  4MN9 A;  2C6R A;  2IY4 A;  3AK9 A;  3MPS A;  1J30 A;  2BJY A;  3FVB A;  1BG7 A;  5GN8 B;  3C1Z A;  3N6O A;  3QD8 A;  5D8Y A;  3FSE A;  3PWQ C;  3PWQ A;  2C41 A;  3BKN A;  4U3G A;  2HR5 A;  3ERZ A;  1JI4 A;  2ITB A;  3TA8 A;  2CF7 A;  3M6J A;  4XKS A;  4DYX A;  2FHA A;  2MGY A;  4ZKW A;  3R2M A;  1L8H A;  3H7G A;  3W54 A;  1XZ1 A;  2AR0 A;  4TOE A;  4EVC A;  1DPS A;  4CYB A;  1Z6O M;  3AJO A;  3BT5 A;  4AM2 A;  1F30 A;  4M35 A;  4KVQ A;  3HIU A;  4KVR A;  2Z5Q A;  5HQO A;  2XJN A;  1RCI A;  3F39 A;  3ISF A;  5ERK A;  4ZL6 A;  4ZMC A;  1Z4A A;  5JAC A;  4CYA A;  4EVE A;  4X0J A;  3V3K B;  4AM5 A;  3OGH A;  4DYU A;  5J93 A;  5FFB A;  3IQ1 A;  3UOF A;  5FFD A;  1R03 A;  3EGM A;  3O7R A;  2G38 B;  4RC7 A;  4PGK A;  3A68 A;  2ZA8 A;  4RC5 B;  1KRQ A;  5J8W A;  2VXX A;  2XGW A;  3PVR B;  3QZ3 A;  2CHI A;  3E1N A;  2C2F A;  3RD0 A;  2PYB A;  1LKP A;  2ZA6 A;  3AF8 X;  5LG2 A;  3PW1 A;  3VVA A;  5CMQ A;  1JRE A;  3AF9 X;  4Y08 A;  2Y3Q A;  1YUX A;  3E2C A;  3R2H A;  3C1Y A;  3WVW A;  1HRS A;  5J8S A;  4WJG 4;  4ML5 A;  4DI0 A;  3QHC A;  4ETR A;  4II4 A;  3UFB A;  1AEW A;  1ZS3 A;  3PVR A;  4MUD A;  4TW3 A;  3KXU A;  4LQH A;  3E1P A;  1F33 A;  5GU0 X;  1TKP A;  2WWX B;  3SHX A;  2YJK A;  4EVD A;  2BK6 A;  3E6S A;  2GS4 A;  3BVI A;  1XZ3 A;  3SE1 A;  2CHP A;  4CY9 A;  2C2J A;  2CN7 A;  1Z6O A;  5HJF A;  2V2J A;  4XGS A;  3PVY B;  2YW6 A;  4MKU A;  4MJY A;  3F33 A;  4QUW A;  2OC5 A;  4IXK A;  4PG1 A;  2V2N A;  2XJO A;  1JKU A;  4ZLW A;  4LPN A;  4W4L B;  4ZKH A;  3F38 A;  1VEQ A;  4TOG A;  5IX6 A;  1RCE A;  3HL1 A;  2G4H A;  3R2L A;  3R2K A;  3PVY A;  3F37 A;  1YUZ A;  3IS7 A;  4PGI A;  4ISP A;  3KA6 A;  3QHB A;  2CN6 A;  4KXR B;  1SOF A;  2BW1 A;  1LKM A;  4OYN A;  3KA3 A;  4AM4 A;  1O9R A;  4DZ0 A;  3BVK A;  5GOU A;  4CVS A;  3AK8 A;  4E40 A;  5CZU A;  3GGY A;  2N02 A;  4MY7 A;  5D8P A;  2V8T A;  2V8U A;  2D5K A;  2FKZ A;  1H96 A;  5JKM G;  2IB0 A;  1DAT A;  3KDQ A;  3C21 A;  4RC7 B;  1TK6 A;  4CVP A;  3E1Q A;  4CVR A;  2Z90 A;  4M34 A;  2CLB A;  5D8X A;  4LYX A;  3NP2 X;  3Q4R A;  3PVT B;  4TOH A;  4Z5S A;  2ZUR X;  3PW1 B;  3PZA A;  2FG4 A;  2JD6 0;  3Q4O A;  3SID A;  1VEI A;  3BVL A;  3ISE A;  2Z5R A;  1S30 A;  4XKT A;  2Y44 A;  2VZB A;  5D8S A;  3NP0 X;  2V2O A;  4II4 B;  2BKC A;  3EZ0 A;  2OKC A;  3KX9 A;  2V2S A;  3E1L A;  4RC8 A;  1BFR A;  3IS8 A;  3AJP A;  2Z5P A;  3PVT A;  1RCG A;  3UOI A;  3Q4Q A;  5D8R A;  4DE6 A;  1O9I A;  2V2M A;  3KWO A;  3AF7 X;  5C6F A;  4TOC A;  2FFX J;  3WNW A;  4LQJ A;  4ZKX A;  2V15 A;  1B71 A;  4ZJK A;  4MXP A;  5FFC A;  3R2O A;  3E1M A;  1RCD A;  3E1J A;  1JGC A;  4XKU A;  4LYU A;  4TOF A;  5LS9 A;  3GHQ A;  5J9V A;  4M32 A;  3JZ9 A;  3PWF A;  2YW7 A;  1IES A;  5ERJ A;  4CMY A;  1VEL A;  5HJH A;  1MFR A;  5K53 A;  2GYD A;  4ISM A;  4CMY V;  4ERU A;  2XKQ A;  5FFE A;  3R2R A;  4REU A;  3RGD A;  5FFA A;  3KA9 A;  2X17 0;  4ITW A;  1TKO A;  3F32 A;  2WTL A;  4DAS A;  1L8I A;  1QYB A;  2JD8 0;  4E6K A;  3E1O A;  1OTK A;  3R2S A;  2V2L A;  4ITT A;  3ES3 A;  3GGZ A;  4Z3B A;  5JKL A;  4RC6 B;  4ZTT A;  3GE4 A;  4DYY A;  3BVF A;  2CEI A;  4LQN A;  3RAV A;  3AJQ A;  3PW8 C;  3VNX A;  1JKV A;  1JIG A;  3EZU A;  1DVB A;  2OH3 A;  1RYT A;  5AXS A;  3KA8 A;  3O7S A;  3RBC A;  3SH6 A;  3BVE A;  1SQ3 A;  1FHA A;  4R42 A;  3VV9 A;  3F34 A;  2UX1 A;  3F35 A;  3JZA B;  4RC6 A;  1LB3 A;  4P18 A;  2FJC A;  2W0O A;  4YXJ A;  3QB9 A;  4YVZ A;  2WLA A;  2CLU A;  3KHK A;  4TOB A;  4IWK A;  5E1U A;  2VXI A;  5I4J A;  1RCC A;  2XJM A;  2ZG8 X;  3WVV A;  3KA4 A;  4TOA A;  4DYZ A;  5GN8 A;  1NF4 A;  2HTN A;  1EUM A;  3WVU A;  2V2I A;  3LKD A;  2V2R A;  4TOD A;  4CVT A;  4W4K B;  1MOJ A;  3DBY A;  3L0M A;  4PG0 A;  2GYQ A;  5GU2 X;  1S2Z A;  3FRR A;  2F7N A;  1ZUJ A;  4YKH A;  3FRS A;  3C23 A;  4YXM A;  2QQY A;  3OJ5 A;  4A25 A;  2FG8 A;  3D19 A;  2CWL A;  4LPM A;  1GWG A;  5JKM A;  5D8Q A;  1NFV A;  1VLG A;  1BCF A;  4EVB A;  3U90 A;  1JI5 A;  3A9Q A;  5CMR A;  5LBH A;  1IER A;  1YV1 A;  1NNQ A;  2QF9 A;  3FI6 A;  1UMN A;  5LG8 A;  1VJX A;  2JD7 0;  3NOZ X;  5GU3 X;  3E6R A;  5E2D A;  3F36 A;  1JTS A;  3UNO A;  5JKL G;  1JYB A;  4TO9 A;  5FEJ A;  4RC5 A;  1N1Q A;  4ZL5 A;  5D8O A;  3T9J A;  5JDO B;  2ZA7 A;  1NF6 A;  2ZG7 X;  2CIH A;  2FL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...