1UVHA

X-ray structure of dps from mycobacterium smegmatis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
TIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGVHEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERDTVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQWFVRAHLESAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords STARVATION-INDUCED DNA PROTECTING PROTEIN
publication title Reassessment of Protein Stability, DNA Binding, and Protection of Mycobacterium Smegmatis Dps.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 57
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1uvhA00
2V2JA 5FFAA 2CEIA 3E1NA 4CYAA 1BFRA 3OJ5A 5JKMG 3E6RA 1NFVA 5HJHA 2ZA6A 3KA4A 2IB0A 3WVUA 2FG8A 4TODA 1O9IA 1ZS3A 3PZAA 4TO9A 3AF9X 1JIGA 4CVRA 5CZUA 4QUWA 5HQOA 4LPJA 5J93A 1Z4AA 5GU1X 4XKUA 3F37A 3R2KA 1UMNA 5GU2X 3RGDA 3KX9A 4E6KA 4XKTA 3PW1B 1ZUJA 1LB3A 4IWJA 2RBDA 3BVLA 4CY9A 1TKOA 3PWQA 4RC6A 4REUA 4II4B 1NF4A 3KWOA 3ES3A 3RD0A 5AXSA 2C2JA 1S3QA 4XKSA 2XKQA 4EVBA 1XZ3A 2CHIA 2YW7A 3E1JA 3OGHA 2ZG7X 3TA8A 5IX6A 5J8SA 4ZKXA 5JKMA 3BKNA 4AM4A 3GE4A 3PVRA 3PWQC 4DE6A 4Y08A 4CYBA 5D8RA 2CLUA 2ITBA 4KVQA 3BT5A 1FHAA 1MOJA 5GOUA 4ZKWA 1JI4A 3UOIA 3PVTA 4YKHA 5LBHA 1AEWA 2GS4A 3PW8C 5ERJA 1Z6OM 1R03A 4CMYA 2FJCA 2V2PA 3PVYA 2C6RA 3O7SA 1JKUA 2IU2A 2WLUA 3IQ1A 5K53A 3ISFA 4EVEA 2CIHA 3R2OA 2XJNA 4IXKA 2V2OA 4ZLWA 2CLBA 3RAVA 3E2CA 3BVEA 5GN8A 3HIUA 4TOGA 1VJXA 3KA6A 4ZKHA 3E1OA 4DYUA 2Z5PA 4ZTTA 2BJYA 3F38A 2BK6A 1NF6A 2C2FA 5C6FA 2FL0A 3IS8A 4ISMA 3UNOA 3QHCA 3R2SA 1EUMA 3F36A 3R2LA 1NNQA 3HL1A 2JD70 3F39A 3PVYB 3AF8X 4TW3A 5CMRA 4DASA 2VXIA 5D8QA 5JACA 4TOFA 3RE7A 1RCGA 1VEQA 3EGMA 1VELA 1S2ZA 4M34A 4DZ0A 2WLAA 1J30A 2C2UA 5HJFA 1RCIA 4ZL6A 2ZG9X 1L8IA 1VLGA 5E2DA 1QYBA 5D8PA 1JI5A 3EZUA 3BVFA 4ZMCA 3MPSA 4M32A 4RC7A 4TOAA 3QHBA 4LQNA 4DI0A 4ITWA 1RYTA 3Q4RA 3KA8A 3NP2X 4PGIA 1LKMA 2FZFA 4DYYA 4AM2A 2CHPA 2V2RA 1JGCA 4EVDA 5I4JA 2JD80 3E1PA 5ERKA 4RC8A 4DYXA 1DATA 2JD60 4IWKA 3ISEA 1LKPA 4TOEA 2V2MA 3E6SA 2YJJA 2UX1A 2CN7A 4MUDA 3R2RA 4AM5A 4ZL5A 2CN6A 4RC6B 3KA3A 3Q4QA 5JKLG 4LQJA 3WVWA 4MKUA 3AK9A 3RBCA 5D8SA 2QF9A 1TKPA 4EVCA 3FI6A 1S30A 1VEIA 5GU3X 2Y3QA 3BVIA 3QVDA 5CMQA 1JREA 3ERZA 2V15A 1JKVA 2QQYA 1RCEA 2HR5A 4ZJKA 1L8HA 1JTSA 5E1UA 5J8WA 4LYXA 1DPSA 1KRQA 1YUXA 3PVRB 1F33A 3T9JA 5K52A 4OYNA 3F34A 2WTLA 4CVTA 4CMYV 1YUZA 3UOFA 1B71A 1BCFA 2V2SA 3E1MA 3PVTB 3PWFA 1XZ1A 2ZA8A 4KVSA 4TOHA 2OC5A 3PW1A 2YW6A 4ML5A 2C41A 3EZ0A 3QD8A 4PG1A 2XGWA 4LQHA 4II4A 2Z5QA 5FEJA 3AF7X 2BW1A 4KVRA 4LPMA 5LG2A 5JKLA 5D8YA 1O9RA 3A9QA 2YJKA 4DYZA 5GN8B 3AJQA 2ZURX 4ETRA 3FVBA 1RCDA 5FFDA 1BG7A 3Q4OA 5FFBA 4LQVA 4PGKA 3AJOA 3GVYA 3O7RA 3NP0X 3U90A 2V2NA 4ITTA 4U3GA 1QGHA 3SIDA 5J9VA 1DVBA 1TJOA 4XGSA 1HRSA 2Z5RA 5FFEA 3R2HA 2CF7A 1GWGA 1TK6A 2ZA7A 3QB9A 2D5KA 3GHQA 1MFRA 2W0OA 3VNXA 5LS9A 4P18A 3Q4NA 5FFCA 3F35A 1H96A 2V2LA 4M33A 3F32A 2BKCA 1JYBA 2PYBA 3H7GA 3PW8A 1OTKA 4RC5A 2VXXA 2HTNA 3SHXA 5GU0X 4LYUA 1Z6OA 4CVSA 3WVVA 2XJOA 4MJYA 3SE1A 2GYDA 4MY7A 2X170 4RC7B 3AJPA 4ISPA 2Z6MA 3NOZX 4M35A 4MN9A 4TOCA 3WNWA 1LKOA 3KA9A 2G4HA 3A68A 3AK8A 1IESA 5D8OA 4Z3BA 4ERUA 3SH6A 2FKZA 5LG8A 1RCCA 4CVPA 4LPNA 2F7NA 3KXUA 3BVKA 2XJMA 2VZBA 1IERA 3R2MA 4PG0A 1UVHA 4RC5B 2Z90A 2ZG8X 2FHAA 3FSEA 4TOBA 2V2IA 3E1QA 2GYQA 3QZ3A 1SQ3A 2FFXJ 3F33A 4A25A 4Z5SA 1N1QA 4R42A 3E1LA 1SOFA 1F30A 3IS7A 5D8XA 2IY4A 2FG4A 2OH3A 1YV1A
chains in the Genus database with same CATH superfamily
2V2JA 5FFAA 2CEIA 3E1NA 4CYAA 1BFRA 3OJ5A 5JKMG 3E6RA 1NFVA 3N6OA 5HJHA 2ZA6A 3KA4A 2IB0A 3WVUA 2FG8A 4TODA 1O9IA 1ZS3A 3PZAA 4TO9A 3AF9X 1JIGA 4CVRA 5CZUA 4QUWA 5HQOA 4LPJA 5J93A 1Z4AA 5GU1X 4XKUA 3F37A 3R2KA 1UMNA 5GU2X 3RGDA 3KX9A 2V8UA 4E6KA 4XKTA 3PW1B 1ZUJA 1LB3A 4IWJA 4W4LB 2RBDA 2AR0A 3BVLA 4CY9A 1TKOA 3PWQA 4RC6A 4REUA 4II4B 1NF4A 3KWOA 3ES3A 3GGZA 3RD0A 5AXSA 2C2JA 1S3QA 4XKSA 2XKQA 4EVBA 1XZ3A 2CHIA 2YW7A 3E1JA 3VVAA 3OGHA 2ZG7X 3TA8A 5IX6A 5J8SA 4ZKXA 5JKMA 2V8TA 3BKNA 3JZ9A 4AM4A 3GE4A 3PVRA 3PWQC 4DE6A 4Y08A 4CYBA 5D8RA 2CLUA 2ITBA 4KVQA 3BT5A 1FHAA 1MOJA 3DBYA 5GOUA 4ZKWA 1JI4A 3UOIA 3PVTA 4YKHA 5LBHA 1AEWA 2GS4A 3PW8C 5ERJA 1Z6OM 1R03A 4CMYA 2FJCA 2V2PA 3PVYA 2C6RA 3O7SA 1JKUA 2IU2A 2WLUA 3IQ1A 5K53A 3ISFA 4EVEA 2CIHA 3R2OA 2XJNA 4IXKA 2V2OA 4ZLWA 2CLBA 3RAVA 3E2CA 3BVEA 5GN8A 3HIUA 4TOGA 1VJXA 3KA6A 4ZKHA 3E1OA 4DYUA 2Z5PA 4ZTTA 2BJYA 3F38A 2BK6A 1NF6A 2C2FA 5C6FA 2FL0A 3IS8A 4ISMA 3UNOA 3QHCA 3R2SA 1EUMA 3F36A 3R2LA 2MGYA 1NNQA 3GGYA 3FRSA 3HL1A 2JD70 3F39A 3PVYB 3AF8X 4TW3A 5CMRA 4DASA 2VXIA 3C1YA 5D8QA 5JACA 4TOFA 3RE7A 2Y44A 1RCGA 1VEQA 3EGMA 1VELA 1S2ZA 4M34A 4DZ0A 2WLAA 1J30A 2C2UA 5JDOA 3KHKA 5HJFA 1RCIA 4X0JA 4YXJA 4ZL6A 2ZG9X 2OKCA 1L8IA 1VLGA 5E2DA 1QYBA 5D8PA 1JI5A 3EZUA 3BVFA 4ZMCA 3MPSA 4M32A 4RC7A 4TOAA 3QHBA 4LQNA 4DI0A 4ITWA 1RYTA 3Q4RA 3KA8A 3NP2X 4PGIA 1LKMA 2FZFA 4DYYA 4AM2A 2CHPA 2V2RA 1JGCA 4EVDA 5I4JA 2JD80 3E1PA 5ERKA 4RC8A 4DYXA 1DATA 2JD60 4IWKA 3ISEA 1LKPA 4TOEA 2V2MA 3E6SA 2YJJA 2UX1A 2CN7A 4MUDA 3R2RA 4AM5A 4ZL5A 2CN6A 4RC6B 3KA3A 4E40A 3Q4QA 5JKLG 4LQJA 3L0MA 3WVWA 4MKUA 3AK9A 3RBCA 5D8SA 2QF9A 1TKPA 4EVCA 3FI6A 1S30A 1VEIA 5GU3X 4W4KB 2Y3QA 3BVIA 3QVDA 5CMQA 1JREA 4WJG4 3VV9A 3ERZA 2V15A 1JKVA 2QQYA 1RCEA 2HR5A 4YVZA 4ZJKA 1L8HA 1JTSA 5E1UA 5J8WA 4LYXA 3UFBA 1DPSA 1KRQA 1YUXA 3PVRB 1F33A 3T9JA 5K52A 4OYNA 3F34A 2WTLA 4CVTA 3M6JA 3JZAB 4CMYV 1YUZA 2N02A 3UOFA 1B71A 3FRRA 2WWXB 1BCFA 2V2SA 3D19A 3E1MA 3PVTB 3PWFA 1XZ1A 2ZA8A 4KVSA 4TOHA 2OC5A 3PW1A 2YW6A 4ML5A 2C41A 3EZ0A 3QD8A 4PG1A 2XGWA 4LQHA 4II4A 2Z5QA 5FEJA 3AF7X 2BW1A 4KVRA 4LPMA 5LG2A 5JKLA 5D8YA 3LKDA 1O9RA 3A9QA 2YJKA 4DYZA 5GN8B 3AJQA 2ZURX 4ETRA 3FVBA 1RCDA 5FFDA 1BG7A 3C23A 3Q4OA 5FFBA 4LQVA 4PGKA 3AJOA 3GVYA 3O7RA 3NP0X 3U90A 4MXPA 2V2NA 4ITTA 4U3GA 1QGHA 3SIDA 5J9VA 1DVBA 1TJOA 4XGSA 1HRSA 2Z5RA 5FFEA 3R2HA 2CF7A 1GWGA 1TK6A 2ZA7A 3QB9A 2D5KA 3GHQA 1MFRA 2W0OA 3VNXA 5LS9A 4P18A 3C21A 3Q4NA 5FFCA 3F35A 2CWLA 1H96A 2V2LA 4M33A 3F32A 2BKCA 1JYBA 2PYBA 3H7GA 4YXMA 3PW8A 1OTKA 5JDOB 4RC5A 2VXXA 2HTNA 3SHXA 5GU0X 4LYUA 1Z6OA 4CVSA 3WVVA 2XJOA 4MJYA 3SE1A 2GYDA 4MY7A 2X170 4RC7B 3AJPA 4ISPA 2Z6MA 3NOZX 4M35A 4MN9A 4TOCA 3WNWA 1LKOA 3KA9A 2G4HA 3A68A 3AK8A 1IESA 5D8OA 3V3KB 4Z3BA 4ERUA 3SH6A 2FKZA 5LG8A 1RCCA 4CVPA 5HU6D 4KXRB 4LPNA 2F7NA 3KXUA 3BVKA 2XJMA 2VZBA 1IERA 3R2MA 4PG0A 1UVHA 4RC5B 2Z90A 2ZG8X 2FHAA 3FSEA 4TOBA 2V2IA 3E1QA 3C1ZA 2G38B 2GYQA 3QZ3A 1SQ3A 2FFXJ 3F33A 4A25A 4Z5SA 3W54A 1N1QA 4R42A 3E1LA 1SOFA 1F30A 3IS7A 3KDQA 5D8XA 2IY4A 2FG4A 2OH3A 1YV1A
chains in the Genus database with same CATH topology
2V2JA 5FFAA 2CEIA 3E1NA 4CYAA 1BFRA 3OJ5A 5JKMG 3E6RA 1NFVA 3N6OA 5HJHA 2ZA6A 3KA4A 2IB0A 3WVUA 2FG8A 4TODA 1O9IA 1ZS3A 3PZAA 4TO9A 3AF9X 1JIGA 4CVRA 5CZUA 4QUWA 5HQOA 4LPJA 5J93A 1Z4AA 5GU1X 4XKUA 3F37A 3R2KA 1UMNA 5GU2X 3RGDA 3KX9A 2V8UA 4E6KA 4XKTA 3PW1B 1ZUJA 1LB3A 4IWJA 4W4LB 2RBDA 2AR0A 3BVLA 4CY9A 1TKOA 3PWQA 4RC6A 4REUA 4II4B 1NF4A 3KWOA 3ES3A 3GGZA 3RD0A 5AXSA 2C2JA 1S3QA 4XKSA 2XKQA 4EVBA 1XZ3A 2CHIA 2YW7A 3E1JA 3VVAA 3OGHA 2ZG7X 3TA8A 5IX6A 5J8SA 4ZKXA 5JKMA 2V8TA 3BKNA 3JZ9A 4AM4A 3GE4A 3PVRA 3PWQC 4DE6A 4Y08A 4CYBA 5D8RA 2CLUA 2ITBA 4KVQA 3BT5A 1FHAA 1MOJA 3DBYA 5GOUA 4ZKWA 1JI4A 3UOIA 3PVTA 4YKHA 5LBHA 1AEWA 2GS4A 3PW8C 5ERJA 1Z6OM 1R03A 4CMYA 2FJCA 2V2PA 3PVYA 2C6RA 3O7SA 1JKUA 2IU2A 2WLUA 3IQ1A 5K53A 3ISFA 4EVEA 2CIHA 3R2OA 2XJNA 4IXKA 2V2OA 4ZLWA 2CLBA 3RAVA 3E2CA 3BVEA 5GN8A 3HIUA 4TOGA 1VJXA 3KA6A 4ZKHA 3E1OA 4DYUA 2Z5PA 4ZTTA 2BJYA 3F38A 2BK6A 1NF6A 2C2FA 5C6FA 2FL0A 3IS8A 4ISMA 3UNOA 3QHCA 3R2SA 1EUMA 3F36A 3R2LA 2MGYA 1NNQA 3GGYA 3FRSA 3HL1A 2JD70 3F39A 3PVYB 3AF8X 4TW3A 5CMRA 4DASA 2VXIA 3C1YA 5D8QA 5JACA 4TOFA 3RE7A 2Y44A 1RCGA 1VEQA 3EGMA 1VELA 1S2ZA 4M34A 4DZ0A 2WLAA 1J30A 2C2UA 5JDOA 3KHKA 5HJFA 1RCIA 4X0JA 4YXJA 4ZL6A 2ZG9X 2OKCA 1L8IA 1VLGA 5E2DA 1QYBA 5D8PA 1JI5A 3EZUA 3BVFA 4ZMCA 3MPSA 4M32A 4RC7A 4TOAA 3QHBA 4LQNA 4DI0A 4ITWA 1RYTA 3Q4RA 3KA8A 3NP2X 4PGIA 1LKMA 2FZFA 4DYYA 4AM2A 2CHPA 2V2RA 1JGCA 4EVDA 5I4JA 2JD80 3E1PA 5ERKA 4RC8A 4DYXA 1DATA 2JD60 4IWKA 3ISEA 1LKPA 4TOEA 2V2MA 3E6SA 2YJJA 2UX1A 2CN7A 4MUDA 3R2RA 4AM5A 4ZL5A 2CN6A 4RC6B 3KA3A 4E40A 3Q4QA 5JKLG 4LQJA 3L0MA 3WVWA 4MKUA 3AK9A 3RBCA 5D8SA 2QF9A 1TKPA 4EVCA 3FI6A 1S30A 1VEIA 5GU3X 4W4KB 2Y3QA 3BVIA 3QVDA 5CMQA 1JREA 4WJG4 3VV9A 3ERZA 2V15A 1JKVA 2QQYA 1RCEA 2HR5A 4YVZA 4ZJKA 1L8HA 1JTSA 5E1UA 5J8WA 4LYXA 3UFBA 1DPSA 1KRQA 1YUXA 3PVRB 1F33A 3T9JA 5K52A 4OYNA 3F34A 2WTLA 4CVTA 3M6JA 3JZAB 4CMYV 1YUZA 2N02A 3UOFA 1B71A 3FRRA 2WWXB 1BCFA 2V2SA 3D19A 3E1MA 3PVTB 3PWFA 1XZ1A 2ZA8A 4KVSA 4TOHA 2OC5A 3PW1A 2YW6A 4ML5A 2C41A 3EZ0A 3QD8A 4PG1A 2XGWA 4LQHA 4II4A 2Z5QA 5FEJA 3AF7X 2BW1A 4KVRA 4LPMA 5LG2A 5JKLA 5D8YA 3LKDA 1O9RA 3A9QA 2YJKA 4DYZA 5GN8B 3AJQA 2ZURX 4ETRA 3FVBA 1RCDA 5FFDA 1BG7A 3C23A 3Q4OA 5FFBA 4LQVA 4PGKA 3AJOA 3GVYA 3O7RA 3NP0X 3U90A 4MXPA 2V2NA 4ITTA 4U3GA 1QGHA 3SIDA 5J9VA 1DVBA 1TJOA 4XGSA 1HRSA 2Z5RA 5FFEA 3R2HA 2CF7A 1GWGA 1TK6A 2ZA7A 3QB9A 2D5KA 3GHQA 1MFRA 2W0OA 3VNXA 5LS9A 4P18A 3C21A 3Q4NA 5FFCA 3F35A 2CWLA 1H96A 2V2LA 4M33A 3F32A 2BKCA 1JYBA 2PYBA 3H7GA 4YXMA 3PW8A 1OTKA 5JDOB 4RC5A 2VXXA 2HTNA 3SHXA 5GU0X 4LYUA 1Z6OA 4CVSA 3WVVA 2XJOA 4MJYA 3SE1A 2GYDA 4MY7A 2X170 4RC7B 3AJPA 4ISPA 2Z6MA 3NOZX 4M35A 4MN9A 4TOCA 3WNWA 1LKOA 3KA9A 2G4HA 3A68A 3AK8A 1IESA 5D8OA 3V3KB 4Z3BA 4ERUA 3SH6A 2FKZA 5LG8A 1RCCA 4CVPA 5HU6D 4KXRB 4LPNA 2F7NA 3KXUA 3BVKA 2XJMA 2VZBA 1IERA 3R2MA 4PG0A 1UVHA 4RC5B 2Z90A 2ZG8X 2FHAA 3FSEA 4TOBA 2V2IA 3E1QA 3C1ZA 2G38B 2GYQA 3QZ3A 1SQ3A 2FFXJ 3F33A 4A25A 4Z5SA 3W54A 1N1QA 4R42A 3E1LA 1SOFA 1F30A 3IS7A 3KDQA 5D8XA 2IY4A 2FG4A 2OH3A 1YV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2J A;  5FFA A;  2CEI A;  3E1N A;  4CYA A;  1BFR A;  3OJ5 A;  5JKM G;  3E6R A;  1NFV A;  5HJH A;  2ZA6 A;  3KA4 A;  2IB0 A;  3WVU A;  2FG8 A;  4TOD A;  1O9I A;  1ZS3 A;  3PZA A;  4TO9 A;  3AF9 X;  1JIG A;  4CVR A;  5CZU A;  4QUW A;  5HQO A;  4LPJ A;  5J93 A;  1Z4A A;  5GU1 X;  4XKU A;  3F37 A;  3R2K A;  1UMN A;  5GU2 X;  3RGD A;  3KX9 A;  4E6K A;  4XKT A;  3PW1 B;  1ZUJ A;  1LB3 A;  4IWJ A;  2RBD A;  3BVL A;  4CY9 A;  1TKO A;  3PWQ A;  4RC6 A;  4REU A;  4II4 B;  1NF4 A;  3KWO A;  3ES3 A;  3RD0 A;  5AXS A;  2C2J A;  1S3Q A;  4XKS A;  2XKQ A;  4EVB A;  1XZ3 A;  2CHI A;  2YW7 A;  3E1J A;  3OGH A;  2ZG7 X;  3TA8 A;  5IX6 A;  5J8S A;  4ZKX A;  5JKM A;  3BKN A;  4AM4 A;  3GE4 A;  3PVR A;  3PWQ C;  4DE6 A;  4Y08 A;  4CYB A;  5D8R A;  2CLU A;  2ITB A;  4KVQ A;  3BT5 A;  1FHA A;  1MOJ A;  5GOU A;  4ZKW A;  1JI4 A;  3UOI A;  3PVT A;  4YKH A;  5LBH A;  1AEW A;  2GS4 A;  3PW8 C;  5ERJ A;  1Z6O M;  1R03 A;  4CMY A;  2FJC A;  2V2P A;  3PVY A;  2C6R A;  3O7S A;  1JKU A;  2IU2 A;  2WLU A;  3IQ1 A;  5K53 A;  3ISF A;  4EVE A;  2CIH A;  3R2O A;  2XJN A;  4IXK A;  2V2O A;  4ZLW A;  2CLB A;  3RAV A;  3E2C A;  3BVE A;  5GN8 A;  3HIU A;  4TOG A;  1VJX A;  3KA6 A;  4ZKH A;  3E1O A;  4DYU A;  2Z5P A;  4ZTT A;  2BJY A;  3F38 A;  2BK6 A;  1NF6 A;  2C2F A;  5C6F A;  2FL0 A;  3IS8 A;  4ISM A;  3UNO A;  3QHC A;  3R2S A;  1EUM A;  3F36 A;  3R2L A;  1NNQ A;  3HL1 A;  2JD7 0;  3F39 A;  3PVY B;  3AF8 X;  4TW3 A;  5CMR A;  4DAS A;  2VXI A;  5D8Q A;  5JAC A;  4TOF A;  3RE7 A;  1RCG A;  1VEQ A;  3EGM A;  1VEL A;  1S2Z A;  4M34 A;  4DZ0 A;  2WLA A;  1J30 A;  2C2U A;  5HJF A;  1RCI A;  4ZL6 A;  2ZG9 X;  1L8I A;  1VLG A;  5E2D A;  1QYB A;  5D8P A;  1JI5 A;  3EZU A;  3BVF A;  4ZMC A;  3MPS A;  4M32 A;  4RC7 A;  4TOA A;  3QHB A;  4LQN A;  4DI0 A;  4ITW A;  1RYT A;  3Q4R A;  3KA8 A;  3NP2 X;  4PGI A;  1LKM A;  2FZF A;  4DYY A;  4AM2 A;  2CHP A;  2V2R A;  1JGC A;  4EVD A;  5I4J A;  2JD8 0;  3E1P A;  5ERK A;  4RC8 A;  4DYX A;  1DAT A;  2JD6 0;  4IWK A;  3ISE A;  1LKP A;  4TOE A;  2V2M A;  3E6S A;  2YJJ A;  2UX1 A;  2CN7 A;  4MUD A;  3R2R A;  4AM5 A;  4ZL5 A;  2CN6 A;  4RC6 B;  3KA3 A;  3Q4Q A;  5JKL G;  4LQJ A;  3WVW A;  4MKU A;  3AK9 A;  3RBC A;  5D8S A;  2QF9 A;  1TKP A;  4EVC A;  3FI6 A;  1S30 A;  1VEI A;  5GU3 X;  2Y3Q A;  3BVI A;  3QVD A;  5CMQ A;  1JRE A;  3ERZ A;  2V15 A;  1JKV A;  2QQY A;  1RCE A;  2HR5 A;  4ZJK A;  1L8H A;  1JTS A;  5E1U A;  5J8W A;  4LYX A;  1DPS A;  1KRQ A;  1YUX A;  3PVR B;  1F33 A;  3T9J A;  5K52 A;  4OYN A;  3F34 A;  2WTL A;  4CVT A;  4CMY V;  1YUZ A;  3UOF A;  1B71 A;  1BCF A;  2V2S A;  3E1M A;  3PVT B;  3PWF A;  1XZ1 A;  2ZA8 A;  4KVS A;  4TOH A;  2OC5 A;  3PW1 A;  2YW6 A;  4ML5 A;  2C41 A;  3EZ0 A;  3QD8 A;  4PG1 A;  2XGW A;  4LQH A;  4II4 A;  2Z5Q A;  5FEJ A;  3AF7 X;  2BW1 A;  4KVR A;  4LPM A;  5LG2 A;  5JKL A;  5D8Y A;  1O9R A;  3A9Q A;  2YJK A;  4DYZ A;  5GN8 B;  3AJQ A;  2ZUR X;  4ETR A;  3FVB A;  1RCD A;  5FFD A;  1BG7 A;  3Q4O A;  5FFB A;  4LQV A;  4PGK A;  3AJO A;  3GVY A;  3O7R A;  3NP0 X;  3U90 A;  2V2N A;  4ITT A;  4U3G A;  1QGH A;  3SID A;  5J9V A;  1DVB A;  1TJO A;  4XGS A;  1HRS A;  2Z5R A;  5FFE A;  3R2H A;  2CF7 A;  1GWG A;  1TK6 A;  2ZA7 A;  3QB9 A;  2D5K A;  3GHQ A;  1MFR A;  2W0O A;  3VNX A;  5LS9 A;  4P18 A;  3Q4N A;  5FFC A;  3F35 A;  1H96 A;  2V2L A;  4M33 A;  3F32 A;  2BKC A;  1JYB A;  2PYB A;  3H7G A;  3PW8 A;  1OTK A;  4RC5 A;  2VXX A;  2HTN A;  3SHX A;  5GU0 X;  4LYU A;  1Z6O A;  4CVS A;  3WVV A;  2XJO A;  4MJY A;  3SE1 A;  2GYD A;  4MY7 A;  2X17 0;  4RC7 B;  3AJP A;  4ISP A;  2Z6M A;  3NOZ X;  4M35 A;  4MN9 A;  4TOC A;  3WNW A;  1LKO A;  3KA9 A;  2G4H A;  3A68 A;  3AK8 A;  1IES A;  5D8O A;  4Z3B A;  4ERU A;  3SH6 A;  2FKZ A;  5LG8 A;  1RCC A;  4CVP A;  4LPN A;  2F7N A;  3KXU A;  3BVK A;  2XJM A;  2VZB A;  1IER A;  3R2M A;  4PG0 A;  1UVH A;  4RC5 B;  2Z90 A;  2ZG8 X;  2FHA A;  3FSE A;  4TOB A;  2V2I A;  3E1Q A;  2GYQ A;  3QZ3 A;  1SQ3 A;  2FFX J;  3F33 A;  4A25 A;  4Z5S A;  1N1Q A;  4R42 A;  3E1L A;  1SOF A;  1F30 A;  3IS7 A;  5D8X A;  2IY4 A;  2FG4 A;  2OH3 A;  1YV1 A; 
#chains in the Genus database with same CATH topology
 2V2J A;  5FFA A;  2CEI A;  3E1N A;  4CYA A;  1BFR A;  3OJ5 A;  5JKM G;  3E6R A;  1NFV A;  3N6O A;  5HJH A;  2ZA6 A;  3KA4 A;  2IB0 A;  3WVU A;  2FG8 A;  4TOD A;  1O9I A;  1ZS3 A;  3PZA A;  4TO9 A;  3AF9 X;  1JIG A;  4CVR A;  5CZU A;  4QUW A;  5HQO A;  4LPJ A;  5J93 A;  1Z4A A;  5GU1 X;  4XKU A;  3F37 A;  3R2K A;  1UMN A;  5GU2 X;  3RGD A;  3KX9 A;  2V8U A;  4E6K A;  4XKT A;  3PW1 B;  1ZUJ A;  1LB3 A;  4IWJ A;  4W4L B;  2RBD A;  2AR0 A;  3BVL A;  4CY9 A;  1TKO A;  3PWQ A;  4RC6 A;  4REU A;  4II4 B;  1NF4 A;  3KWO A;  3ES3 A;  3GGZ A;  3RD0 A;  5AXS A;  2C2J A;  1S3Q A;  4XKS A;  2XKQ A;  4EVB A;  1XZ3 A;  2CHI A;  2YW7 A;  3E1J A;  3VVA A;  3OGH A;  2ZG7 X;  3TA8 A;  5IX6 A;  5J8S A;  4ZKX A;  5JKM A;  2V8T A;  3BKN A;  3JZ9 A;  4AM4 A;  3GE4 A;  3PVR A;  3PWQ C;  4DE6 A;  4Y08 A;  4CYB A;  5D8R A;  2CLU A;  2ITB A;  4KVQ A;  3BT5 A;  1FHA A;  1MOJ A;  3DBY A;  5GOU A;  4ZKW A;  1JI4 A;  3UOI A;  3PVT A;  4YKH A;  5LBH A;  1AEW A;  2GS4 A;  3PW8 C;  5ERJ A;  1Z6O M;  1R03 A;  4CMY A;  2FJC A;  2V2P A;  3PVY A;  2C6R A;  3O7S A;  1JKU A;  2IU2 A;  2WLU A;  3IQ1 A;  5K53 A;  3ISF A;  4EVE A;  2CIH A;  3R2O A;  2XJN A;  4IXK A;  2V2O A;  4ZLW A;  2CLB A;  3RAV A;  3E2C A;  3BVE A;  5GN8 A;  3HIU A;  4TOG A;  1VJX A;  3KA6 A;  4ZKH A;  3E1O A;  4DYU A;  2Z5P A;  4ZTT A;  2BJY A;  3F38 A;  2BK6 A;  1NF6 A;  2C2F A;  5C6F A;  2FL0 A;  3IS8 A;  4ISM A;  3UNO A;  3QHC A;  3R2S A;  1EUM A;  3F36 A;  3R2L A;  2MGY A;  1NNQ A;  3GGY A;  3FRS A;  3HL1 A;  2JD7 0;  3F39 A;  3PVY B;  3AF8 X;  4TW3 A;  5CMR A;  4DAS A;  2VXI A;  3C1Y A;  5D8Q A;  5JAC A;  4TOF A;  3RE7 A;  2Y44 A;  1RCG A;  1VEQ A;  3EGM A;  1VEL A;  1S2Z A;  4M34 A;  4DZ0 A;  2WLA A;  1J30 A;  2C2U A;  5JDO A;  3KHK A;  5HJF A;  1RCI A;  4X0J A;  4YXJ A;  4ZL6 A;  2ZG9 X;  2OKC A;  1L8I A;  1VLG A;  5E2D A;  1QYB A;  5D8P A;  1JI5 A;  3EZU A;  3BVF A;  4ZMC A;  3MPS A;  4M32 A;  4RC7 A;  4TOA A;  3QHB A;  4LQN A;  4DI0 A;  4ITW A;  1RYT A;  3Q4R A;  3KA8 A;  3NP2 X;  4PGI A;  1LKM A;  2FZF A;  4DYY A;  4AM2 A;  2CHP A;  2V2R A;  1JGC A;  4EVD A;  5I4J A;  2JD8 0;  3E1P A;  5ERK A;  4RC8 A;  4DYX A;  1DAT A;  2JD6 0;  4IWK A;  3ISE A;  1LKP A;  4TOE A;  2V2M A;  3E6S A;  2YJJ A;  2UX1 A;  2CN7 A;  4MUD A;  3R2R A;  4AM5 A;  4ZL5 A;  2CN6 A;  4RC6 B;  3KA3 A;  4E40 A;  3Q4Q A;  5JKL G;  4LQJ A;  3L0M A;  3WVW A;  4MKU A;  3AK9 A;  3RBC A;  5D8S A;  2QF9 A;  1TKP A;  4EVC A;  3FI6 A;  1S30 A;  1VEI A;  5GU3 X;  4W4K B;  2Y3Q A;  3BVI A;  3QVD A;  5CMQ A;  1JRE A;  4WJG 4;  3VV9 A;  3ERZ A;  2V15 A;  1JKV A;  2QQY A;  1RCE A;  2HR5 A;  4YVZ A;  4ZJK A;  1L8H A;  1JTS A;  5E1U A;  5J8W A;  4LYX A;  3UFB A;  1DPS A;  1KRQ A;  1YUX A;  3PVR B;  1F33 A;  3T9J A;  5K52 A;  4OYN A;  3F34 A;  2WTL A;  4CVT A;  3M6J A;  3JZA B;  4CMY V;  1YUZ A;  2N02 A;  3UOF A;  1B71 A;  3FRR A;  2WWX B;  1BCF A;  2V2S A;  3D19 A;  3E1M A;  3PVT B;  3PWF A;  1XZ1 A;  2ZA8 A;  4KVS A;  4TOH A;  2OC5 A;  3PW1 A;  2YW6 A;  4ML5 A;  2C41 A;  3EZ0 A;  3QD8 A;  4PG1 A;  2XGW A;  4LQH A;  4II4 A;  2Z5Q A;  5FEJ A;  3AF7 X;  2BW1 A;  4KVR A;  4LPM A;  5LG2 A;  5JKL A;  5D8Y A;  3LKD A;  1O9R A;  3A9Q A;  2YJK A;  4DYZ A;  5GN8 B;  3AJQ A;  2ZUR X;  4ETR A;  3FVB A;  1RCD A;  5FFD A;  1BG7 A;  3C23 A;  3Q4O A;  5FFB A;  4LQV A;  4PGK A;  3AJO A;  3GVY A;  3O7R A;  3NP0 X;  3U90 A;  4MXP A;  2V2N A;  4ITT A;  4U3G A;  1QGH A;  3SID A;  5J9V A;  1DVB A;  1TJO A;  4XGS A;  1HRS A;  2Z5R A;  5FFE A;  3R2H A;  2CF7 A;  1GWG A;  1TK6 A;  2ZA7 A;  3QB9 A;  2D5K A;  3GHQ A;  1MFR A;  2W0O A;  3VNX A;  5LS9 A;  4P18 A;  3C21 A;  3Q4N A;  5FFC A;  3F35 A;  2CWL A;  1H96 A;  2V2L A;  4M33 A;  3F32 A;  2BKC A;  1JYB A;  2PYB A;  3H7G A;  4YXM A;  3PW8 A;  1OTK A;  5JDO B;  4RC5 A;  2VXX A;  2HTN A;  3SHX A;  5GU0 X;  4LYU A;  1Z6O A;  4CVS A;  3WVV A;  2XJO A;  4MJY A;  3SE1 A;  2GYD A;  4MY7 A;  2X17 0;  4RC7 B;  3AJP A;  4ISP A;  2Z6M A;  3NOZ X;  4M35 A;  4MN9 A;  4TOC A;  3WNW A;  1LKO A;  3KA9 A;  2G4H A;  3A68 A;  3AK8 A;  1IES A;  5D8O A;  3V3K B;  4Z3B A;  4ERU A;  3SH6 A;  2FKZ A;  5LG8 A;  1RCC A;  4CVP A;  5HU6 D;  4KXR B;  4LPN A;  2F7N A;  3KXU A;  3BVK A;  2XJM A;  2VZB A;  1IER A;  3R2M A;  4PG0 A;  1UVH A;  4RC5 B;  2Z90 A;  2ZG8 X;  2FHA A;  3FSE A;  4TOB A;  2V2I A;  3E1Q A;  3C1Z A;  2G38 B;  2GYQ A;  3QZ3 A;  1SQ3 A;  2FFX J;  3F33 A;  4A25 A;  4Z5S A;  3W54 A;  1N1Q A;  4R42 A;  3E1L A;  1SOF A;  1F30 A;  3IS7 A;  3KDQ A;  5D8X A;  2IY4 A;  2FG4 A;  2OH3 A;  1YV1 A; 
#chains in the Genus database with same CATH homology
 2V2J A;  5FFA A;  2CEI A;  3E1N A;  4CYA A;  1BFR A;  3OJ5 A;  5JKM G;  3E6R A;  1NFV A;  3N6O A;  5HJH A;  2ZA6 A;  3KA4 A;  2IB0 A;  3WVU A;  2FG8 A;  4TOD A;  1O9I A;  1ZS3 A;  3PZA A;  4TO9 A;  3AF9 X;  1JIG A;  4CVR A;  5CZU A;  4QUW A;  5HQO A;  4LPJ A;  5J93 A;  1Z4A A;  5GU1 X;  4XKU A;  3F37 A;  3R2K A;  1UMN A;  5GU2 X;  3RGD A;  3KX9 A;  2V8U A;  4E6K A;  4XKT A;  3PW1 B;  1ZUJ A;  1LB3 A;  4IWJ A;  4W4L B;  2RBD A;  2AR0 A;  3BVL A;  4CY9 A;  1TKO A;  3PWQ A;  4RC6 A;  4REU A;  4II4 B;  1NF4 A;  3KWO A;  3ES3 A;  3GGZ A;  3RD0 A;  5AXS A;  2C2J A;  1S3Q A;  4XKS A;  2XKQ A;  4EVB A;  1XZ3 A;  2CHI A;  2YW7 A;  3E1J A;  3VVA A;  3OGH A;  2ZG7 X;  3TA8 A;  5IX6 A;  5J8S A;  4ZKX A;  5JKM A;  2V8T A;  3BKN A;  3JZ9 A;  4AM4 A;  3GE4 A;  3PVR A;  3PWQ C;  4DE6 A;  4Y08 A;  4CYB A;  5D8R A;  2CLU A;  2ITB A;  4KVQ A;  3BT5 A;  1FHA A;  1MOJ A;  3DBY A;  5GOU A;  4ZKW A;  1JI4 A;  3UOI A;  3PVT A;  4YKH A;  5LBH A;  1AEW A;  2GS4 A;  3PW8 C;  5ERJ A;  1Z6O M;  1R03 A;  4CMY A;  2FJC A;  2V2P A;  3PVY A;  2C6R A;  3O7S A;  1JKU A;  2IU2 A;  2WLU A;  3IQ1 A;  5K53 A;  3ISF A;  4EVE A;  2CIH A;  3R2O A;  2XJN A;  4IXK A;  2V2O A;  4ZLW A;  2CLB A;  3RAV A;  3E2C A;  3BVE A;  5GN8 A;  3HIU A;  4TOG A;  1VJX A;  3KA6 A;  4ZKH A;  3E1O A;  4DYU A;  2Z5P A;  4ZTT A;  2BJY A;  3F38 A;  2BK6 A;  1NF6 A;  2C2F A;  5C6F A;  2FL0 A;  3IS8 A;  4ISM A;  3UNO A;  3QHC A;  3R2S A;  1EUM A;  3F36 A;  3R2L A;  2MGY A;  1NNQ A;  3GGY A;  3FRS A;  3HL1 A;  2JD7 0;  3F39 A;  3PVY B;  3AF8 X;  4TW3 A;  5CMR A;  4DAS A;  2VXI A;  3C1Y A;  5D8Q A;  5JAC A;  4TOF A;  3RE7 A;  2Y44 A;  1RCG A;  1VEQ A;  3EGM A;  1VEL A;  1S2Z A;  4M34 A;  4DZ0 A;  2WLA A;  1J30 A;  2C2U A;  5JDO A;  3KHK A;  5HJF A;  1RCI A;  4X0J A;  4YXJ A;  4ZL6 A;  2ZG9 X;  2OKC A;  1L8I A;  1VLG A;  5E2D A;  1QYB A;  5D8P A;  1JI5 A;  3EZU A;  3BVF A;  4ZMC A;  3MPS A;  4M32 A;  4RC7 A;  4TOA A;  3QHB A;  4LQN A;  4DI0 A;  4ITW A;  1RYT A;  3Q4R A;  3KA8 A;  3NP2 X;  4PGI A;  1LKM A;  2FZF A;  4DYY A;  4AM2 A;  2CHP A;  2V2R A;  1JGC A;  4EVD A;  5I4J A;  2JD8 0;  3E1P A;  5ERK A;  4RC8 A;  4DYX A;  1DAT A;  2JD6 0;  4IWK A;  3ISE A;  1LKP A;  4TOE A;  2V2M A;  3E6S A;  2YJJ A;  2UX1 A;  2CN7 A;  4MUD A;  3R2R A;  4AM5 A;  4ZL5 A;  2CN6 A;  4RC6 B;  3KA3 A;  4E40 A;  3Q4Q A;  5JKL G;  4LQJ A;  3L0M A;  3WVW A;  4MKU A;  3AK9 A;  3RBC A;  5D8S A;  2QF9 A;  1TKP A;  4EVC A;  3FI6 A;  1S30 A;  1VEI A;  5GU3 X;  4W4K B;  2Y3Q A;  3BVI A;  3QVD A;  5CMQ A;  1JRE A;  4WJG 4;  3VV9 A;  3ERZ A;  2V15 A;  1JKV A;  2QQY A;  1RCE A;  2HR5 A;  4YVZ A;  4ZJK A;  1L8H A;  1JTS A;  5E1U A;  5J8W A;  4LYX A;  3UFB A;  1DPS A;  1KRQ A;  1YUX A;  3PVR B;  1F33 A;  3T9J A;  5K52 A;  4OYN A;  3F34 A;  2WTL A;  4CVT A;  3M6J A;  3JZA B;  4CMY V;  1YUZ A;  2N02 A;  3UOF A;  1B71 A;  3FRR A;  2WWX B;  1BCF A;  2V2S A;  3D19 A;  3E1M A;  3PVT B;  3PWF A;  1XZ1 A;  2ZA8 A;  4KVS A;  4TOH A;  2OC5 A;  3PW1 A;  2YW6 A;  4ML5 A;  2C41 A;  3EZ0 A;  3QD8 A;  4PG1 A;  2XGW A;  4LQH A;  4II4 A;  2Z5Q A;  5FEJ A;  3AF7 X;  2BW1 A;  4KVR A;  4LPM A;  5LG2 A;  5JKL A;  5D8Y A;  3LKD A;  1O9R A;  3A9Q A;  2YJK A;  4DYZ A;  5GN8 B;  3AJQ A;  2ZUR X;  4ETR A;  3FVB A;  1RCD A;  5FFD A;  1BG7 A;  3C23 A;  3Q4O A;  5FFB A;  4LQV A;  4PGK A;  3AJO A;  3GVY A;  3O7R A;  3NP0 X;  3U90 A;  4MXP A;  2V2N A;  4ITT A;  4U3G A;  1QGH A;  3SID A;  5J9V A;  1DVB A;  1TJO A;  4XGS A;  1HRS A;  2Z5R A;  5FFE A;  3R2H A;  2CF7 A;  1GWG A;  1TK6 A;  2ZA7 A;  3QB9 A;  2D5K A;  3GHQ A;  1MFR A;  2W0O A;  3VNX A;  5LS9 A;  4P18 A;  3C21 A;  3Q4N A;  5FFC A;  3F35 A;  2CWL A;  1H96 A;  2V2L A;  4M33 A;  3F32 A;  2BKC A;  1JYB A;  2PYB A;  3H7G A;  4YXM A;  3PW8 A;  1OTK A;  5JDO B;  4RC5 A;  2VXX A;  2HTN A;  3SHX A;  5GU0 X;  4LYU A;  1Z6O A;  4CVS A;  3WVV A;  2XJO A;  4MJY A;  3SE1 A;  2GYD A;  4MY7 A;  2X17 0;  4RC7 B;  3AJP A;  4ISP A;  2Z6M A;  3NOZ X;  4M35 A;  4MN9 A;  4TOC A;  3WNW A;  1LKO A;  3KA9 A;  2G4H A;  3A68 A;  3AK8 A;  1IES A;  5D8O A;  3V3K B;  4Z3B A;  4ERU A;  3SH6 A;  2FKZ A;  5LG8 A;  1RCC A;  4CVP A;  5HU6 D;  4KXR B;  4LPN A;  2F7N A;  3KXU A;  3BVK A;  2XJM A;  2VZB A;  1IER A;  3R2M A;  4PG0 A;  1UVH A;  4RC5 B;  2Z90 A;  2ZG8 X;  2FHA A;  3FSE A;  4TOB A;  2V2I A;  3E1Q A;  3C1Z A;  2G38 B;  2GYQ A;  3QZ3 A;  1SQ3 A;  2FFX J;  3F33 A;  4A25 A;  4Z5S A;  3W54 A;  1N1Q A;  4R42 A;  3E1L A;  1SOF A;  1F30 A;  3IS7 A;  3KDQ A;  5D8X A;  2IY4 A;  2FG4 A;  2OH3 A;  1YV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...