3OGHA

Crystal structure of ycie protein from e. coli cft073, a member of ferritine-like superfamily of diiron-containing four-helix-bundle proteins
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
163
structure length
145
Chain Sequence
AMNRIEHYHDWLRDAHAMEKQAESMLESMASRIDNYPELRARIEQHLSETKNQIVQLETILDRNDISRSVIKDSEIVKGSISGYVFEQFEIACYTSLLAAAKNAGDTASIPTIEAILNEEKHMADWLIQHIPQTTEKFLIRSETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein yciE
publication title Crystal structure of yciE protein from E. coli CFT073, a member of ferritine-like superfamily of diiron-containing four-helix-bundle proteins
rcsb
source organism Escherichia coli o6
total genus 60
structure length 145
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05974 DUF892 Domain of unknown function (DUF892)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3oghA00
5J93A 3BVKA 1S2ZA 5C6FA 4OYNA 3E1LA 1JGCA 4CY9A 1KRQA 3BVIA 3F32A 2GYDA 1SQ3A 4RC7A 2V2JA 3RAVA 3UNOA 2Z5PA 3PW1B 2WLAA 2V2MA 3A9QA 2CLBA 5D8QA 1NF6A 3AJOA 3FSEA 3GE4A 3EZUA 4M35A 5GOUA 4CMYV 2FHAA 1Z6OM 5JACA 3KA4A 4DYZA 2Z90A 1SOFA 1YUXA 1ZS3A 2OH3A 4XKTA 4RC6A 2FG4A 2ITBA 5D8SA 1MFRA 5FFEA 1N1QA 1Z6OA 2WLUA 1RCGA 1L8IA 5GU2X 1GWGA 5GU1X 1S30A 2Z5RA 5K53A 5FFDA 2GYQA 3PWQC 4ITWA 3AF7X 4II4A 3SIDA 5E2DA 3A68A 4ISPA 1DPSA 1XZ1A 4MN9A 3FVBA 4DE6A 1JREA 3E1NA 4E6KA 1UVHA 3R2SA 1QYBA 5CMRA 3QHCA 2ZG7X 2IB0A 1BFRA 3PVRA 5GU3X 4PGKA 4EVDA 1DATA 2ZA7A 2OC5A 2ZURX 3Q4QA 3ISFA 4MY7A 4CMYA 3NP2X 2QF9A 5FFAA 2C2JA 4M34A 4AM2A 3HL1A 2V2OA 4II4B 4M32A 5J9VA 2Y3QA 1LKOA 3R2LA 1B71A 2V2NA 3SE1A 1Z4AA 5D8OA 3E6RA 3ES3A 1YV1A 4TOCA 3KA9A 4DI0A 5CZUA 5AXSA 2VXXA 3E6SA 1O9RA 2ZA6A 3PW8A 5IX6A 2FFXJ 1JTSA 4TOBA 2CIHA 2FG8A 3BT5A 4TW3A 5LG2A 1RYTA 2VXIA 3EGMA 4REUA 4LPNA 3KA6A 3E1JA 3U90A 1TKPA 5FEJA 1J30A 4TO9A 3TA8A 2ZG9X 4CVRA 4MKUA 4ERUA 1JI5A 2CLUA 3PVTB 4LPJA 1NNQA 2V2RA 5LBHA 1H96A 3PWFA 3OGHA 5I4JA 2G4HA 3AF8X 2XJMA 2Z5QA 4ZMCA 3RE7A 4CYBA 2YW6A 1EUMA 5CMQA 5LG8A 2FL0A 3Q4NA 4RC5A 1O9IA 3UOIA 3QZ3A 3KX9A 5JKMG 3ERZA 2IY4A 2Z6MA 4MUDA 4YKHA 3IQ1A 3R2OA 2XGWA 3SH6A 4CVTA 4ZKXA 1ZUJA 4AM4A 3QHBA 4IWJA 4LYUA 4DYXA 4XKUA 2CN6A 2HTNA 2CF7A 2VZBA 4ISMA 5ERJA 5GU0X 4ETRA 2FZFA 4RC8A 1JKVA 3R2MA 2YW7A 4TOFA 3PZAA 4RC5B 1S3QA 3T9JA 3R2KA 2GS4A 3HIUA 2FJCA 3GVYA 1HRSA 3KWOA 5K52A 3H7GA 3AK9A 3BVFA 5D8PA 3PWQA 3R2RA 1LKMA 3PVYB 3BVLA 2CEIA 4CVSA 3BKNA 4MJYA 3UOFA 4QUWA 4ZJKA 4IWKA 1TJOA 2W0OA 3IS8A 2CHPA 2JD60 4Z3BA 4KVQA 5FFCA 2PYBA 4DZ0A 2XJNA 3PVTA 2JD80 1R03A 4PGIA 2RBDA 4DASA 3F34A 2D5KA 1YUZA 2V15A 3E1MA 3E1QA 4Z5SA 3WNWA 3RGDA 1RCDA 2IU2A 1OTKA 3NP0X 4LYXA 4DYYA 4LQJA 4ZKWA 1RCEA 3QVDA 2BKCA 1TKOA 4TODA 2ZA8A 4KVSA 4KVRA 3R2HA 4ZL6A 1FHAA 2C6RA 1RCIA 4LPMA 3WVWA 3VNXA 3Q4RA 4A25A 3E2CA 2X170 4TOGA 5ERKA 4ZKHA 3IS7A 3QB9A 3KXUA 2V2IA 2YJKA 3E1PA 4R42A 5D8RA 1RCCA 3AK8A 4ZTTA 1BCFA 3F38A 5LS9A 1JI4A 2BK6A 2FKZA 3F35A 3Q4OA 5GN8B 1JIGA 2XKQA 4ZL5A 1VEQA 3SHXA 2WTLA 4EVEA 4XGSA 1NFVA 4Y08A 3PVYA 2CN7A 3EZ0A 1AEWA 1XZ3A 5J8SA 2JD70 3RD0A 5FFBA 2QQYA 3ISEA 4RC7B 1IERA 4DYUA 3AF9X 5JKMA 4EVBA 1UMNA 4TOHA 2C41A 3OJ5A 3FI6A 2BJYA 2C2FA 2CHIA 4PG0A 4TOEA 3QD8A 5HQOA 4M33A 3WVVA 1JYBA 1BG7A 3KA8A 4LQHA 3E1OA 4TOAA 5E1UA 4IXKA 1VEIA 1F30A 4LQVA 1VELA 4RC6B 1TK6A 3MPSA 5D8XA 5J8WA 2XJOA 4LQNA 2ZG8X 4CVPA 2YJJA 1IESA 3AJQA 5HJHA 1MOJA 4ZLWA 3KA3A 1NF4A 1DVBA 3NOZX 3PW8C 3WVUA 4CYAA 3RBCA 3BVEA 2F7NA 4PG1A 5JKLG 2C2UA 1L8HA 1QGHA 3F36A 2V2LA 5HJFA 1LB3A 3F33A 3O7RA 3O7SA 4ML5A 2UX1A 3PVRB 5D8YA 4U3GA 3PW1A 1F33A 2V2SA 4AM5A 1VJXA 3GHQA 3F37A 5JKLA 1VLGA 1LKPA 5GN8A 1JKUA 4ITTA 2BW1A 4EVCA 3AJPA 4XKSA 2HR5A 2V2PA 3F39A 4P18A
chains in the Genus database with same CATH superfamily
5J93A 3BVKA 1S2ZA 5C6FA 4OYNA 3E1LA 1JGCA 4CY9A 1KRQA 3BVIA 3F32A 2GYDA 1SQ3A 4RC7A 2V2JA 3RAVA 3UNOA 2Z5PA 3PW1B 2WLAA 2V2MA 3A9QA 2CLBA 5D8QA 1NF6A 4E40A 3AJOA 3FSEA 3GE4A 3EZUA 4M35A 5GOUA 4CMYV 2FHAA 3GGZA 1Z6OM 5JACA 3KA4A 4DYZA 2Z90A 1SOFA 1YUXA 3C1YA 4YXJA 1ZS3A 2OH3A 4XKTA 4RC6A 2FG4A 2ITBA 5D8SA 1MFRA 2G38B 5FFEA 1N1QA 1Z6OA 2WLUA 1RCGA 1L8IA 5GU2X 1GWGA 3KHKA 5GU1X 1S30A 2Z5RA 5K53A 5FFDA 3D19A 2GYQA 3PWQC 4W4KB 4ITWA 3AF7X 4II4A 3SIDA 5E2DA 3A68A 4ISPA 1DPSA 1XZ1A 4MN9A 3FVBA 4DE6A 1JREA 3E1NA 4E6KA 1UVHA 3R2SA 1QYBA 5CMRA 3QHCA 2ZG7X 2IB0A 1BFRA 3PVRA 5GU3X 3C1ZA 4PGKA 4EVDA 1DATA 2ZA7A 2OC5A 2ZURX 3Q4QA 3ISFA 5JDOB 4MY7A 4CMYA 3NP2X 2QF9A 5FFAA 2C2JA 4M34A 4AM2A 3HL1A 2V2OA 4II4B 4M32A 5J9VA 2Y3QA 1LKOA 3R2LA 1B71A 2V2NA 3SE1A 1Z4AA 5D8OA 3E6RA 3ES3A 1YV1A 4TOCA 3KA9A 4DI0A 5CZUA 3L0MA 5AXSA 2VXXA 3E6SA 1O9RA 2ZA6A 3PW8A 5IX6A 2FFXJ 1JTSA 4TOBA 2CIHA 2FG8A 3FRSA 3BT5A 4TW3A 5LG2A 1RYTA 2VXIA 3EGMA 4REUA 4LPNA 3KA6A 3E1JA 3U90A 1TKPA 5FEJA 1J30A 4TO9A 3TA8A 2ZG9X 4CVRA 4MKUA 4ERUA 1JI5A 2CLUA 3PVTB 4LPJA 2MGYA 1NNQA 2V2RA 5LBHA 1H96A 3PWFA 3OGHA 5I4JA 2G4HA 3AF8X 2XJMA 2Z5QA 4ZMCA 3RE7A 4CYBA 2V8TA 2YW6A 1EUMA 5CMQA 5LG8A 2FL0A 3Q4NA 4RC5A 1O9IA 3UOIA 3QZ3A 3KX9A 5JKMG 3ERZA 2IY4A 2Z6MA 3FRRA 4MUDA 4YKHA 3C21A 3IQ1A 3R2OA 2XGWA 3SH6A 4CVTA 4ZKXA 1ZUJA 4AM4A 3VV9A 3QHBA 4IWJA 5JDOA 4LYUA 4DYXA 4XKUA 2CN6A 2HTNA 3JZ9A 2CF7A 2VZBA 4ISMA 5ERJA 4MXPA 5GU0X 4ETRA 2FZFA 4RC8A 1JKVA 3R2MA 2YW7A 4TOFA 3PZAA 3JZAB 4RC5B 3N6OA 1S3QA 3T9JA 3R2KA 2GS4A 3HIUA 2FJCA 3GVYA 1HRSA 3KWOA 5K52A 3H7GA 3AK9A 3BVFA 5D8PA 3PWQA 2CWLA 3R2RA 1LKMA 3PVYB 3BVLA 3LKDA 2CEIA 4CVSA 3BKNA 3M6JA 4MJYA 3UOFA 2WWXB 4QUWA 4ZJKA 4IWKA 1TJOA 2W0OA 3IS8A 2CHPA 2JD60 4Z3BA 4KVQA 5FFCA 2PYBA 4DZ0A 2XJNA 3PVTA 3UFBA 2JD80 1R03A 4PGIA 2RBDA 4DASA 3F34A 2D5KA 1YUZA 2V15A 3E1MA 5HU6D 3E1QA 4Z5SA 2N02A 3WNWA 3RGDA 3KDQA 1RCDA 2IU2A 2OKCA 1OTKA 3NP0X 4LYXA 4DYYA 4LQJA 4ZKWA 1RCEA 3QVDA 2BKCA 1TKOA 4TODA 2ZA8A 4KVSA 2V8UA 4KVRA 3R2HA 4ZL6A 1FHAA 2C6RA 1RCIA 4LPMA 3WVWA 3VNXA 3Q4RA 4A25A 4YXMA 3E2CA 2X170 4TOGA 5ERKA 4W4LB 4ZKHA 3IS7A 3QB9A 3KXUA 2V2IA 2YJKA 3E1PA 4R42A 5D8RA 1RCCA 3DBYA 3VVAA 3AK8A 4ZTTA 1BCFA 3F38A 5LS9A 1JI4A 2BK6A 2FKZA 3F35A 3Q4OA 5GN8B 1JIGA 2XKQA 4ZL5A 1VEQA 3SHXA 2WTLA 4EVEA 4XGSA 1NFVA 4Y08A 3PVYA 2CN7A 3EZ0A 1AEWA 1XZ3A 5J8SA 2JD70 3RD0A 5FFBA 2QQYA 3ISEA 4RC7B 1IERA 4DYUA 3AF9X 5JKMA 4EVBA 1UMNA 4TOHA 2C41A 3OJ5A 3FI6A 2BJYA 2C2FA 2CHIA 3C23A 4PG0A 4TOEA 3QD8A 5HQOA 4M33A 2AR0A 3WVVA 1JYBA 1BG7A 3KA8A 4LQHA 3E1OA 4TOAA 5E1UA 4IXKA 1VEIA 1F30A 4LQVA 1VELA 4RC6B 1TK6A 3MPSA 5D8XA 5J8WA 2XJOA 4LQNA 2ZG8X 4CVPA 2YJJA 1IESA 3V3KB 3AJQA 5HJHA 1MOJA 4ZLWA 3KA3A 4X0JA 1NF4A 1DVBA 3NOZX 3PW8C 3WVUA 4CYAA 3RBCA 3BVEA 2F7NA 4PG1A 5JKLG 2C2UA 1L8HA 1QGHA 3F36A 4YVZA 2V2LA 5HJFA 1LB3A 3F33A 3GGYA 3O7RA 4KXRB 3O7SA 4ML5A 2UX1A 3PVRB 3W54A 5D8YA 4U3GA 3PW1A 1F33A 4WJG4 2V2SA 4AM5A 1VJXA 3GHQA 3F37A 5JKLA 1VLGA 1LKPA 5GN8A 1JKUA 4ITTA 2BW1A 4EVCA 3AJPA 4XKSA 2HR5A 2V2PA 3F39A 2Y44A 4P18A
chains in the Genus database with same CATH topology
5J93A 3BVKA 1S2ZA 5C6FA 4OYNA 3E1LA 1JGCA 4CY9A 1KRQA 3BVIA 3F32A 2GYDA 1SQ3A 4RC7A 2V2JA 3RAVA 3UNOA 2Z5PA 3PW1B 2WLAA 2V2MA 3A9QA 2CLBA 5D8QA 1NF6A 4E40A 3AJOA 3FSEA 3GE4A 3EZUA 4M35A 5GOUA 4CMYV 2FHAA 3GGZA 1Z6OM 5JACA 3KA4A 4DYZA 2Z90A 1SOFA 1YUXA 3C1YA 4YXJA 1ZS3A 2OH3A 4XKTA 4RC6A 2FG4A 2ITBA 5D8SA 1MFRA 2G38B 5FFEA 1N1QA 1Z6OA 2WLUA 1RCGA 1L8IA 5GU2X 1GWGA 3KHKA 5GU1X 1S30A 2Z5RA 5K53A 5FFDA 3D19A 2GYQA 3PWQC 4W4KB 4ITWA 3AF7X 4II4A 3SIDA 5E2DA 3A68A 4ISPA 1DPSA 1XZ1A 4MN9A 3FVBA 4DE6A 1JREA 3E1NA 4E6KA 1UVHA 3R2SA 1QYBA 5CMRA 3QHCA 2ZG7X 2IB0A 1BFRA 3PVRA 5GU3X 3C1ZA 4PGKA 4EVDA 1DATA 2ZA7A 2OC5A 2ZURX 3Q4QA 3ISFA 5JDOB 4MY7A 4CMYA 3NP2X 2QF9A 5FFAA 2C2JA 4M34A 4AM2A 3HL1A 2V2OA 4II4B 4M32A 5J9VA 2Y3QA 1LKOA 3R2LA 1B71A 2V2NA 3SE1A 1Z4AA 5D8OA 3E6RA 3ES3A 1YV1A 4TOCA 3KA9A 4DI0A 5CZUA 3L0MA 5AXSA 2VXXA 3E6SA 1O9RA 2ZA6A 3PW8A 5IX6A 2FFXJ 1JTSA 4TOBA 2CIHA 2FG8A 3FRSA 3BT5A 4TW3A 5LG2A 1RYTA 2VXIA 3EGMA 4REUA 4LPNA 3KA6A 3E1JA 3U90A 1TKPA 5FEJA 1J30A 4TO9A 3TA8A 2ZG9X 4CVRA 4MKUA 4ERUA 1JI5A 2CLUA 3PVTB 4LPJA 2MGYA 1NNQA 2V2RA 5LBHA 1H96A 3PWFA 3OGHA 5I4JA 2G4HA 3AF8X 2XJMA 2Z5QA 4ZMCA 3RE7A 4CYBA 2V8TA 2YW6A 1EUMA 5CMQA 5LG8A 2FL0A 3Q4NA 4RC5A 1O9IA 3UOIA 3QZ3A 3KX9A 5JKMG 3ERZA 2IY4A 2Z6MA 3FRRA 4MUDA 4YKHA 3C21A 3IQ1A 3R2OA 2XGWA 3SH6A 4CVTA 4ZKXA 1ZUJA 4AM4A 3VV9A 3QHBA 4IWJA 5JDOA 4LYUA 4DYXA 4XKUA 2CN6A 2HTNA 3JZ9A 2CF7A 2VZBA 4ISMA 5ERJA 4MXPA 5GU0X 4ETRA 2FZFA 4RC8A 1JKVA 3R2MA 2YW7A 4TOFA 3PZAA 3JZAB 4RC5B 3N6OA 1S3QA 3T9JA 3R2KA 2GS4A 3HIUA 2FJCA 3GVYA 1HRSA 3KWOA 5K52A 3H7GA 3AK9A 3BVFA 5D8PA 3PWQA 2CWLA 3R2RA 1LKMA 3PVYB 3BVLA 3LKDA 2CEIA 4CVSA 3BKNA 3M6JA 4MJYA 3UOFA 2WWXB 4QUWA 4ZJKA 4IWKA 1TJOA 2W0OA 3IS8A 2CHPA 2JD60 4Z3BA 4KVQA 5FFCA 2PYBA 4DZ0A 2XJNA 3PVTA 3UFBA 2JD80 1R03A 4PGIA 2RBDA 4DASA 3F34A 2D5KA 1YUZA 2V15A 3E1MA 5HU6D 3E1QA 4Z5SA 2N02A 3WNWA 3RGDA 3KDQA 1RCDA 2IU2A 2OKCA 1OTKA 3NP0X 4LYXA 4DYYA 4LQJA 4ZKWA 1RCEA 3QVDA 2BKCA 1TKOA 4TODA 2ZA8A 4KVSA 2V8UA 4KVRA 3R2HA 4ZL6A 1FHAA 2C6RA 1RCIA 4LPMA 3WVWA 3VNXA 3Q4RA 4A25A 4YXMA 3E2CA 2X170 4TOGA 5ERKA 4W4LB 4ZKHA 3IS7A 3QB9A 3KXUA 2V2IA 2YJKA 3E1PA 4R42A 5D8RA 1RCCA 3DBYA 3VVAA 3AK8A 4ZTTA 1BCFA 3F38A 5LS9A 1JI4A 2BK6A 2FKZA 3F35A 3Q4OA 5GN8B 1JIGA 2XKQA 4ZL5A 1VEQA 3SHXA 2WTLA 4EVEA 4XGSA 1NFVA 4Y08A 3PVYA 2CN7A 3EZ0A 1AEWA 1XZ3A 5J8SA 2JD70 3RD0A 5FFBA 2QQYA 3ISEA 4RC7B 1IERA 4DYUA 3AF9X 5JKMA 4EVBA 1UMNA 4TOHA 2C41A 3OJ5A 3FI6A 2BJYA 2C2FA 2CHIA 3C23A 4PG0A 4TOEA 3QD8A 5HQOA 4M33A 2AR0A 3WVVA 1JYBA 1BG7A 3KA8A 4LQHA 3E1OA 4TOAA 5E1UA 4IXKA 1VEIA 1F30A 4LQVA 1VELA 4RC6B 1TK6A 3MPSA 5D8XA 5J8WA 2XJOA 4LQNA 2ZG8X 4CVPA 2YJJA 1IESA 3V3KB 3AJQA 5HJHA 1MOJA 4ZLWA 3KA3A 4X0JA 1NF4A 1DVBA 3NOZX 3PW8C 3WVUA 4CYAA 3RBCA 3BVEA 2F7NA 4PG1A 5JKLG 2C2UA 1L8HA 1QGHA 3F36A 4YVZA 2V2LA 5HJFA 1LB3A 3F33A 3GGYA 3O7RA 4KXRB 3O7SA 4ML5A 2UX1A 3PVRB 3W54A 5D8YA 4U3GA 3PW1A 1F33A 4WJG4 2V2SA 4AM5A 1VJXA 3GHQA 3F37A 5JKLA 1VLGA 1LKPA 5GN8A 1JKUA 4ITTA 2BW1A 4EVCA 3AJPA 4XKSA 2HR5A 2V2PA 3F39A 2Y44A 4P18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J93 A;  3BVK A;  1S2Z A;  5C6F A;  4OYN A;  3E1L A;  1JGC A;  4CY9 A;  1KRQ A;  3BVI A;  3F32 A;  2GYD A;  1SQ3 A;  4RC7 A;  2V2J A;  3RAV A;  3UNO A;  2Z5P A;  3PW1 B;  2WLA A;  2V2M A;  3A9Q A;  2CLB A;  5D8Q A;  1NF6 A;  3AJO A;  3FSE A;  3GE4 A;  3EZU A;  4M35 A;  5GOU A;  4CMY V;  2FHA A;  1Z6O M;  5JAC A;  3KA4 A;  4DYZ A;  2Z90 A;  1SOF A;  1YUX A;  1ZS3 A;  2OH3 A;  4XKT A;  4RC6 A;  2FG4 A;  2ITB A;  5D8S A;  1MFR A;  5FFE A;  1N1Q A;  1Z6O A;  2WLU A;  1RCG A;  1L8I A;  5GU2 X;  1GWG A;  5GU1 X;  1S30 A;  2Z5R A;  5K53 A;  5FFD A;  2GYQ A;  3PWQ C;  4ITW A;  3AF7 X;  4II4 A;  3SID A;  5E2D A;  3A68 A;  4ISP A;  1DPS A;  1XZ1 A;  4MN9 A;  3FVB A;  4DE6 A;  1JRE A;  3E1N A;  4E6K A;  1UVH A;  3R2S A;  1QYB A;  5CMR A;  3QHC A;  2ZG7 X;  2IB0 A;  1BFR A;  3PVR A;  5GU3 X;  4PGK A;  4EVD A;  1DAT A;  2ZA7 A;  2OC5 A;  2ZUR X;  3Q4Q A;  3ISF A;  4MY7 A;  4CMY A;  3NP2 X;  2QF9 A;  5FFA A;  2C2J A;  4M34 A;  4AM2 A;  3HL1 A;  2V2O A;  4II4 B;  4M32 A;  5J9V A;  2Y3Q A;  1LKO A;  3R2L A;  1B71 A;  2V2N A;  3SE1 A;  1Z4A A;  5D8O A;  3E6R A;  3ES3 A;  1YV1 A;  4TOC A;  3KA9 A;  4DI0 A;  5CZU A;  5AXS A;  2VXX A;  3E6S A;  1O9R A;  2ZA6 A;  3PW8 A;  5IX6 A;  2FFX J;  1JTS A;  4TOB A;  2CIH A;  2FG8 A;  3BT5 A;  4TW3 A;  5LG2 A;  1RYT A;  2VXI A;  3EGM A;  4REU A;  4LPN A;  3KA6 A;  3E1J A;  3U90 A;  1TKP A;  5FEJ A;  1J30 A;  4TO9 A;  3TA8 A;  2ZG9 X;  4CVR A;  4MKU A;  4ERU A;  1JI5 A;  2CLU A;  3PVT B;  4LPJ A;  1NNQ A;  2V2R A;  5LBH A;  1H96 A;  3PWF A;  3OGH A;  5I4J A;  2G4H A;  3AF8 X;  2XJM A;  2Z5Q A;  4ZMC A;  3RE7 A;  4CYB A;  2YW6 A;  1EUM A;  5CMQ A;  5LG8 A;  2FL0 A;  3Q4N A;  4RC5 A;  1O9I A;  3UOI A;  3QZ3 A;  3KX9 A;  5JKM G;  3ERZ A;  2IY4 A;  2Z6M A;  4MUD A;  4YKH A;  3IQ1 A;  3R2O A;  2XGW A;  3SH6 A;  4CVT A;  4ZKX A;  1ZUJ A;  4AM4 A;  3QHB A;  4IWJ A;  4LYU A;  4DYX A;  4XKU A;  2CN6 A;  2HTN A;  2CF7 A;  2VZB A;  4ISM A;  5ERJ A;  5GU0 X;  4ETR A;  2FZF A;  4RC8 A;  1JKV A;  3R2M A;  2YW7 A;  4TOF A;  3PZA A;  4RC5 B;  1S3Q A;  3T9J A;  3R2K A;  2GS4 A;  3HIU A;  2FJC A;  3GVY A;  1HRS A;  3KWO A;  5K52 A;  3H7G A;  3AK9 A;  3BVF A;  5D8P A;  3PWQ A;  3R2R A;  1LKM A;  3PVY B;  3BVL A;  2CEI A;  4CVS A;  3BKN A;  4MJY A;  3UOF A;  4QUW A;  4ZJK A;  4IWK A;  1TJO A;  2W0O A;  3IS8 A;  2CHP A;  2JD6 0;  4Z3B A;  4KVQ A;  5FFC A;  2PYB A;  4DZ0 A;  2XJN A;  3PVT A;  2JD8 0;  1R03 A;  4PGI A;  2RBD A;  4DAS A;  3F34 A;  2D5K A;  1YUZ A;  2V15 A;  3E1M A;  3E1Q A;  4Z5S A;  3WNW A;  3RGD A;  1RCD A;  2IU2 A;  1OTK A;  3NP0 X;  4LYX A;  4DYY A;  4LQJ A;  4ZKW A;  1RCE A;  3QVD A;  2BKC A;  1TKO A;  4TOD A;  2ZA8 A;  4KVS A;  4KVR A;  3R2H A;  4ZL6 A;  1FHA A;  2C6R A;  1RCI A;  4LPM A;  3WVW A;  3VNX A;  3Q4R A;  4A25 A;  3E2C A;  2X17 0;  4TOG A;  5ERK A;  4ZKH A;  3IS7 A;  3QB9 A;  3KXU A;  2V2I A;  2YJK A;  3E1P A;  4R42 A;  5D8R A;  1RCC A;  3AK8 A;  4ZTT A;  1BCF A;  3F38 A;  5LS9 A;  1JI4 A;  2BK6 A;  2FKZ A;  3F35 A;  3Q4O A;  5GN8 B;  1JIG A;  2XKQ A;  4ZL5 A;  1VEQ A;  3SHX A;  2WTL A;  4EVE A;  4XGS A;  1NFV A;  4Y08 A;  3PVY A;  2CN7 A;  3EZ0 A;  1AEW A;  1XZ3 A;  5J8S A;  2JD7 0;  3RD0 A;  5FFB A;  2QQY A;  3ISE A;  4RC7 B;  1IER A;  4DYU A;  3AF9 X;  5JKM A;  4EVB A;  1UMN A;  4TOH A;  2C41 A;  3OJ5 A;  3FI6 A;  2BJY A;  2C2F A;  2CHI A;  4PG0 A;  4TOE A;  3QD8 A;  5HQO A;  4M33 A;  3WVV A;  1JYB A;  1BG7 A;  3KA8 A;  4LQH A;  3E1O A;  4TOA A;  5E1U A;  4IXK A;  1VEI A;  1F30 A;  4LQV A;  1VEL A;  4RC6 B;  1TK6 A;  3MPS A;  5D8X A;  5J8W A;  2XJO A;  4LQN A;  2ZG8 X;  4CVP A;  2YJJ A;  1IES A;  3AJQ A;  5HJH A;  1MOJ A;  4ZLW A;  3KA3 A;  1NF4 A;  1DVB A;  3NOZ X;  3PW8 C;  3WVU A;  4CYA A;  3RBC A;  3BVE A;  2F7N A;  4PG1 A;  5JKL G;  2C2U A;  1L8H A;  1QGH A;  3F36 A;  2V2L A;  5HJF A;  1LB3 A;  3F33 A;  3O7R A;  3O7S A;  4ML5 A;  2UX1 A;  3PVR B;  5D8Y A;  4U3G A;  3PW1 A;  1F33 A;  2V2S A;  4AM5 A;  1VJX A;  3GHQ A;  3F37 A;  5JKL A;  1VLG A;  1LKP A;  5GN8 A;  1JKU A;  4ITT A;  2BW1 A;  4EVC A;  3AJP A;  4XKS A;  2HR5 A;  2V2P A;  3F39 A;  4P18 A; 
#chains in the Genus database with same CATH topology
 5J93 A;  3BVK A;  1S2Z A;  5C6F A;  4OYN A;  3E1L A;  1JGC A;  4CY9 A;  1KRQ A;  3BVI A;  3F32 A;  2GYD A;  1SQ3 A;  4RC7 A;  2V2J A;  3RAV A;  3UNO A;  2Z5P A;  3PW1 B;  2WLA A;  2V2M A;  3A9Q A;  2CLB A;  5D8Q A;  1NF6 A;  4E40 A;  3AJO A;  3FSE A;  3GE4 A;  3EZU A;  4M35 A;  5GOU A;  4CMY V;  2FHA A;  3GGZ A;  1Z6O M;  5JAC A;  3KA4 A;  4DYZ A;  2Z90 A;  1SOF A;  1YUX A;  3C1Y A;  4YXJ A;  1ZS3 A;  2OH3 A;  4XKT A;  4RC6 A;  2FG4 A;  2ITB A;  5D8S A;  1MFR A;  2G38 B;  5FFE A;  1N1Q A;  1Z6O A;  2WLU A;  1RCG A;  1L8I A;  5GU2 X;  1GWG A;  3KHK A;  5GU1 X;  1S30 A;  2Z5R A;  5K53 A;  5FFD A;  3D19 A;  2GYQ A;  3PWQ C;  4W4K B;  4ITW A;  3AF7 X;  4II4 A;  3SID A;  5E2D A;  3A68 A;  4ISP A;  1DPS A;  1XZ1 A;  4MN9 A;  3FVB A;  4DE6 A;  1JRE A;  3E1N A;  4E6K A;  1UVH A;  3R2S A;  1QYB A;  5CMR A;  3QHC A;  2ZG7 X;  2IB0 A;  1BFR A;  3PVR A;  5GU3 X;  3C1Z A;  4PGK A;  4EVD A;  1DAT A;  2ZA7 A;  2OC5 A;  2ZUR X;  3Q4Q A;  3ISF A;  5JDO B;  4MY7 A;  4CMY A;  3NP2 X;  2QF9 A;  5FFA A;  2C2J A;  4M34 A;  4AM2 A;  3HL1 A;  2V2O A;  4II4 B;  4M32 A;  5J9V A;  2Y3Q A;  1LKO A;  3R2L A;  1B71 A;  2V2N A;  3SE1 A;  1Z4A A;  5D8O A;  3E6R A;  3ES3 A;  1YV1 A;  4TOC A;  3KA9 A;  4DI0 A;  5CZU A;  3L0M A;  5AXS A;  2VXX A;  3E6S A;  1O9R A;  2ZA6 A;  3PW8 A;  5IX6 A;  2FFX J;  1JTS A;  4TOB A;  2CIH A;  2FG8 A;  3FRS A;  3BT5 A;  4TW3 A;  5LG2 A;  1RYT A;  2VXI A;  3EGM A;  4REU A;  4LPN A;  3KA6 A;  3E1J A;  3U90 A;  1TKP A;  5FEJ A;  1J30 A;  4TO9 A;  3TA8 A;  2ZG9 X;  4CVR A;  4MKU A;  4ERU A;  1JI5 A;  2CLU A;  3PVT B;  4LPJ A;  2MGY A;  1NNQ A;  2V2R A;  5LBH A;  1H96 A;  3PWF A;  3OGH A;  5I4J A;  2G4H A;  3AF8 X;  2XJM A;  2Z5Q A;  4ZMC A;  3RE7 A;  4CYB A;  2V8T A;  2YW6 A;  1EUM A;  5CMQ A;  5LG8 A;  2FL0 A;  3Q4N A;  4RC5 A;  1O9I A;  3UOI A;  3QZ3 A;  3KX9 A;  5JKM G;  3ERZ A;  2IY4 A;  2Z6M A;  3FRR A;  4MUD A;  4YKH A;  3C21 A;  3IQ1 A;  3R2O A;  2XGW A;  3SH6 A;  4CVT A;  4ZKX A;  1ZUJ A;  4AM4 A;  3VV9 A;  3QHB A;  4IWJ A;  5JDO A;  4LYU A;  4DYX A;  4XKU A;  2CN6 A;  2HTN A;  3JZ9 A;  2CF7 A;  2VZB A;  4ISM A;  5ERJ A;  4MXP A;  5GU0 X;  4ETR A;  2FZF A;  4RC8 A;  1JKV A;  3R2M A;  2YW7 A;  4TOF A;  3PZA A;  3JZA B;  4RC5 B;  3N6O A;  1S3Q A;  3T9J A;  3R2K A;  2GS4 A;  3HIU A;  2FJC A;  3GVY A;  1HRS A;  3KWO A;  5K52 A;  3H7G A;  3AK9 A;  3BVF A;  5D8P A;  3PWQ A;  2CWL A;  3R2R A;  1LKM A;  3PVY B;  3BVL A;  3LKD A;  2CEI A;  4CVS A;  3BKN A;  3M6J A;  4MJY A;  3UOF A;  2WWX B;  4QUW A;  4ZJK A;  4IWK A;  1TJO A;  2W0O A;  3IS8 A;  2CHP A;  2JD6 0;  4Z3B A;  4KVQ A;  5FFC A;  2PYB A;  4DZ0 A;  2XJN A;  3PVT A;  3UFB A;  2JD8 0;  1R03 A;  4PGI A;  2RBD A;  4DAS A;  3F34 A;  2D5K A;  1YUZ A;  2V15 A;  3E1M A;  5HU6 D;  3E1Q A;  4Z5S A;  2N02 A;  3WNW A;  3RGD A;  3KDQ A;  1RCD A;  2IU2 A;  2OKC A;  1OTK A;  3NP0 X;  4LYX A;  4DYY A;  4LQJ A;  4ZKW A;  1RCE A;  3QVD A;  2BKC A;  1TKO A;  4TOD A;  2ZA8 A;  4KVS A;  2V8U A;  4KVR A;  3R2H A;  4ZL6 A;  1FHA A;  2C6R A;  1RCI A;  4LPM A;  3WVW A;  3VNX A;  3Q4R A;  4A25 A;  4YXM A;  3E2C A;  2X17 0;  4TOG A;  5ERK A;  4W4L B;  4ZKH A;  3IS7 A;  3QB9 A;  3KXU A;  2V2I A;  2YJK A;  3E1P A;  4R42 A;  5D8R A;  1RCC A;  3DBY A;  3VVA A;  3AK8 A;  4ZTT A;  1BCF A;  3F38 A;  5LS9 A;  1JI4 A;  2BK6 A;  2FKZ A;  3F35 A;  3Q4O A;  5GN8 B;  1JIG A;  2XKQ A;  4ZL5 A;  1VEQ A;  3SHX A;  2WTL A;  4EVE A;  4XGS A;  1NFV A;  4Y08 A;  3PVY A;  2CN7 A;  3EZ0 A;  1AEW A;  1XZ3 A;  5J8S A;  2JD7 0;  3RD0 A;  5FFB A;  2QQY A;  3ISE A;  4RC7 B;  1IER A;  4DYU A;  3AF9 X;  5JKM A;  4EVB A;  1UMN A;  4TOH A;  2C41 A;  3OJ5 A;  3FI6 A;  2BJY A;  2C2F A;  2CHI A;  3C23 A;  4PG0 A;  4TOE A;  3QD8 A;  5HQO A;  4M33 A;  2AR0 A;  3WVV A;  1JYB A;  1BG7 A;  3KA8 A;  4LQH A;  3E1O A;  4TOA A;  5E1U A;  4IXK A;  1VEI A;  1F30 A;  4LQV A;  1VEL A;  4RC6 B;  1TK6 A;  3MPS A;  5D8X A;  5J8W A;  2XJO A;  4LQN A;  2ZG8 X;  4CVP A;  2YJJ A;  1IES A;  3V3K B;  3AJQ A;  5HJH A;  1MOJ A;  4ZLW A;  3KA3 A;  4X0J A;  1NF4 A;  1DVB A;  3NOZ X;  3PW8 C;  3WVU A;  4CYA A;  3RBC A;  3BVE A;  2F7N A;  4PG1 A;  5JKL G;  2C2U A;  1L8H A;  1QGH A;  3F36 A;  4YVZ A;  2V2L A;  5HJF A;  1LB3 A;  3F33 A;  3GGY A;  3O7R A;  4KXR B;  3O7S A;  4ML5 A;  2UX1 A;  3PVR B;  3W54 A;  5D8Y A;  4U3G A;  3PW1 A;  1F33 A;  4WJG 4;  2V2S A;  4AM5 A;  1VJX A;  3GHQ A;  3F37 A;  5JKL A;  1VLG A;  1LKP A;  5GN8 A;  1JKU A;  4ITT A;  2BW1 A;  4EVC A;  3AJP A;  4XKS A;  2HR5 A;  2V2P A;  3F39 A;  2Y44 A;  4P18 A; 
#chains in the Genus database with same CATH homology
 5J93 A;  3BVK A;  1S2Z A;  5C6F A;  4OYN A;  3E1L A;  1JGC A;  4CY9 A;  1KRQ A;  3BVI A;  3F32 A;  2GYD A;  1SQ3 A;  4RC7 A;  2V2J A;  3RAV A;  3UNO A;  2Z5P A;  3PW1 B;  2WLA A;  2V2M A;  3A9Q A;  2CLB A;  5D8Q A;  1NF6 A;  4E40 A;  3AJO A;  3FSE A;  3GE4 A;  3EZU A;  4M35 A;  5GOU A;  4CMY V;  2FHA A;  3GGZ A;  1Z6O M;  5JAC A;  3KA4 A;  4DYZ A;  2Z90 A;  1SOF A;  1YUX A;  3C1Y A;  4YXJ A;  1ZS3 A;  2OH3 A;  4XKT A;  4RC6 A;  2FG4 A;  2ITB A;  5D8S A;  1MFR A;  2G38 B;  5FFE A;  1N1Q A;  1Z6O A;  2WLU A;  1RCG A;  1L8I A;  5GU2 X;  1GWG A;  3KHK A;  5GU1 X;  1S30 A;  2Z5R A;  5K53 A;  5FFD A;  3D19 A;  2GYQ A;  3PWQ C;  4W4K B;  4ITW A;  3AF7 X;  4II4 A;  3SID A;  5E2D A;  3A68 A;  4ISP A;  1DPS A;  1XZ1 A;  4MN9 A;  3FVB A;  4DE6 A;  1JRE A;  3E1N A;  4E6K A;  1UVH A;  3R2S A;  1QYB A;  5CMR A;  3QHC A;  2ZG7 X;  2IB0 A;  1BFR A;  3PVR A;  5GU3 X;  3C1Z A;  4PGK A;  4EVD A;  1DAT A;  2ZA7 A;  2OC5 A;  2ZUR X;  3Q4Q A;  3ISF A;  5JDO B;  4MY7 A;  4CMY A;  3NP2 X;  2QF9 A;  5FFA A;  2C2J A;  4M34 A;  4AM2 A;  3HL1 A;  2V2O A;  4II4 B;  4M32 A;  5J9V A;  2Y3Q A;  1LKO A;  3R2L A;  1B71 A;  2V2N A;  3SE1 A;  1Z4A A;  5D8O A;  3E6R A;  3ES3 A;  1YV1 A;  4TOC A;  3KA9 A;  4DI0 A;  5CZU A;  3L0M A;  5AXS A;  2VXX A;  3E6S A;  1O9R A;  2ZA6 A;  3PW8 A;  5IX6 A;  2FFX J;  1JTS A;  4TOB A;  2CIH A;  2FG8 A;  3FRS A;  3BT5 A;  4TW3 A;  5LG2 A;  1RYT A;  2VXI A;  3EGM A;  4REU A;  4LPN A;  3KA6 A;  3E1J A;  3U90 A;  1TKP A;  5FEJ A;  1J30 A;  4TO9 A;  3TA8 A;  2ZG9 X;  4CVR A;  4MKU A;  4ERU A;  1JI5 A;  2CLU A;  3PVT B;  4LPJ A;  2MGY A;  1NNQ A;  2V2R A;  5LBH A;  1H96 A;  3PWF A;  3OGH A;  5I4J A;  2G4H A;  3AF8 X;  2XJM A;  2Z5Q A;  4ZMC A;  3RE7 A;  4CYB A;  2V8T A;  2YW6 A;  1EUM A;  5CMQ A;  5LG8 A;  2FL0 A;  3Q4N A;  4RC5 A;  1O9I A;  3UOI A;  3QZ3 A;  3KX9 A;  5JKM G;  3ERZ A;  2IY4 A;  2Z6M A;  3FRR A;  4MUD A;  4YKH A;  3C21 A;  3IQ1 A;  3R2O A;  2XGW A;  3SH6 A;  4CVT A;  4ZKX A;  1ZUJ A;  4AM4 A;  3VV9 A;  3QHB A;  4IWJ A;  5JDO A;  4LYU A;  4DYX A;  4XKU A;  2CN6 A;  2HTN A;  3JZ9 A;  2CF7 A;  2VZB A;  4ISM A;  5ERJ A;  4MXP A;  5GU0 X;  4ETR A;  2FZF A;  4RC8 A;  1JKV A;  3R2M A;  2YW7 A;  4TOF A;  3PZA A;  3JZA B;  4RC5 B;  3N6O A;  1S3Q A;  3T9J A;  3R2K A;  2GS4 A;  3HIU A;  2FJC A;  3GVY A;  1HRS A;  3KWO A;  5K52 A;  3H7G A;  3AK9 A;  3BVF A;  5D8P A;  3PWQ A;  2CWL A;  3R2R A;  1LKM A;  3PVY B;  3BVL A;  3LKD A;  2CEI A;  4CVS A;  3BKN A;  3M6J A;  4MJY A;  3UOF A;  2WWX B;  4QUW A;  4ZJK A;  4IWK A;  1TJO A;  2W0O A;  3IS8 A;  2CHP A;  2JD6 0;  4Z3B A;  4KVQ A;  5FFC A;  2PYB A;  4DZ0 A;  2XJN A;  3PVT A;  3UFB A;  2JD8 0;  1R03 A;  4PGI A;  2RBD A;  4DAS A;  3F34 A;  2D5K A;  1YUZ A;  2V15 A;  3E1M A;  5HU6 D;  3E1Q A;  4Z5S A;  2N02 A;  3WNW A;  3RGD A;  3KDQ A;  1RCD A;  2IU2 A;  2OKC A;  1OTK A;  3NP0 X;  4LYX A;  4DYY A;  4LQJ A;  4ZKW A;  1RCE A;  3QVD A;  2BKC A;  1TKO A;  4TOD A;  2ZA8 A;  4KVS A;  2V8U A;  4KVR A;  3R2H A;  4ZL6 A;  1FHA A;  2C6R A;  1RCI A;  4LPM A;  3WVW A;  3VNX A;  3Q4R A;  4A25 A;  4YXM A;  3E2C A;  2X17 0;  4TOG A;  5ERK A;  4W4L B;  4ZKH A;  3IS7 A;  3QB9 A;  3KXU A;  2V2I A;  2YJK A;  3E1P A;  4R42 A;  5D8R A;  1RCC A;  3DBY A;  3VVA A;  3AK8 A;  4ZTT A;  1BCF A;  3F38 A;  5LS9 A;  1JI4 A;  2BK6 A;  2FKZ A;  3F35 A;  3Q4O A;  5GN8 B;  1JIG A;  2XKQ A;  4ZL5 A;  1VEQ A;  3SHX A;  2WTL A;  4EVE A;  4XGS A;  1NFV A;  4Y08 A;  3PVY A;  2CN7 A;  3EZ0 A;  1AEW A;  1XZ3 A;  5J8S A;  2JD7 0;  3RD0 A;  5FFB A;  2QQY A;  3ISE A;  4RC7 B;  1IER A;  4DYU A;  3AF9 X;  5JKM A;  4EVB A;  1UMN A;  4TOH A;  2C41 A;  3OJ5 A;  3FI6 A;  2BJY A;  2C2F A;  2CHI A;  3C23 A;  4PG0 A;  4TOE A;  3QD8 A;  5HQO A;  4M33 A;  2AR0 A;  3WVV A;  1JYB A;  1BG7 A;  3KA8 A;  4LQH A;  3E1O A;  4TOA A;  5E1U A;  4IXK A;  1VEI A;  1F30 A;  4LQV A;  1VEL A;  4RC6 B;  1TK6 A;  3MPS A;  5D8X A;  5J8W A;  2XJO A;  4LQN A;  2ZG8 X;  4CVP A;  2YJJ A;  1IES A;  3V3K B;  3AJQ A;  5HJH A;  1MOJ A;  4ZLW A;  3KA3 A;  4X0J A;  1NF4 A;  1DVB A;  3NOZ X;  3PW8 C;  3WVU A;  4CYA A;  3RBC A;  3BVE A;  2F7N A;  4PG1 A;  5JKL G;  2C2U A;  1L8H A;  1QGH A;  3F36 A;  4YVZ A;  2V2L A;  5HJF A;  1LB3 A;  3F33 A;  3GGY A;  3O7R A;  4KXR B;  3O7S A;  4ML5 A;  2UX1 A;  3PVR B;  3W54 A;  5D8Y A;  4U3G A;  3PW1 A;  1F33 A;  4WJG 4;  2V2S A;  4AM5 A;  1VJX A;  3GHQ A;  3F37 A;  5JKL A;  1VLG A;  1LKP A;  5GN8 A;  1JKU A;  4ITT A;  2BW1 A;  4EVC A;  3AJP A;  4XKS A;  2HR5 A;  2V2P A;  3F39 A;  2Y44 A;  4P18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...