3OGHA

Crystal structure of ycie protein from e. coli cft073, a member of ferritine-like superfamily of diiron-containing four-helix-bundle proteins
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
163
structure length
145
Chain Sequence
AMNRIEHYHDWLRDAHAMEKQAESMLESMASRIDNYPELRARIEQHLSETKNQIVQLETILDRNDISRSVIKDSEIVKGSISGYVFEQFEIACYTSLLAAAKNAGDTASIPTIEAILNEEKHMADWLIQHIPQTTEKFLIRSETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein yciE
publication title Crystal structure of yciE protein from E. coli CFT073, a member of ferritine-like superfamily of diiron-containing four-helix-bundle proteins
rcsb
source organism Escherichia coli o6
molecule tags Structural genomics, unknown function
total genus 60
structure length 145
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05974 DUF892 Domain of unknown function (DUF892)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3oghA00
2V2IA 3HIUA 4CVSA 3AF9X 3AF8X 4CYAA 1RYTA 3R2RA 3RAVA 4ITTA 1SQ3A 3R2SA 2PYBA 3R2HA 2FG4A 5FFDA 2GS4A 1JIGA 1MFRA 2JD80 4RC7B 1QYBA 1H96A 4EVDA 3F37A 2FJCA 2V2SA 4CVRA 3KA8A 1DATA 3A9QA 4MUDA 1DPSA 5E1UA 5FEJA 2BJYA 2V2JA 3BVLA 4ZJKA 1HRSA 3E1LA 3F35A 4ZKXA 4CMYV 5HJHA 2CN7A 4DZ0A 4II4B 4CYBA 2ZA7A 5GU2X 1YUXA 1NNQA 3KWOA 4XKTA 4OYNA 4ETRA 5E2DA 3GHQA 4DYZA 3AK8A 2UX1A 1XZ3A 3BVFA 2OH3A 3NP2X 1JKUA 3VNXA 2FG8A 4Z5SA 4R42A 3SHXA 3EZ0A 4LPNA 2FZFA 1TJOA 3AJQA 1UVHA 1AEWA 1S3QA 2BK6A 1F33A 3FVBA 3ERZA 2BW1A 4TOBA 2YW7A 3SH6A 3QZ3A 3IS8A 2Z6MA 4TOGA 2GYDA 1L8HA 1RCEA 3MPSA 1JYBA 4CMYA 2ITBA 1J30A 3SE1A 4EVEA 5FFCA 3WVVA 4U3GA 5CZUA 1DVBA 5JKMA 3FSEA 2V2NA 2HR5A 1IESA 4LQJA 5J93A 4AM2A 3GVYA 4TOHA 3E2CA 4ISPA 5GU1X 2C2JA 3BT5A 4TW3A 3E1QA 3PWFA 4TO9A 2IY4A 3PW8A 1EUMA 2XJOA 5FFEA 3QD8A 5CMRA 3A68A 2CIHA 3AJPA 3PVTA 4IWKA 5J8WA 1Z6OA 3IQ1A 2XKQA 1JGCA 2WLUA 1R03A 4MKUA 4DE6A 5C6FA 1LKOA 3QVDA 2WLAA 1JI5A 1VEQA 3PZAA 4MN9A 2HTNA 2C2FA 2Z5RA 3Q4OA 4KVQA 1ZUJA 3PVTB 3PVRA 2ZA6A 5LS9A 4PGIA 4DI0A 1XZ1A 3EGMA 2V2MA 1LKMA 4PGKA 1KRQA 3O7SA 4MY7A 3ISEA 2FFXJ 4QUWA 2C41A 3IS7A 4AM5A 5JKMG 1TKOA 5ERKA 3E6RA 4M33A 4Z3BA 2V2PA 1VEIA 2V2OA 4A25A 3PVRB 3KA6A 4M34A 2ZG8X 1JI4A 1NFVA 3O7RA 1S2ZA 1VJXA 4LQNA 1JTSA 2YJKA 1VLGA 2CF7A 4M32A 3Q4QA 2Z90A 2W0OA 5D8OA 4REUA 5AXSA 5LG2A 4ZKWA 3F36A 1TKPA 3RE7A 3KA9A 1IERA 4IXKA 1L8IA 2CHPA 4CVTA 2WTLA 2F7NA 2FKZA 5GU3X 2ZURX 3E1NA 1RCGA 3KA4A 2C6RA 1UMNA 3T9JA 3KXUA 1NF4A 2V15A 2GYQA 4AM4A 3UNOA 2ZG9X 3TA8A 5D8YA 3Q4NA 4CY9A 3SIDA 1O9RA 3PVYA 4YKHA 4PG1A 4ZL6A 2Z5PA 5JKLA 2VXIA 3PWQC 2IB0A 5J9VA 1B71A 2ZG7X 1MOJA 3HL1A 3NP0X 2JD60 2YW6A 5LBHA 1BCFA 4DYYA 1Z4AA 2FHAA 2C2UA 3H7GA 2YJJA 4ISMA 3F34A 2CEIA 3QB9A 5IX6A 4TOAA 3PVYB 4TOEA 1NF6A 1ZS3A 2Y3QA 1RCCA 4PG0A 1OTKA 1VELA 3E1JA 3F32A 4ZMCA 2CLBA 4RC8A 1BG7A 3FI6A 3AJOA 3E1MA 4XGSA 5HQOA 3AK9A 5D8QA 5D8PA 1FHAA 3UOIA 4LYUA 2OC5A 4LQVA 4ML5A 1RCDA 5GN8A 4EVBA 3R2LA 4TOFA 3E6SA 3KA3A 1JREA 4EVCA 2V2LA 4XKUA 4II4A 2XGWA 3Q4RA 5JKLG 2Z5QA 4TODA 2VZBA 4ZTTA 3F39A 4DYUA 1O9IA 4M35A 3RGDA 5JACA 2D5KA 3F33A 1LB3A 4ZL5A 3WVWA 2CLUA 1S30A 3BVEA 4LPJA 3U90A 5GN8B 3R2OA 3OGHA 3AF7X 3R2KA 5GU0X 4P18A 1Z6OM 4RC6A 1JKVA 4CVPA 3BKNA 1BFRA 5J8SA 1N1QA 1GWGA 3BVKA 4Y08A 3EZUA 5CMQA 2IU2A 4XKSA 2CN6A 3BVIA 2VXXA 4ITWA 4IWJA 4KVSA 4MJYA 1QGHA 2XJNA 2QF9A 4RC6B 5FFAA 1F30A 5ERJA 2ZA8A 3PW8C 5I4JA 5LG8A 1LKPA 2QQYA 2G4HA 2RBDA 3WNWA 1YUZA 1SOFA 3GE4A 2CHIA 3E1PA 4DYXA 5D8RA 2X170 2FL0A 3NOZX 4RC5A 1RCIA 3KX9A 3PW1A 2V2RA 4TOCA 5K52A 1YV1A 4LQHA 5FFBA 4E6KA 4ZKHA 5D8XA 2JD70 2XJMA 3F38A 4KVRA 3QHBA 3UOFA 3WVUA 3E1OA 3RBCA 3ES3A 5D8SA 4ERUA 4LYXA 3PWQA 4RC7A 4RC5B 3OJ5A 3PW1B 3R2MA 4ZLWA 3ISFA 5HJFA 4DASA 3QHCA 1TK6A 3RD0A 5K53A 2BKCA 4LPMA 5GOUA
chains in the Genus database with same CATH superfamily
2V2IA 3HIUA 4CVSA 3AF9X 3AF8X 4CYAA 1RYTA 3R2RA 3RAVA 4ITTA 1SQ3A 3R2SA 2N02A 2PYBA 3R2HA 2FG4A 5FFDA 2GS4A 1JIGA 1MFRA 2JD80 4RC7B 1QYBA 1H96A 4EVDA 4KXRB 3F37A 2FJCA 2V2SA 4CVRA 3KA8A 1DATA 3A9QA 4MUDA 1DPSA 4YXMA 3VVAA 5E1UA 5FEJA 2BJYA 2V2JA 3BVLA 4E40A 4ZJKA 1HRSA 3E1LA 3F35A 4ZKXA 4CMYV 5HJHA 2CN7A 4DZ0A 4II4B 4CYBA 2ZA7A 5GU2X 1YUXA 3C1ZA 4YXJA 1NNQA 3KWOA 2MGYA 4XKTA 4OYNA 4ETRA 5E2DA 3GHQA 4DYZA 3AK8A 2UX1A 1XZ3A 3BVFA 2OH3A 3NP2X 1JKUA 3VNXA 2FG8A 4Z5SA 4R42A 3C1YA 3SHXA 3EZ0A 4LPNA 2FZFA 1TJOA 3AJQA 1UVHA 1AEWA 1S3QA 2BK6A 1F33A 3FVBA 3ERZA 2BW1A 4TOBA 2YW7A 3SH6A 3QZ3A 3IS8A 2WWXB 2Z6MA 4TOGA 2GYDA 5HU6D 1L8HA 1RCEA 3MPSA 1JYBA 4CMYA 2ITBA 3W54A 1J30A 3SE1A 4EVEA 5FFCA 3WVVA 4U3GA 5CZUA 1DVBA 5JKMA 3FSEA 4WJG4 2V2NA 2HR5A 1IESA 4LQJA 5J93A 3M6JA 4AM2A 3GVYA 4TOHA 3E2CA 4ISPA 5GU1X 2C2JA 3BT5A 4TW3A 3E1QA 3PWFA 4TO9A 2IY4A 3PW8A 1EUMA 2XJOA 5FFEA 3QD8A 5CMRA 3A68A 2CIHA 3AJPA 3PVTA 4IWKA 5J8WA 1Z6OA 3IQ1A 2XKQA 1JGCA 2WLUA 1R03A 4MKUA 4DE6A 5C6FA 1LKOA 2V8UA 3QVDA 2WLAA 1JI5A 2G38B 1VEQA 3PZAA 4MN9A 3KHKA 2HTNA 2C2FA 2Z5RA 3Q4OA 4KVQA 1ZUJA 3PVTB 3PVRA 2ZA6A 4W4KB 5LS9A 4PGIA 4DI0A 1XZ1A 3EGMA 2V2MA 3V3KB 4W4LB 1LKMA 4MXPA 4PGKA 1KRQA 3O7SA 4MY7A 3ISEA 2FFXJ 4QUWA 2C41A 3IS7A 4AM5A 5JKMG 1TKOA 5ERKA 3E6RA 4M33A 4Z3BA 2V2PA 1VEIA 2V2OA 4A25A 3D19A 3PVRB 3KA6A 4M34A 2ZG8X 1JI4A 1NFVA 3O7RA 1S2ZA 1VJXA 4LQNA 1JTSA 2YJKA 1VLGA 2CF7A 4M32A 3Q4QA 2Z90A 3GGYA 2W0OA 5D8OA 4REUA 5AXSA 5LG2A 4ZKWA 3F36A 1TKPA 3RE7A 3KA9A 1IERA 4IXKA 3FRSA 1L8IA 2CHPA 4CVTA 2WTLA 2F7NA 2FKZA 5GU3X 2ZURX 3E1NA 3VV9A 1RCGA 3KA4A 2C6RA 1UMNA 3T9JA 3KXUA 1NF4A 2V15A 2GYQA 4AM4A 3C23A 3UNOA 2ZG9X 3TA8A 5D8YA 3Q4NA 4CY9A 3SIDA 1O9RA 3PVYA 4YKHA 3L0MA 4PG1A 4ZL6A 2Z5PA 5JKLA 2VXIA 3PWQC 2IB0A 5J9VA 1B71A 2ZG7X 1MOJA 3GGZA 3HL1A 3NP0X 2JD60 2YW6A 5LBHA 1BCFA 4DYYA 1Z4AA 2FHAA 2C2UA 3H7GA 2YJJA 4ISMA 3F34A 2CEIA 3JZ9A 3QB9A 3UFBA 5IX6A 4TOAA 3PVYB 2Y44A 4TOEA 1NF6A 1ZS3A 2Y3QA 1RCCA 4PG0A 1OTKA 1VELA 3E1JA 3F32A 4ZMCA 2CLBA 4RC8A 1BG7A 2CWLA 3C21A 3FI6A 3AJOA 3E1MA 4XGSA 5HQOA 4YVZA 3AK9A 5D8QA 5D8PA 1FHAA 3FRRA 3UOIA 4LYUA 2OC5A 4LQVA 4ML5A 1RCDA 5GN8A 4EVBA 3R2LA 4TOFA 3E6SA 3KA3A 1JREA 4EVCA 2V2LA 4XKUA 4II4A 2XGWA 3Q4RA 2V8TA 5JKLG 2Z5QA 4TODA 2VZBA 4ZTTA 4X0JA 3F39A 4DYUA 1O9IA 4M35A 3RGDA 5JACA 2D5KA 3F33A 1LB3A 4ZL5A 3WVWA 2CLUA 1S30A 3BVEA 4LPJA 3U90A 5GN8B 3R2OA 3OGHA 3AF7X 3LKDA 5JDOA 3R2KA 5GU0X 4P18A 1Z6OM 4RC6A 1JKVA 4CVPA 3BKNA 1BFRA 5J8SA 1N1QA 1GWGA 3BVKA 4Y08A 3EZUA 5CMQA 2IU2A 3N6OA 2OKCA 4XKSA 2CN6A 2AR0A 3BVIA 2VXXA 4ITWA 4IWJA 4KVSA 4MJYA 5JDOB 1QGHA 2XJNA 2QF9A 4RC6B 5FFAA 1F30A 5ERJA 2ZA8A 3PW8C 5I4JA 5LG8A 1LKPA 2QQYA 2G4HA 2RBDA 3WNWA 1YUZA 1SOFA 3GE4A 2CHIA 3E1PA 4DYXA 5D8RA 2X170 2FL0A 3NOZX 4RC5A 3JZAB 1RCIA 3KX9A 3PW1A 2V2RA 4TOCA 5K52A 1YV1A 3KDQA 4LQHA 5FFBA 4E6KA 4ZKHA 5D8XA 2JD70 2XJMA 3F38A 4KVRA 3QHBA 3UOFA 3WVUA 3E1OA 3RBCA 3ES3A 5D8SA 4ERUA 4LYXA 3DBYA 3PWQA 4RC7A 4RC5B 3OJ5A 3PW1B 3R2MA 4ZLWA 3ISFA 5HJFA 4DASA 3QHCA 1TK6A 3RD0A 5K53A 2BKCA 4LPMA 5GOUA
chains in the Genus database with same CATH topology
2V2IA 3HIUA 4CVSA 3AF9X 3AF8X 4CYAA 1RYTA 3R2RA 3RAVA 4ITTA 1SQ3A 3R2SA 2N02A 2PYBA 3R2HA 2FG4A 5FFDA 2GS4A 1JIGA 1MFRA 2JD80 4RC7B 1QYBA 1H96A 4EVDA 4KXRB 3F37A 2FJCA 2V2SA 4CVRA 3KA8A 1DATA 3A9QA 4MUDA 1DPSA 4YXMA 3VVAA 5E1UA 5FEJA 2BJYA 2V2JA 3BVLA 4E40A 4ZJKA 1HRSA 3E1LA 3F35A 4ZKXA 4CMYV 5HJHA 2CN7A 4DZ0A 4II4B 4CYBA 2ZA7A 5GU2X 1YUXA 3C1ZA 4YXJA 1NNQA 3KWOA 2MGYA 4XKTA 4OYNA 4ETRA 5E2DA 3GHQA 4DYZA 3AK8A 2UX1A 1XZ3A 3BVFA 2OH3A 3NP2X 1JKUA 3VNXA 2FG8A 4Z5SA 4R42A 3C1YA 3SHXA 3EZ0A 4LPNA 2FZFA 1TJOA 3AJQA 1UVHA 1AEWA 1S3QA 2BK6A 1F33A 3FVBA 3ERZA 2BW1A 4TOBA 2YW7A 3SH6A 3QZ3A 3IS8A 2WWXB 2Z6MA 4TOGA 2GYDA 5HU6D 1L8HA 1RCEA 3MPSA 1JYBA 4CMYA 2ITBA 3W54A 1J30A 3SE1A 4EVEA 5FFCA 3WVVA 4U3GA 5CZUA 1DVBA 5JKMA 3FSEA 4WJG4 2V2NA 2HR5A 1IESA 4LQJA 5J93A 3M6JA 4AM2A 3GVYA 4TOHA 3E2CA 4ISPA 5GU1X 2C2JA 3BT5A 4TW3A 3E1QA 3PWFA 4TO9A 2IY4A 3PW8A 1EUMA 2XJOA 5FFEA 3QD8A 5CMRA 3A68A 2CIHA 3AJPA 3PVTA 4IWKA 5J8WA 1Z6OA 3IQ1A 2XKQA 1JGCA 2WLUA 1R03A 4MKUA 4DE6A 5C6FA 1LKOA 2V8UA 3QVDA 2WLAA 1JI5A 2G38B 1VEQA 3PZAA 4MN9A 3KHKA 2HTNA 2C2FA 2Z5RA 3Q4OA 4KVQA 1ZUJA 3PVTB 3PVRA 2ZA6A 4W4KB 5LS9A 4PGIA 4DI0A 1XZ1A 3EGMA 2V2MA 3V3KB 4W4LB 1LKMA 4MXPA 4PGKA 1KRQA 3O7SA 4MY7A 3ISEA 2FFXJ 4QUWA 2C41A 3IS7A 4AM5A 5JKMG 1TKOA 5ERKA 3E6RA 4M33A 4Z3BA 2V2PA 1VEIA 2V2OA 4A25A 3D19A 3PVRB 3KA6A 4M34A 2ZG8X 1JI4A 1NFVA 3O7RA 1S2ZA 1VJXA 4LQNA 1JTSA 2YJKA 1VLGA 2CF7A 4M32A 3Q4QA 2Z90A 3GGYA 2W0OA 5D8OA 4REUA 5AXSA 5LG2A 4ZKWA 3F36A 1TKPA 3RE7A 3KA9A 1IERA 4IXKA 3FRSA 1L8IA 2CHPA 4CVTA 2WTLA 2F7NA 2FKZA 5GU3X 2ZURX 3E1NA 3VV9A 1RCGA 3KA4A 2C6RA 1UMNA 3T9JA 3KXUA 1NF4A 2V15A 2GYQA 4AM4A 3C23A 3UNOA 2ZG9X 3TA8A 5D8YA 3Q4NA 4CY9A 3SIDA 1O9RA 3PVYA 4YKHA 3L0MA 4PG1A 4ZL6A 2Z5PA 5JKLA 2VXIA 3PWQC 2IB0A 5J9VA 1B71A 2ZG7X 1MOJA 3GGZA 3HL1A 3NP0X 2JD60 2YW6A 5LBHA 1BCFA 4DYYA 1Z4AA 2FHAA 2C2UA 3H7GA 2YJJA 4ISMA 3F34A 2CEIA 3JZ9A 3QB9A 3UFBA 5IX6A 4TOAA 3PVYB 2Y44A 4TOEA 1NF6A 1ZS3A 2Y3QA 1RCCA 4PG0A 1OTKA 1VELA 3E1JA 3F32A 4ZMCA 2CLBA 4RC8A 1BG7A 2CWLA 3C21A 3FI6A 3AJOA 3E1MA 4XGSA 5HQOA 4YVZA 3AK9A 5D8QA 5D8PA 1FHAA 3FRRA 3UOIA 4LYUA 2OC5A 4LQVA 4ML5A 1RCDA 5GN8A 4EVBA 3R2LA 4TOFA 3E6SA 3KA3A 1JREA 4EVCA 2V2LA 4XKUA 4II4A 2XGWA 3Q4RA 2V8TA 5JKLG 2Z5QA 4TODA 2VZBA 4ZTTA 4X0JA 3F39A 4DYUA 1O9IA 4M35A 3RGDA 5JACA 2D5KA 3F33A 1LB3A 4ZL5A 3WVWA 2CLUA 1S30A 3BVEA 4LPJA 3U90A 5GN8B 3R2OA 3OGHA 3AF7X 3LKDA 5JDOA 3R2KA 5GU0X 4P18A 1Z6OM 4RC6A 1JKVA 4CVPA 3BKNA 1BFRA 5J8SA 1N1QA 1GWGA 3BVKA 4Y08A 3EZUA 5CMQA 2IU2A 3N6OA 2OKCA 4XKSA 2CN6A 2AR0A 3BVIA 2VXXA 4ITWA 4IWJA 4KVSA 4MJYA 5JDOB 1QGHA 2XJNA 2QF9A 4RC6B 5FFAA 1F30A 5ERJA 2ZA8A 3PW8C 5I4JA 5LG8A 1LKPA 2QQYA 2G4HA 2RBDA 3WNWA 1YUZA 1SOFA 3GE4A 2CHIA 3E1PA 4DYXA 5D8RA 2X170 2FL0A 3NOZX 4RC5A 3JZAB 1RCIA 3KX9A 3PW1A 2V2RA 4TOCA 5K52A 1YV1A 3KDQA 4LQHA 5FFBA 4E6KA 4ZKHA 5D8XA 2JD70 2XJMA 3F38A 4KVRA 3QHBA 3UOFA 3WVUA 3E1OA 3RBCA 3ES3A 5D8SA 4ERUA 4LYXA 3DBYA 3PWQA 4RC7A 4RC5B 3OJ5A 3PW1B 3R2MA 4ZLWA 3ISFA 5HJFA 4DASA 3QHCA 1TK6A 3RD0A 5K53A 2BKCA 4LPMA 5GOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2I A;  3HIU A;  4CVS A;  3AF9 X;  3AF8 X;  4CYA A;  1RYT A;  3R2R A;  3RAV A;  4ITT A;  1SQ3 A;  3R2S A;  2PYB A;  3R2H A;  2FG4 A;  5FFD A;  2GS4 A;  1JIG A;  1MFR A;  2JD8 0;  4RC7 B;  1QYB A;  1H96 A;  4EVD A;  3F37 A;  2FJC A;  2V2S A;  4CVR A;  3KA8 A;  1DAT A;  3A9Q A;  4MUD A;  1DPS A;  5E1U A;  5FEJ A;  2BJY A;  2V2J A;  3BVL A;  4ZJK A;  1HRS A;  3E1L A;  3F35 A;  4ZKX A;  4CMY V;  5HJH A;  2CN7 A;  4DZ0 A;  4II4 B;  4CYB A;  2ZA7 A;  5GU2 X;  1YUX A;  1NNQ A;  3KWO A;  4XKT A;  4OYN A;  4ETR A;  5E2D A;  3GHQ A;  4DYZ A;  3AK8 A;  2UX1 A;  1XZ3 A;  3BVF A;  2OH3 A;  3NP2 X;  1JKU A;  3VNX A;  2FG8 A;  4Z5S A;  4R42 A;  3SHX A;  3EZ0 A;  4LPN A;  2FZF A;  1TJO A;  3AJQ A;  1UVH A;  1AEW A;  1S3Q A;  2BK6 A;  1F33 A;  3FVB A;  3ERZ A;  2BW1 A;  4TOB A;  2YW7 A;  3SH6 A;  3QZ3 A;  3IS8 A;  2Z6M A;  4TOG A;  2GYD A;  1L8H A;  1RCE A;  3MPS A;  1JYB A;  4CMY A;  2ITB A;  1J30 A;  3SE1 A;  4EVE A;  5FFC A;  3WVV A;  4U3G A;  5CZU A;  1DVB A;  5JKM A;  3FSE A;  2V2N A;  2HR5 A;  1IES A;  4LQJ A;  5J93 A;  4AM2 A;  3GVY A;  4TOH A;  3E2C A;  4ISP A;  5GU1 X;  2C2J A;  3BT5 A;  4TW3 A;  3E1Q A;  3PWF A;  4TO9 A;  2IY4 A;  3PW8 A;  1EUM A;  2XJO A;  5FFE A;  3QD8 A;  5CMR A;  3A68 A;  2CIH A;  3AJP A;  3PVT A;  4IWK A;  5J8W A;  1Z6O A;  3IQ1 A;  2XKQ A;  1JGC A;  2WLU A;  1R03 A;  4MKU A;  4DE6 A;  5C6F A;  1LKO A;  3QVD A;  2WLA A;  1JI5 A;  1VEQ A;  3PZA A;  4MN9 A;  2HTN A;  2C2F A;  2Z5R A;  3Q4O A;  4KVQ A;  1ZUJ A;  3PVT B;  3PVR A;  2ZA6 A;  5LS9 A;  4PGI A;  4DI0 A;  1XZ1 A;  3EGM A;  2V2M A;  1LKM A;  4PGK A;  1KRQ A;  3O7S A;  4MY7 A;  3ISE A;  2FFX J;  4QUW A;  2C41 A;  3IS7 A;  4AM5 A;  5JKM G;  1TKO A;  5ERK A;  3E6R A;  4M33 A;  4Z3B A;  2V2P A;  1VEI A;  2V2O A;  4A25 A;  3PVR B;  3KA6 A;  4M34 A;  2ZG8 X;  1JI4 A;  1NFV A;  3O7R A;  1S2Z A;  1VJX A;  4LQN A;  1JTS A;  2YJK A;  1VLG A;  2CF7 A;  4M32 A;  3Q4Q A;  2Z90 A;  2W0O A;  5D8O A;  4REU A;  5AXS A;  5LG2 A;  4ZKW A;  3F36 A;  1TKP A;  3RE7 A;  3KA9 A;  1IER A;  4IXK A;  1L8I A;  2CHP A;  4CVT A;  2WTL A;  2F7N A;  2FKZ A;  5GU3 X;  2ZUR X;  3E1N A;  1RCG A;  3KA4 A;  2C6R A;  1UMN A;  3T9J A;  3KXU A;  1NF4 A;  2V15 A;  2GYQ A;  4AM4 A;  3UNO A;  2ZG9 X;  3TA8 A;  5D8Y A;  3Q4N A;  4CY9 A;  3SID A;  1O9R A;  3PVY A;  4YKH A;  4PG1 A;  4ZL6 A;  2Z5P A;  5JKL A;  2VXI A;  3PWQ C;  2IB0 A;  5J9V A;  1B71 A;  2ZG7 X;  1MOJ A;  3HL1 A;  3NP0 X;  2JD6 0;  2YW6 A;  5LBH A;  1BCF A;  4DYY A;  1Z4A A;  2FHA A;  2C2U A;  3H7G A;  2YJJ A;  4ISM A;  3F34 A;  2CEI A;  3QB9 A;  5IX6 A;  4TOA A;  3PVY B;  4TOE A;  1NF6 A;  1ZS3 A;  2Y3Q A;  1RCC A;  4PG0 A;  1OTK A;  1VEL A;  3E1J A;  3F32 A;  4ZMC A;  2CLB A;  4RC8 A;  1BG7 A;  3FI6 A;  3AJO A;  3E1M A;  4XGS A;  5HQO A;  3AK9 A;  5D8Q A;  5D8P A;  1FHA A;  3UOI A;  4LYU A;  2OC5 A;  4LQV A;  4ML5 A;  1RCD A;  5GN8 A;  4EVB A;  3R2L A;  4TOF A;  3E6S A;  3KA3 A;  1JRE A;  4EVC A;  2V2L A;  4XKU A;  4II4 A;  2XGW A;  3Q4R A;  5JKL G;  2Z5Q A;  4TOD A;  2VZB A;  4ZTT A;  3F39 A;  4DYU A;  1O9I A;  4M35 A;  3RGD A;  5JAC A;  2D5K A;  3F33 A;  1LB3 A;  4ZL5 A;  3WVW A;  2CLU A;  1S30 A;  3BVE A;  4LPJ A;  3U90 A;  5GN8 B;  3R2O A;  3OGH A;  3AF7 X;  3R2K A;  5GU0 X;  4P18 A;  1Z6O M;  4RC6 A;  1JKV A;  4CVP A;  3BKN A;  1BFR A;  5J8S A;  1N1Q A;  1GWG A;  3BVK A;  4Y08 A;  3EZU A;  5CMQ A;  2IU2 A;  4XKS A;  2CN6 A;  3BVI A;  2VXX A;  4ITW A;  4IWJ A;  4KVS A;  4MJY A;  1QGH A;  2XJN A;  2QF9 A;  4RC6 B;  5FFA A;  1F30 A;  5ERJ A;  2ZA8 A;  3PW8 C;  5I4J A;  5LG8 A;  1LKP A;  2QQY A;  2G4H A;  2RBD A;  3WNW A;  1YUZ A;  1SOF A;  3GE4 A;  2CHI A;  3E1P A;  4DYX A;  5D8R A;  2X17 0;  2FL0 A;  3NOZ X;  4RC5 A;  1RCI A;  3KX9 A;  3PW1 A;  2V2R A;  4TOC A;  5K52 A;  1YV1 A;  4LQH A;  5FFB A;  4E6K A;  4ZKH A;  5D8X A;  2JD7 0;  2XJM A;  3F38 A;  4KVR A;  3QHB A;  3UOF A;  3WVU A;  3E1O A;  3RBC A;  3ES3 A;  5D8S A;  4ERU A;  4LYX A;  3PWQ A;  4RC7 A;  4RC5 B;  3OJ5 A;  3PW1 B;  3R2M A;  4ZLW A;  3ISF A;  5HJF A;  4DAS A;  3QHC A;  1TK6 A;  3RD0 A;  5K53 A;  2BKC A;  4LPM A;  5GOU A; 
#chains in the Genus database with same CATH topology
 2V2I A;  3HIU A;  4CVS A;  3AF9 X;  3AF8 X;  4CYA A;  1RYT A;  3R2R A;  3RAV A;  4ITT A;  1SQ3 A;  3R2S A;  2N02 A;  2PYB A;  3R2H A;  2FG4 A;  5FFD A;  2GS4 A;  1JIG A;  1MFR A;  2JD8 0;  4RC7 B;  1QYB A;  1H96 A;  4EVD A;  4KXR B;  3F37 A;  2FJC A;  2V2S A;  4CVR A;  3KA8 A;  1DAT A;  3A9Q A;  4MUD A;  1DPS A;  4YXM A;  3VVA A;  5E1U A;  5FEJ A;  2BJY A;  2V2J A;  3BVL A;  4E40 A;  4ZJK A;  1HRS A;  3E1L A;  3F35 A;  4ZKX A;  4CMY V;  5HJH A;  2CN7 A;  4DZ0 A;  4II4 B;  4CYB A;  2ZA7 A;  5GU2 X;  1YUX A;  3C1Z A;  4YXJ A;  1NNQ A;  3KWO A;  2MGY A;  4XKT A;  4OYN A;  4ETR A;  5E2D A;  3GHQ A;  4DYZ A;  3AK8 A;  2UX1 A;  1XZ3 A;  3BVF A;  2OH3 A;  3NP2 X;  1JKU A;  3VNX A;  2FG8 A;  4Z5S A;  4R42 A;  3C1Y A;  3SHX A;  3EZ0 A;  4LPN A;  2FZF A;  1TJO A;  3AJQ A;  1UVH A;  1AEW A;  1S3Q A;  2BK6 A;  1F33 A;  3FVB A;  3ERZ A;  2BW1 A;  4TOB A;  2YW7 A;  3SH6 A;  3QZ3 A;  3IS8 A;  2WWX B;  2Z6M A;  4TOG A;  2GYD A;  5HU6 D;  1L8H A;  1RCE A;  3MPS A;  1JYB A;  4CMY A;  2ITB A;  3W54 A;  1J30 A;  3SE1 A;  4EVE A;  5FFC A;  3WVV A;  4U3G A;  5CZU A;  1DVB A;  5JKM A;  3FSE A;  4WJG 4;  2V2N A;  2HR5 A;  1IES A;  4LQJ A;  5J93 A;  3M6J A;  4AM2 A;  3GVY A;  4TOH A;  3E2C A;  4ISP A;  5GU1 X;  2C2J A;  3BT5 A;  4TW3 A;  3E1Q A;  3PWF A;  4TO9 A;  2IY4 A;  3PW8 A;  1EUM A;  2XJO A;  5FFE A;  3QD8 A;  5CMR A;  3A68 A;  2CIH A;  3AJP A;  3PVT A;  4IWK A;  5J8W A;  1Z6O A;  3IQ1 A;  2XKQ A;  1JGC A;  2WLU A;  1R03 A;  4MKU A;  4DE6 A;  5C6F A;  1LKO A;  2V8U A;  3QVD A;  2WLA A;  1JI5 A;  2G38 B;  1VEQ A;  3PZA A;  4MN9 A;  3KHK A;  2HTN A;  2C2F A;  2Z5R A;  3Q4O A;  4KVQ A;  1ZUJ A;  3PVT B;  3PVR A;  2ZA6 A;  4W4K B;  5LS9 A;  4PGI A;  4DI0 A;  1XZ1 A;  3EGM A;  2V2M A;  3V3K B;  4W4L B;  1LKM A;  4MXP A;  4PGK A;  1KRQ A;  3O7S A;  4MY7 A;  3ISE A;  2FFX J;  4QUW A;  2C41 A;  3IS7 A;  4AM5 A;  5JKM G;  1TKO A;  5ERK A;  3E6R A;  4M33 A;  4Z3B A;  2V2P A;  1VEI A;  2V2O A;  4A25 A;  3D19 A;  3PVR B;  3KA6 A;  4M34 A;  2ZG8 X;  1JI4 A;  1NFV A;  3O7R A;  1S2Z A;  1VJX A;  4LQN A;  1JTS A;  2YJK A;  1VLG A;  2CF7 A;  4M32 A;  3Q4Q A;  2Z90 A;  3GGY A;  2W0O A;  5D8O A;  4REU A;  5AXS A;  5LG2 A;  4ZKW A;  3F36 A;  1TKP A;  3RE7 A;  3KA9 A;  1IER A;  4IXK A;  3FRS A;  1L8I A;  2CHP A;  4CVT A;  2WTL A;  2F7N A;  2FKZ A;  5GU3 X;  2ZUR X;  3E1N A;  3VV9 A;  1RCG A;  3KA4 A;  2C6R A;  1UMN A;  3T9J A;  3KXU A;  1NF4 A;  2V15 A;  2GYQ A;  4AM4 A;  3C23 A;  3UNO A;  2ZG9 X;  3TA8 A;  5D8Y A;  3Q4N A;  4CY9 A;  3SID A;  1O9R A;  3PVY A;  4YKH A;  3L0M A;  4PG1 A;  4ZL6 A;  2Z5P A;  5JKL A;  2VXI A;  3PWQ C;  2IB0 A;  5J9V A;  1B71 A;  2ZG7 X;  1MOJ A;  3GGZ A;  3HL1 A;  3NP0 X;  2JD6 0;  2YW6 A;  5LBH A;  1BCF A;  4DYY A;  1Z4A A;  2FHA A;  2C2U A;  3H7G A;  2YJJ A;  4ISM A;  3F34 A;  2CEI A;  3JZ9 A;  3QB9 A;  3UFB A;  5IX6 A;  4TOA A;  3PVY B;  2Y44 A;  4TOE A;  1NF6 A;  1ZS3 A;  2Y3Q A;  1RCC A;  4PG0 A;  1OTK A;  1VEL A;  3E1J A;  3F32 A;  4ZMC A;  2CLB A;  4RC8 A;  1BG7 A;  2CWL A;  3C21 A;  3FI6 A;  3AJO A;  3E1M A;  4XGS A;  5HQO A;  4YVZ A;  3AK9 A;  5D8Q A;  5D8P A;  1FHA A;  3FRR A;  3UOI A;  4LYU A;  2OC5 A;  4LQV A;  4ML5 A;  1RCD A;  5GN8 A;  4EVB A;  3R2L A;  4TOF A;  3E6S A;  3KA3 A;  1JRE A;  4EVC A;  2V2L A;  4XKU A;  4II4 A;  2XGW A;  3Q4R A;  2V8T A;  5JKL G;  2Z5Q A;  4TOD A;  2VZB A;  4ZTT A;  4X0J A;  3F39 A;  4DYU A;  1O9I A;  4M35 A;  3RGD A;  5JAC A;  2D5K A;  3F33 A;  1LB3 A;  4ZL5 A;  3WVW A;  2CLU A;  1S30 A;  3BVE A;  4LPJ A;  3U90 A;  5GN8 B;  3R2O A;  3OGH A;  3AF7 X;  3LKD A;  5JDO A;  3R2K A;  5GU0 X;  4P18 A;  1Z6O M;  4RC6 A;  1JKV A;  4CVP A;  3BKN A;  1BFR A;  5J8S A;  1N1Q A;  1GWG A;  3BVK A;  4Y08 A;  3EZU A;  5CMQ A;  2IU2 A;  3N6O A;  2OKC A;  4XKS A;  2CN6 A;  2AR0 A;  3BVI A;  2VXX A;  4ITW A;  4IWJ A;  4KVS A;  4MJY A;  5JDO B;  1QGH A;  2XJN A;  2QF9 A;  4RC6 B;  5FFA A;  1F30 A;  5ERJ A;  2ZA8 A;  3PW8 C;  5I4J A;  5LG8 A;  1LKP A;  2QQY A;  2G4H A;  2RBD A;  3WNW A;  1YUZ A;  1SOF A;  3GE4 A;  2CHI A;  3E1P A;  4DYX A;  5D8R A;  2X17 0;  2FL0 A;  3NOZ X;  4RC5 A;  3JZA B;  1RCI A;  3KX9 A;  3PW1 A;  2V2R A;  4TOC A;  5K52 A;  1YV1 A;  3KDQ A;  4LQH A;  5FFB A;  4E6K A;  4ZKH A;  5D8X A;  2JD7 0;  2XJM A;  3F38 A;  4KVR A;  3QHB A;  3UOF A;  3WVU A;  3E1O A;  3RBC A;  3ES3 A;  5D8S A;  4ERU A;  4LYX A;  3DBY A;  3PWQ A;  4RC7 A;  4RC5 B;  3OJ5 A;  3PW1 B;  3R2M A;  4ZLW A;  3ISF A;  5HJF A;  4DAS A;  3QHC A;  1TK6 A;  3RD0 A;  5K53 A;  2BKC A;  4LPM A;  5GOU A; 
#chains in the Genus database with same CATH homology
 2V2I A;  3HIU A;  4CVS A;  3AF9 X;  3AF8 X;  4CYA A;  1RYT A;  3R2R A;  3RAV A;  4ITT A;  1SQ3 A;  3R2S A;  2N02 A;  2PYB A;  3R2H A;  2FG4 A;  5FFD A;  2GS4 A;  1JIG A;  1MFR A;  2JD8 0;  4RC7 B;  1QYB A;  1H96 A;  4EVD A;  4KXR B;  3F37 A;  2FJC A;  2V2S A;  4CVR A;  3KA8 A;  1DAT A;  3A9Q A;  4MUD A;  1DPS A;  4YXM A;  3VVA A;  5E1U A;  5FEJ A;  2BJY A;  2V2J A;  3BVL A;  4E40 A;  4ZJK A;  1HRS A;  3E1L A;  3F35 A;  4ZKX A;  4CMY V;  5HJH A;  2CN7 A;  4DZ0 A;  4II4 B;  4CYB A;  2ZA7 A;  5GU2 X;  1YUX A;  3C1Z A;  4YXJ A;  1NNQ A;  3KWO A;  2MGY A;  4XKT A;  4OYN A;  4ETR A;  5E2D A;  3GHQ A;  4DYZ A;  3AK8 A;  2UX1 A;  1XZ3 A;  3BVF A;  2OH3 A;  3NP2 X;  1JKU A;  3VNX A;  2FG8 A;  4Z5S A;  4R42 A;  3C1Y A;  3SHX A;  3EZ0 A;  4LPN A;  2FZF A;  1TJO A;  3AJQ A;  1UVH A;  1AEW A;  1S3Q A;  2BK6 A;  1F33 A;  3FVB A;  3ERZ A;  2BW1 A;  4TOB A;  2YW7 A;  3SH6 A;  3QZ3 A;  3IS8 A;  2WWX B;  2Z6M A;  4TOG A;  2GYD A;  5HU6 D;  1L8H A;  1RCE A;  3MPS A;  1JYB A;  4CMY A;  2ITB A;  3W54 A;  1J30 A;  3SE1 A;  4EVE A;  5FFC A;  3WVV A;  4U3G A;  5CZU A;  1DVB A;  5JKM A;  3FSE A;  4WJG 4;  2V2N A;  2HR5 A;  1IES A;  4LQJ A;  5J93 A;  3M6J A;  4AM2 A;  3GVY A;  4TOH A;  3E2C A;  4ISP A;  5GU1 X;  2C2J A;  3BT5 A;  4TW3 A;  3E1Q A;  3PWF A;  4TO9 A;  2IY4 A;  3PW8 A;  1EUM A;  2XJO A;  5FFE A;  3QD8 A;  5CMR A;  3A68 A;  2CIH A;  3AJP A;  3PVT A;  4IWK A;  5J8W A;  1Z6O A;  3IQ1 A;  2XKQ A;  1JGC A;  2WLU A;  1R03 A;  4MKU A;  4DE6 A;  5C6F A;  1LKO A;  2V8U A;  3QVD A;  2WLA A;  1JI5 A;  2G38 B;  1VEQ A;  3PZA A;  4MN9 A;  3KHK A;  2HTN A;  2C2F A;  2Z5R A;  3Q4O A;  4KVQ A;  1ZUJ A;  3PVT B;  3PVR A;  2ZA6 A;  4W4K B;  5LS9 A;  4PGI A;  4DI0 A;  1XZ1 A;  3EGM A;  2V2M A;  3V3K B;  4W4L B;  1LKM A;  4MXP A;  4PGK A;  1KRQ A;  3O7S A;  4MY7 A;  3ISE A;  2FFX J;  4QUW A;  2C41 A;  3IS7 A;  4AM5 A;  5JKM G;  1TKO A;  5ERK A;  3E6R A;  4M33 A;  4Z3B A;  2V2P A;  1VEI A;  2V2O A;  4A25 A;  3D19 A;  3PVR B;  3KA6 A;  4M34 A;  2ZG8 X;  1JI4 A;  1NFV A;  3O7R A;  1S2Z A;  1VJX A;  4LQN A;  1JTS A;  2YJK A;  1VLG A;  2CF7 A;  4M32 A;  3Q4Q A;  2Z90 A;  3GGY A;  2W0O A;  5D8O A;  4REU A;  5AXS A;  5LG2 A;  4ZKW A;  3F36 A;  1TKP A;  3RE7 A;  3KA9 A;  1IER A;  4IXK A;  3FRS A;  1L8I A;  2CHP A;  4CVT A;  2WTL A;  2F7N A;  2FKZ A;  5GU3 X;  2ZUR X;  3E1N A;  3VV9 A;  1RCG A;  3KA4 A;  2C6R A;  1UMN A;  3T9J A;  3KXU A;  1NF4 A;  2V15 A;  2GYQ A;  4AM4 A;  3C23 A;  3UNO A;  2ZG9 X;  3TA8 A;  5D8Y A;  3Q4N A;  4CY9 A;  3SID A;  1O9R A;  3PVY A;  4YKH A;  3L0M A;  4PG1 A;  4ZL6 A;  2Z5P A;  5JKL A;  2VXI A;  3PWQ C;  2IB0 A;  5J9V A;  1B71 A;  2ZG7 X;  1MOJ A;  3GGZ A;  3HL1 A;  3NP0 X;  2JD6 0;  2YW6 A;  5LBH A;  1BCF A;  4DYY A;  1Z4A A;  2FHA A;  2C2U A;  3H7G A;  2YJJ A;  4ISM A;  3F34 A;  2CEI A;  3JZ9 A;  3QB9 A;  3UFB A;  5IX6 A;  4TOA A;  3PVY B;  2Y44 A;  4TOE A;  1NF6 A;  1ZS3 A;  2Y3Q A;  1RCC A;  4PG0 A;  1OTK A;  1VEL A;  3E1J A;  3F32 A;  4ZMC A;  2CLB A;  4RC8 A;  1BG7 A;  2CWL A;  3C21 A;  3FI6 A;  3AJO A;  3E1M A;  4XGS A;  5HQO A;  4YVZ A;  3AK9 A;  5D8Q A;  5D8P A;  1FHA A;  3FRR A;  3UOI A;  4LYU A;  2OC5 A;  4LQV A;  4ML5 A;  1RCD A;  5GN8 A;  4EVB A;  3R2L A;  4TOF A;  3E6S A;  3KA3 A;  1JRE A;  4EVC A;  2V2L A;  4XKU A;  4II4 A;  2XGW A;  3Q4R A;  2V8T A;  5JKL G;  2Z5Q A;  4TOD A;  2VZB A;  4ZTT A;  4X0J A;  3F39 A;  4DYU A;  1O9I A;  4M35 A;  3RGD A;  5JAC A;  2D5K A;  3F33 A;  1LB3 A;  4ZL5 A;  3WVW A;  2CLU A;  1S30 A;  3BVE A;  4LPJ A;  3U90 A;  5GN8 B;  3R2O A;  3OGH A;  3AF7 X;  3LKD A;  5JDO A;  3R2K A;  5GU0 X;  4P18 A;  1Z6O M;  4RC6 A;  1JKV A;  4CVP A;  3BKN A;  1BFR A;  5J8S A;  1N1Q A;  1GWG A;  3BVK A;  4Y08 A;  3EZU A;  5CMQ A;  2IU2 A;  3N6O A;  2OKC A;  4XKS A;  2CN6 A;  2AR0 A;  3BVI A;  2VXX A;  4ITW A;  4IWJ A;  4KVS A;  4MJY A;  5JDO B;  1QGH A;  2XJN A;  2QF9 A;  4RC6 B;  5FFA A;  1F30 A;  5ERJ A;  2ZA8 A;  3PW8 C;  5I4J A;  5LG8 A;  1LKP A;  2QQY A;  2G4H A;  2RBD A;  3WNW A;  1YUZ A;  1SOF A;  3GE4 A;  2CHI A;  3E1P A;  4DYX A;  5D8R A;  2X17 0;  2FL0 A;  3NOZ X;  4RC5 A;  3JZA B;  1RCI A;  3KX9 A;  3PW1 A;  2V2R A;  4TOC A;  5K52 A;  1YV1 A;  3KDQ A;  4LQH A;  5FFB A;  4E6K A;  4ZKH A;  5D8X A;  2JD7 0;  2XJM A;  3F38 A;  4KVR A;  3QHB A;  3UOF A;  3WVU A;  3E1O A;  3RBC A;  3ES3 A;  5D8S A;  4ERU A;  4LYX A;  3DBY A;  3PWQ A;  4RC7 A;  4RC5 B;  3OJ5 A;  3PW1 B;  3R2M A;  4ZLW A;  3ISF A;  5HJF A;  4DAS A;  3QHC A;  1TK6 A;  3RD0 A;  5K53 A;  2BKC A;  4LPM A;  5GOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...