2WLUA

Iron-bound crystal structure of streptococcus pyogenes dpr
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
172
structure length
166
Chain Sequence
TLVENIYASVTHNSKNEKTKAVLNQAVADLSVAASIVHQVHWYMRGPGFLYLHPKMDELLDSLNANLDEVSERLITIGGAPYSTLAEFSKHSKLDEAKGTYDKTVAQHLARLVEVYLYLSSLYQVGLDITDEEGDAGTNDLFTAAKTEAEKTIWMLQAERGQGPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DPS-LIKE PEROXIDE RESISTANCE PROTEIN
publication title Crystal Structures of Streptococcus Pyogenes Dpr Reveal a Dodecameric Iron-Binding Protein with a Ferroxidase Site.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 75
structure length 166
sequence length 172
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2009-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2wluA00
2CLUA 5D8RA 3VNXA 2Z5RA 4ZKWA 4ZL6A 1YUZA 3PVTA 1F33A 4II4B 3AK9A 2JD80 2OC5A 2CN6A 4DE6A 3R2KA 2IY4A 3BVIA 2CEIA 3RBCA 4LYXA 2C2JA 5J8WA 1VJXA 4ITWA 5FFCA 2Z90A 4CYAA 4ETRA 3F34A 5J93A 3PVTB 3R2HA 3PVYA 3HL1A 1L8IA 3QVDA 2C2UA 1JI5A 1KRQA 1BFRA 2VZBA 3ERZA 4MN9A 5E1UA 5C6FA 3UOIA 1IERA 5D8PA 2Z5PA 3E6SA 4A25A 1LKMA 4DYYA 2WTLA 3RAVA 1MOJA 4CVPA 2FG8A 1RCIA 2XJMA 4TOAA 3ES3A 5HQOA 4P18A 2RBDA 1S30A 1JKUA 5JKMG 1DVBA 2C6RA 2F7NA 3F39A 4LQHA 4DI0A 3AJQA 4TODA 3KXUA 3H7GA 3RE7A 4OYNA 3KA6A 5JKLG 1OTKA 2V2IA 3R2LA 4REUA 3AF9X 2HR5A 4RC6A 5D8SA 5J8SA 3U90A 1RCCA 3F38A 2Y3QA 3F35A 3Q4RA 2CN7A 3KWOA 3UNOA 2ZA8A 3QZ3A 3PW8A 4RC8A 1YV1A 2VXIA 3KX9A 3KA3A 4MY7A 2D5KA 3F32A 1YUXA 2XJNA 4M34A 4XKUA 3QD8A 4XKSA 3E1LA 3E1MA 1BCFA 1Z4AA 4ERUA 2V2PA 4ITTA 1FHAA 5D8YA 3AF8X 3OJ5A 5HJFA 2ZG7X 4ZKHA 3SE1A 3GE4A 2FFXJ 4KVQA 3EZ0A 5CZUA 1J30A 3MPSA 2C2FA 3E1NA 4TW3A 1JGCA 3SH6A 1XZ1A 1ZS3A 3PW8C 3QB9A 4M32A 5FFEA 3Q4OA 3R2OA 2V2MA 5GOUA 3BKNA 1NF6A 4XGSA 3EGMA 3UOFA 1SQ3A 2V2LA 2V2JA 3PWQC 5K53A 2FKZA 3KA9A 4Z3BA 2V2RA 4EVEA 3PW1A 3NOZX 4IWJA 2X170 3SHXA 4EVBA 4PGKA 1HRSA 3NP2X 5AXSA 1SOFA 3WVWA 1MFRA 1JREA 1RYTA 2IB0A 2C41A 5FEJA 4TO9A 2VXXA 2ZG9X 1VELA 4CMYA 1RCDA 4LPJA 3PVYB 5J9VA 5I4JA 3PW1B 3IS8A 3IQ1A 2ZG8X 4TOEA 2YW6A 1DATA 3BVEA 4Y08A 2FG4A 5LG8A 1Z6OA 4ZJKA 3T9JA 1DPSA 1F30A 5D8OA 3A68A 3PVRA 5E2DA 3R2MA 1QGHA 5D8XA 3EZUA 3F33A 2CIHA 2CF7A 4YKHA 3AJPA 5FFDA 3O7RA 1JI4A 2FJCA 4PGIA 3ISFA 3Q4QA 5ERKA 4TOBA 3BVFA 2YW7A 4DYUA 2FHAA 4DZ0A 3R2RA 2YJJA 4RC5A 5GU1X 1R03A 4IWKA 2W0OA 3PVRB 1TKOA 1NNQA 4MJYA 4RC6B 2Z5QA 1Z6OM 2CHPA 3WNWA 4MKUA 3QHBA 5CMRA 3OGHA 1VEIA 5FFBA 2ZA7A 3E1OA 3SIDA 3GHQA 3WVVA 2FZFA 4RC5B 3E2CA 2V15A 1QYBA 4ZKXA 3KA4A 4PG1A 3QHCA 1L8HA 5GU3X 3AJOA 2BW1A 4M35A 1N1QA 2ZURX 3IS7A 1TK6A 2GS4A 4CVRA 3WVUA 1NF4A 2V2SA 4ISMA 1VEQA 4DYXA 2XGWA 2ZA6A 3ISEA 4DYZA 3Q4NA 4KVSA 4XKTA 5IX6A 1O9IA 2CHIA 5GU2X 2UX1A 1S2ZA 4CVSA 4Z5SA 2JD60 4E6KA 2IU2A 3HIUA 5ERJA 4ISPA 2BJYA 1ZUJA 4LYUA 1BG7A 1RCEA 1UMNA 4CYBA 3R2SA 2WLUA 3F36A 5HJHA 2XKQA 4TOHA 1LB3A 2CLBA 4LQVA 1XZ3A 4R42A 2HTNA 2Z6MA 1GWGA 4U3GA 4ML5A 3RD0A 1JIGA 4ZTTA 4RC7A 2QQYA 1JYBA 4PG0A 3FVBA 4TOFA 2YJKA 4TOGA 4M33A 1NFVA 2GYDA 3KA8A 5CMQA 1IESA 2BK6A 1H96A 2V2OA 3F37A 2FL0A 1AEWA 2PYBA 5JACA 2GYQA 1VLGA 2V2NA 4MUDA 4RC7B 3FSEA 1JTSA 1LKOA 2G4HA 1UVHA 3TA8A 5D8QA 4QUWA 1RCGA 3GVYA 4CVTA 2JD70 4EVCA 1TJOA 2OH3A 3NP0X 4LPMA 4CMYV 3E1QA 4CY9A 5GN8A 3AF7X 3PWFA 3RGDA 3BVKA 1TKPA 2WLAA 4AM4A 4ZL5A 4TOCA 4KVRA 3BVLA 1B71A 3PZAA 3E1PA 1EUMA 4DASA 4EVDA 1JKVA 1LKPA 2ITBA 4AM5A 5LS9A 3A9QA 4LQNA 5K52A 5GN8B 5JKMA 3BT5A 5LG2A 4IXKA 3AK8A 1S3QA 3FI6A 3PWQA 4AM2A 5LBHA 3E6RA 4II4A 5JKLA 4ZLWA 2XJOA 3O7SA 3E1JA 2QF9A 1O9RA 4ZMCA 5FFAA 4LQJA 5GU0X 4LPNA 2BKCA
chains in the Genus database with same CATH superfamily
3D19A 2CLUA 5D8RA 3VNXA 2Z5RA 3C1ZA 4MXPA 4ZKWA 4ZL6A 1YUZA 3PVTA 1F33A 4II4B 3AK9A 2JD80 2OC5A 2CN6A 4DE6A 3R2KA 2IY4A 3BVIA 3KDQA 2CEIA 3RBCA 4LYXA 2C2JA 5J8WA 1VJXA 4ITWA 5FFCA 2Z90A 4CYAA 4ETRA 3F34A 5J93A 3PVTB 3R2HA 3PVYA 3HL1A 1L8IA 3QVDA 3LKDA 2C2UA 1JI5A 1KRQA 1BFRA 2VZBA 3ERZA 4MN9A 5E1UA 5C6FA 3UOIA 1IERA 5D8PA 2Z5PA 3E6SA 2AR0A 4A25A 1LKMA 4DYYA 4YXMA 2WTLA 2V8UA 3RAVA 1MOJA 4CVPA 2FG8A 1RCIA 2XJMA 4TOAA 3ES3A 5HQOA 4P18A 2RBDA 1S30A 1JKUA 5JKMG 1DVBA 2C6RA 2F7NA 3F39A 4LQHA 4DI0A 3AJQA 4TODA 3KXUA 3H7GA 3RE7A 4OYNA 4W4LB 3KA6A 5JKLG 1OTKA 2V2IA 3R2LA 4REUA 3AF9X 2HR5A 4RC6A 5D8SA 5J8SA 3U90A 1RCCA 3F38A 2Y3QA 3F35A 3Q4RA 2CN7A 3KWOA 3UNOA 2ZA8A 3QZ3A 3PW8A 3KHKA 4RC8A 1YV1A 2VXIA 3KX9A 3KA3A 3JZAB 4E40A 4MY7A 2D5KA 3F32A 1YUXA 2XJNA 4X0JA 4M34A 4XKUA 3QD8A 4XKSA 3E1LA 3E1MA 1BCFA 3GGZA 5JDOA 1Z4AA 3DBYA 2V2PA 4ERUA 4ITTA 1FHAA 5D8YA 3AF8X 3OJ5A 5HJFA 3VVAA 3V3KB 3FRSA 2ZG7X 4ZKHA 3SE1A 3GE4A 2FFXJ 4KVQA 3EZ0A 5CZUA 1J30A 3MPSA 2C2FA 3E1NA 4TW3A 1JGCA 3SH6A 1XZ1A 1ZS3A 3PW8C 3JZ9A 3QB9A 4M32A 5FFEA 3Q4OA 3R2OA 2V2MA 5GOUA 3BKNA 1NF6A 4XGSA 3EGMA 3UOFA 1SQ3A 2V2LA 2V2JA 3PWQC 5K53A 2FKZA 3KA9A 4Z3BA 2V2RA 4EVEA 3PW1A 3M6JA 3NOZX 4IWJA 2X170 3SHXA 4EVBA 4PGKA 1HRSA 3NP2X 5AXSA 1SOFA 3WVWA 1MFRA 1JREA 1RYTA 2IB0A 2C41A 5FEJA 4TO9A 2VXXA 2ZG9X 1VELA 4CMYA 1RCDA 4LPJA 3PVYB 5J9VA 5I4JA 3PW1B 3IS8A 4W4KB 3IQ1A 2ZG8X 4TOEA 2YW6A 1DATA 3BVEA 4Y08A 2FG4A 5LG8A 1Z6OA 4ZJKA 3T9JA 1DPSA 1F30A 3N6OA 2OKCA 5D8OA 3A68A 3PVRA 5E2DA 3R2MA 1QGHA 5D8XA 3EZUA 3F33A 2CIHA 2CF7A 4YKHA 3AJPA 5FFDA 3O7RA 1JI4A 2FJCA 4PGIA 3ISFA 3Q4QA 5ERKA 4TOBA 3BVFA 2YW7A 4DYUA 2FHAA 2N02A 4DZ0A 3R2RA 2YJJA 4RC5A 5GU1X 1R03A 4IWKA 2W0OA 3PVRB 1TKOA 1NNQA 4MJYA 4RC6B 2Z5QA 1Z6OM 2CHPA 3WNWA 4MKUA 3QHBA 5CMRA 3OGHA 1VEIA 5FFBA 2ZA7A 3E1OA 3SIDA 3GHQA 3WVVA 2FZFA 4RC5B 3E2CA 2V15A 1QYBA 4ZKXA 3KA4A 4PG1A 3QHCA 1L8HA 5GU3X 3AJOA 2BW1A 4M35A 1N1QA 5JDOB 2ZURX 2CWLA 3IS7A 1TK6A 2GS4A 4CVRA 3WVUA 1NF4A 2V2SA 3VV9A 4ISMA 1VEQA 4DYXA 2XGWA 2ZA6A 3ISEA 4DYZA 3Q4NA 4KVSA 3W54A 4XKTA 5IX6A 2MGYA 1O9IA 3L0MA 2CHIA 5GU2X 2UX1A 1S2ZA 4CVSA 4Z5SA 2JD60 4E6KA 2IU2A 3HIUA 5ERJA 4ISPA 2BJYA 1ZUJA 4LYUA 1BG7A 1RCEA 2Y44A 1UMNA 4CYBA 3R2SA 4YXJA 2WLUA 3F36A 5HJHA 2XKQA 4TOHA 1LB3A 2CLBA 4YVZA 4LQVA 1XZ3A 4R42A 2HTNA 2Z6MA 1GWGA 4U3GA 4ML5A 3UFBA 3RD0A 1JIGA 4ZTTA 4RC7A 2QQYA 1JYBA 4PG0A 3FVBA 4TOFA 2YJKA 4TOGA 4M33A 1NFVA 2GYDA 3KA8A 5CMQA 1IESA 2G38B 2BK6A 1H96A 2V2OA 3F37A 2FL0A 1AEWA 2PYBA 3FRRA 4KXRB 2GYQA 5JACA 1VLGA 2V2NA 4MUDA 4RC7B 3FSEA 1JTSA 1LKOA 2G4HA 1UVHA 3TA8A 5D8QA 4QUWA 4WJG4 1RCGA 3GVYA 4CVTA 2JD70 4EVCA 1TJOA 2OH3A 3C1YA 3NP0X 4LPMA 4CMYV 3E1QA 4CY9A 5GN8A 3AF7X 3PWFA 3RGDA 3BVKA 1TKPA 2WLAA 4AM4A 4ZL5A 3C23A 4TOCA 4KVRA 3BVLA 1B71A 3PZAA 3E1PA 1EUMA 4DASA 4EVDA 1JKVA 1LKPA 2ITBA 4AM5A 5LS9A 3A9QA 4LQNA 5K52A 5GN8B 5JKMA 3BT5A 5LG2A 4IXKA 3AK8A 2V8TA 1S3QA 3FI6A 3PWQA 4AM2A 2WWXB 5LBHA 3E6RA 4II4A 5JKLA 4ZLWA 2XJOA 3O7SA 3GGYA 3E1JA 2QF9A 1O9RA 3C21A 4ZMCA 4LQJA 5FFAA 5GU0X 4LPNA 2BKCA 5HU6D
chains in the Genus database with same CATH topology
3D19A 2CLUA 5D8RA 3VNXA 2Z5RA 3C1ZA 4MXPA 4ZKWA 4ZL6A 1YUZA 3PVTA 1F33A 4II4B 3AK9A 2JD80 2OC5A 2CN6A 4DE6A 3R2KA 2IY4A 3BVIA 3KDQA 2CEIA 3RBCA 4LYXA 2C2JA 5J8WA 1VJXA 4ITWA 5FFCA 2Z90A 4CYAA 4ETRA 3F34A 5J93A 3PVTB 3R2HA 3PVYA 3HL1A 1L8IA 3QVDA 3LKDA 2C2UA 1JI5A 1KRQA 1BFRA 2VZBA 3ERZA 4MN9A 5E1UA 5C6FA 3UOIA 1IERA 5D8PA 2Z5PA 3E6SA 2AR0A 4A25A 1LKMA 4DYYA 4YXMA 2WTLA 2V8UA 3RAVA 1MOJA 4CVPA 2FG8A 1RCIA 2XJMA 4TOAA 3ES3A 5HQOA 4P18A 2RBDA 1S30A 1JKUA 5JKMG 1DVBA 2C6RA 2F7NA 3F39A 4LQHA 4DI0A 3AJQA 4TODA 3KXUA 3H7GA 3RE7A 4OYNA 4W4LB 3KA6A 5JKLG 1OTKA 2V2IA 3R2LA 4REUA 3AF9X 2HR5A 4RC6A 5D8SA 5J8SA 3U90A 1RCCA 3F38A 2Y3QA 3F35A 3Q4RA 2CN7A 3KWOA 3UNOA 2ZA8A 3QZ3A 3PW8A 3KHKA 4RC8A 1YV1A 2VXIA 3KX9A 3KA3A 3JZAB 4E40A 4MY7A 2D5KA 3F32A 1YUXA 2XJNA 4X0JA 4M34A 4XKUA 3QD8A 4XKSA 3E1LA 3E1MA 1BCFA 3GGZA 5JDOA 1Z4AA 3DBYA 2V2PA 4ERUA 4ITTA 1FHAA 5D8YA 3AF8X 3OJ5A 5HJFA 3VVAA 3V3KB 3FRSA 2ZG7X 4ZKHA 3SE1A 3GE4A 2FFXJ 4KVQA 3EZ0A 5CZUA 1J30A 3MPSA 2C2FA 3E1NA 4TW3A 1JGCA 3SH6A 1XZ1A 1ZS3A 3PW8C 3JZ9A 3QB9A 4M32A 5FFEA 3Q4OA 3R2OA 2V2MA 5GOUA 3BKNA 1NF6A 4XGSA 3EGMA 3UOFA 1SQ3A 2V2LA 2V2JA 3PWQC 5K53A 2FKZA 3KA9A 4Z3BA 2V2RA 4EVEA 3PW1A 3M6JA 3NOZX 4IWJA 2X170 3SHXA 4EVBA 4PGKA 1HRSA 3NP2X 5AXSA 1SOFA 3WVWA 1MFRA 1JREA 1RYTA 2IB0A 2C41A 5FEJA 4TO9A 2VXXA 2ZG9X 1VELA 4CMYA 1RCDA 4LPJA 3PVYB 5J9VA 5I4JA 3PW1B 3IS8A 4W4KB 3IQ1A 2ZG8X 4TOEA 2YW6A 1DATA 3BVEA 4Y08A 2FG4A 5LG8A 1Z6OA 4ZJKA 3T9JA 1DPSA 1F30A 3N6OA 2OKCA 5D8OA 3A68A 3PVRA 5E2DA 3R2MA 1QGHA 5D8XA 3EZUA 3F33A 2CIHA 2CF7A 4YKHA 3AJPA 5FFDA 3O7RA 1JI4A 2FJCA 4PGIA 3ISFA 3Q4QA 5ERKA 4TOBA 3BVFA 2YW7A 4DYUA 2FHAA 2N02A 4DZ0A 3R2RA 2YJJA 4RC5A 5GU1X 1R03A 4IWKA 2W0OA 3PVRB 1TKOA 1NNQA 4MJYA 4RC6B 2Z5QA 1Z6OM 2CHPA 3WNWA 4MKUA 3QHBA 5CMRA 3OGHA 1VEIA 5FFBA 2ZA7A 3E1OA 3SIDA 3GHQA 3WVVA 2FZFA 4RC5B 3E2CA 2V15A 1QYBA 4ZKXA 3KA4A 4PG1A 3QHCA 1L8HA 5GU3X 3AJOA 2BW1A 4M35A 1N1QA 5JDOB 2ZURX 2CWLA 3IS7A 1TK6A 2GS4A 4CVRA 3WVUA 1NF4A 2V2SA 3VV9A 4ISMA 1VEQA 4DYXA 2XGWA 2ZA6A 3ISEA 4DYZA 3Q4NA 4KVSA 3W54A 4XKTA 5IX6A 2MGYA 1O9IA 3L0MA 2CHIA 5GU2X 2UX1A 1S2ZA 4CVSA 4Z5SA 2JD60 4E6KA 2IU2A 3HIUA 5ERJA 4ISPA 2BJYA 1ZUJA 4LYUA 1BG7A 1RCEA 2Y44A 1UMNA 4CYBA 3R2SA 4YXJA 2WLUA 3F36A 5HJHA 2XKQA 4TOHA 1LB3A 2CLBA 4YVZA 4LQVA 1XZ3A 4R42A 2HTNA 2Z6MA 1GWGA 4U3GA 4ML5A 3UFBA 3RD0A 1JIGA 4ZTTA 4RC7A 2QQYA 1JYBA 4PG0A 3FVBA 4TOFA 2YJKA 4TOGA 4M33A 1NFVA 2GYDA 3KA8A 5CMQA 1IESA 2G38B 2BK6A 1H96A 2V2OA 3F37A 2FL0A 1AEWA 2PYBA 3FRRA 4KXRB 2GYQA 5JACA 1VLGA 2V2NA 4MUDA 4RC7B 3FSEA 1JTSA 1LKOA 2G4HA 1UVHA 3TA8A 5D8QA 4QUWA 4WJG4 1RCGA 3GVYA 4CVTA 2JD70 4EVCA 1TJOA 2OH3A 3C1YA 3NP0X 4LPMA 4CMYV 3E1QA 4CY9A 5GN8A 3AF7X 3PWFA 3RGDA 3BVKA 1TKPA 2WLAA 4AM4A 4ZL5A 3C23A 4TOCA 4KVRA 3BVLA 1B71A 3PZAA 3E1PA 1EUMA 4DASA 4EVDA 1JKVA 1LKPA 2ITBA 4AM5A 5LS9A 3A9QA 4LQNA 5K52A 5GN8B 5JKMA 3BT5A 5LG2A 4IXKA 3AK8A 2V8TA 1S3QA 3FI6A 3PWQA 4AM2A 2WWXB 5LBHA 3E6RA 4II4A 5JKLA 4ZLWA 2XJOA 3O7SA 3GGYA 3E1JA 2QF9A 1O9RA 3C21A 4ZMCA 4LQJA 5FFAA 5GU0X 4LPNA 2BKCA 5HU6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CLU A;  5D8R A;  3VNX A;  2Z5R A;  4ZKW A;  4ZL6 A;  1YUZ A;  3PVT A;  1F33 A;  4II4 B;  3AK9 A;  2JD8 0;  2OC5 A;  2CN6 A;  4DE6 A;  3R2K A;  2IY4 A;  3BVI A;  2CEI A;  3RBC A;  4LYX A;  2C2J A;  5J8W A;  1VJX A;  4ITW A;  5FFC A;  2Z90 A;  4CYA A;  4ETR A;  3F34 A;  5J93 A;  3PVT B;  3R2H A;  3PVY A;  3HL1 A;  1L8I A;  3QVD A;  2C2U A;  1JI5 A;  1KRQ A;  1BFR A;  2VZB A;  3ERZ A;  4MN9 A;  5E1U A;  5C6F A;  3UOI A;  1IER A;  5D8P A;  2Z5P A;  3E6S A;  4A25 A;  1LKM A;  4DYY A;  2WTL A;  3RAV A;  1MOJ A;  4CVP A;  2FG8 A;  1RCI A;  2XJM A;  4TOA A;  3ES3 A;  5HQO A;  4P18 A;  2RBD A;  1S30 A;  1JKU A;  5JKM G;  1DVB A;  2C6R A;  2F7N A;  3F39 A;  4LQH A;  4DI0 A;  3AJQ A;  4TOD A;  3KXU A;  3H7G A;  3RE7 A;  4OYN A;  3KA6 A;  5JKL G;  1OTK A;  2V2I A;  3R2L A;  4REU A;  3AF9 X;  2HR5 A;  4RC6 A;  5D8S A;  5J8S A;  3U90 A;  1RCC A;  3F38 A;  2Y3Q A;  3F35 A;  3Q4R A;  2CN7 A;  3KWO A;  3UNO A;  2ZA8 A;  3QZ3 A;  3PW8 A;  4RC8 A;  1YV1 A;  2VXI A;  3KX9 A;  3KA3 A;  4MY7 A;  2D5K A;  3F32 A;  1YUX A;  2XJN A;  4M34 A;  4XKU A;  3QD8 A;  4XKS A;  3E1L A;  3E1M A;  1BCF A;  1Z4A A;  4ERU A;  2V2P A;  4ITT A;  1FHA A;  5D8Y A;  3AF8 X;  3OJ5 A;  5HJF A;  2ZG7 X;  4ZKH A;  3SE1 A;  3GE4 A;  2FFX J;  4KVQ A;  3EZ0 A;  5CZU A;  1J30 A;  3MPS A;  2C2F A;  3E1N A;  4TW3 A;  1JGC A;  3SH6 A;  1XZ1 A;  1ZS3 A;  3PW8 C;  3QB9 A;  4M32 A;  5FFE A;  3Q4O A;  3R2O A;  2V2M A;  5GOU A;  3BKN A;  1NF6 A;  4XGS A;  3EGM A;  3UOF A;  1SQ3 A;  2V2L A;  2V2J A;  3PWQ C;  5K53 A;  2FKZ A;  3KA9 A;  4Z3B A;  2V2R A;  4EVE A;  3PW1 A;  3NOZ X;  4IWJ A;  2X17 0;  3SHX A;  4EVB A;  4PGK A;  1HRS A;  3NP2 X;  5AXS A;  1SOF A;  3WVW A;  1MFR A;  1JRE A;  1RYT A;  2IB0 A;  2C41 A;  5FEJ A;  4TO9 A;  2VXX A;  2ZG9 X;  1VEL A;  4CMY A;  1RCD A;  4LPJ A;  3PVY B;  5J9V A;  5I4J A;  3PW1 B;  3IS8 A;  3IQ1 A;  2ZG8 X;  4TOE A;  2YW6 A;  1DAT A;  3BVE A;  4Y08 A;  2FG4 A;  5LG8 A;  1Z6O A;  4ZJK A;  3T9J A;  1DPS A;  1F30 A;  5D8O A;  3A68 A;  3PVR A;  5E2D A;  3R2M A;  1QGH A;  5D8X A;  3EZU A;  3F33 A;  2CIH A;  2CF7 A;  4YKH A;  3AJP A;  5FFD A;  3O7R A;  1JI4 A;  2FJC A;  4PGI A;  3ISF A;  3Q4Q A;  5ERK A;  4TOB A;  3BVF A;  2YW7 A;  4DYU A;  2FHA A;  4DZ0 A;  3R2R A;  2YJJ A;  4RC5 A;  5GU1 X;  1R03 A;  4IWK A;  2W0O A;  3PVR B;  1TKO A;  1NNQ A;  4MJY A;  4RC6 B;  2Z5Q A;  1Z6O M;  2CHP A;  3WNW A;  4MKU A;  3QHB A;  5CMR A;  3OGH A;  1VEI A;  5FFB A;  2ZA7 A;  3E1O A;  3SID A;  3GHQ A;  3WVV A;  2FZF A;  4RC5 B;  3E2C A;  2V15 A;  1QYB A;  4ZKX A;  3KA4 A;  4PG1 A;  3QHC A;  1L8H A;  5GU3 X;  3AJO A;  2BW1 A;  4M35 A;  1N1Q A;  2ZUR X;  3IS7 A;  1TK6 A;  2GS4 A;  4CVR A;  3WVU A;  1NF4 A;  2V2S A;  4ISM A;  1VEQ A;  4DYX A;  2XGW A;  2ZA6 A;  3ISE A;  4DYZ A;  3Q4N A;  4KVS A;  4XKT A;  5IX6 A;  1O9I A;  2CHI A;  5GU2 X;  2UX1 A;  1S2Z A;  4CVS A;  4Z5S A;  2JD6 0;  4E6K A;  2IU2 A;  3HIU A;  5ERJ A;  4ISP A;  2BJY A;  1ZUJ A;  4LYU A;  1BG7 A;  1RCE A;  1UMN A;  4CYB A;  3R2S A;  2WLU A;  3F36 A;  5HJH A;  2XKQ A;  4TOH A;  1LB3 A;  2CLB A;  4LQV A;  1XZ3 A;  4R42 A;  2HTN A;  2Z6M A;  1GWG A;  4U3G A;  4ML5 A;  3RD0 A;  1JIG A;  4ZTT A;  4RC7 A;  2QQY A;  1JYB A;  4PG0 A;  3FVB A;  4TOF A;  2YJK A;  4TOG A;  4M33 A;  1NFV A;  2GYD A;  3KA8 A;  5CMQ A;  1IES A;  2BK6 A;  1H96 A;  2V2O A;  3F37 A;  2FL0 A;  1AEW A;  2PYB A;  5JAC A;  2GYQ A;  1VLG A;  2V2N A;  4MUD A;  4RC7 B;  3FSE A;  1JTS A;  1LKO A;  2G4H A;  1UVH A;  3TA8 A;  5D8Q A;  4QUW A;  1RCG A;  3GVY A;  4CVT A;  2JD7 0;  4EVC A;  1TJO A;  2OH3 A;  3NP0 X;  4LPM A;  4CMY V;  3E1Q A;  4CY9 A;  5GN8 A;  3AF7 X;  3PWF A;  3RGD A;  3BVK A;  1TKP A;  2WLA A;  4AM4 A;  4ZL5 A;  4TOC A;  4KVR A;  3BVL A;  1B71 A;  3PZA A;  3E1P A;  1EUM A;  4DAS A;  4EVD A;  1JKV A;  1LKP A;  2ITB A;  4AM5 A;  5LS9 A;  3A9Q A;  4LQN A;  5K52 A;  5GN8 B;  5JKM A;  3BT5 A;  5LG2 A;  4IXK A;  3AK8 A;  1S3Q A;  3FI6 A;  3PWQ A;  4AM2 A;  5LBH A;  3E6R A;  4II4 A;  5JKL A;  4ZLW A;  2XJO A;  3O7S A;  3E1J A;  2QF9 A;  1O9R A;  4ZMC A;  5FFA A;  4LQJ A;  5GU0 X;  4LPN A;  2BKC A; 
#chains in the Genus database with same CATH topology
 3D19 A;  2CLU A;  5D8R A;  3VNX A;  2Z5R A;  3C1Z A;  4MXP A;  4ZKW A;  4ZL6 A;  1YUZ A;  3PVT A;  1F33 A;  4II4 B;  3AK9 A;  2JD8 0;  2OC5 A;  2CN6 A;  4DE6 A;  3R2K A;  2IY4 A;  3BVI A;  3KDQ A;  2CEI A;  3RBC A;  4LYX A;  2C2J A;  5J8W A;  1VJX A;  4ITW A;  5FFC A;  2Z90 A;  4CYA A;  4ETR A;  3F34 A;  5J93 A;  3PVT B;  3R2H A;  3PVY A;  3HL1 A;  1L8I A;  3QVD A;  3LKD A;  2C2U A;  1JI5 A;  1KRQ A;  1BFR A;  2VZB A;  3ERZ A;  4MN9 A;  5E1U A;  5C6F A;  3UOI A;  1IER A;  5D8P A;  2Z5P A;  3E6S A;  2AR0 A;  4A25 A;  1LKM A;  4DYY A;  4YXM A;  2WTL A;  2V8U A;  3RAV A;  1MOJ A;  4CVP A;  2FG8 A;  1RCI A;  2XJM A;  4TOA A;  3ES3 A;  5HQO A;  4P18 A;  2RBD A;  1S30 A;  1JKU A;  5JKM G;  1DVB A;  2C6R A;  2F7N A;  3F39 A;  4LQH A;  4DI0 A;  3AJQ A;  4TOD A;  3KXU A;  3H7G A;  3RE7 A;  4OYN A;  4W4L B;  3KA6 A;  5JKL G;  1OTK A;  2V2I A;  3R2L A;  4REU A;  3AF9 X;  2HR5 A;  4RC6 A;  5D8S A;  5J8S A;  3U90 A;  1RCC A;  3F38 A;  2Y3Q A;  3F35 A;  3Q4R A;  2CN7 A;  3KWO A;  3UNO A;  2ZA8 A;  3QZ3 A;  3PW8 A;  3KHK A;  4RC8 A;  1YV1 A;  2VXI A;  3KX9 A;  3KA3 A;  3JZA B;  4E40 A;  4MY7 A;  2D5K A;  3F32 A;  1YUX A;  2XJN A;  4X0J A;  4M34 A;  4XKU A;  3QD8 A;  4XKS A;  3E1L A;  3E1M A;  1BCF A;  3GGZ A;  5JDO A;  1Z4A A;  3DBY A;  2V2P A;  4ERU A;  4ITT A;  1FHA A;  5D8Y A;  3AF8 X;  3OJ5 A;  5HJF A;  3VVA A;  3V3K B;  3FRS A;  2ZG7 X;  4ZKH A;  3SE1 A;  3GE4 A;  2FFX J;  4KVQ A;  3EZ0 A;  5CZU A;  1J30 A;  3MPS A;  2C2F A;  3E1N A;  4TW3 A;  1JGC A;  3SH6 A;  1XZ1 A;  1ZS3 A;  3PW8 C;  3JZ9 A;  3QB9 A;  4M32 A;  5FFE A;  3Q4O A;  3R2O A;  2V2M A;  5GOU A;  3BKN A;  1NF6 A;  4XGS A;  3EGM A;  3UOF A;  1SQ3 A;  2V2L A;  2V2J A;  3PWQ C;  5K53 A;  2FKZ A;  3KA9 A;  4Z3B A;  2V2R A;  4EVE A;  3PW1 A;  3M6J A;  3NOZ X;  4IWJ A;  2X17 0;  3SHX A;  4EVB A;  4PGK A;  1HRS A;  3NP2 X;  5AXS A;  1SOF A;  3WVW A;  1MFR A;  1JRE A;  1RYT A;  2IB0 A;  2C41 A;  5FEJ A;  4TO9 A;  2VXX A;  2ZG9 X;  1VEL A;  4CMY A;  1RCD A;  4LPJ A;  3PVY B;  5J9V A;  5I4J A;  3PW1 B;  3IS8 A;  4W4K B;  3IQ1 A;  2ZG8 X;  4TOE A;  2YW6 A;  1DAT A;  3BVE A;  4Y08 A;  2FG4 A;  5LG8 A;  1Z6O A;  4ZJK A;  3T9J A;  1DPS A;  1F30 A;  3N6O A;  2OKC A;  5D8O A;  3A68 A;  3PVR A;  5E2D A;  3R2M A;  1QGH A;  5D8X A;  3EZU A;  3F33 A;  2CIH A;  2CF7 A;  4YKH A;  3AJP A;  5FFD A;  3O7R A;  1JI4 A;  2FJC A;  4PGI A;  3ISF A;  3Q4Q A;  5ERK A;  4TOB A;  3BVF A;  2YW7 A;  4DYU A;  2FHA A;  2N02 A;  4DZ0 A;  3R2R A;  2YJJ A;  4RC5 A;  5GU1 X;  1R03 A;  4IWK A;  2W0O A;  3PVR B;  1TKO A;  1NNQ A;  4MJY A;  4RC6 B;  2Z5Q A;  1Z6O M;  2CHP A;  3WNW A;  4MKU A;  3QHB A;  5CMR A;  3OGH A;  1VEI A;  5FFB A;  2ZA7 A;  3E1O A;  3SID A;  3GHQ A;  3WVV A;  2FZF A;  4RC5 B;  3E2C A;  2V15 A;  1QYB A;  4ZKX A;  3KA4 A;  4PG1 A;  3QHC A;  1L8H A;  5GU3 X;  3AJO A;  2BW1 A;  4M35 A;  1N1Q A;  5JDO B;  2ZUR X;  2CWL A;  3IS7 A;  1TK6 A;  2GS4 A;  4CVR A;  3WVU A;  1NF4 A;  2V2S A;  3VV9 A;  4ISM A;  1VEQ A;  4DYX A;  2XGW A;  2ZA6 A;  3ISE A;  4DYZ A;  3Q4N A;  4KVS A;  3W54 A;  4XKT A;  5IX6 A;  2MGY A;  1O9I A;  3L0M A;  2CHI A;  5GU2 X;  2UX1 A;  1S2Z A;  4CVS A;  4Z5S A;  2JD6 0;  4E6K A;  2IU2 A;  3HIU A;  5ERJ A;  4ISP A;  2BJY A;  1ZUJ A;  4LYU A;  1BG7 A;  1RCE A;  2Y44 A;  1UMN A;  4CYB A;  3R2S A;  4YXJ A;  2WLU A;  3F36 A;  5HJH A;  2XKQ A;  4TOH A;  1LB3 A;  2CLB A;  4YVZ A;  4LQV A;  1XZ3 A;  4R42 A;  2HTN A;  2Z6M A;  1GWG A;  4U3G A;  4ML5 A;  3UFB A;  3RD0 A;  1JIG A;  4ZTT A;  4RC7 A;  2QQY A;  1JYB A;  4PG0 A;  3FVB A;  4TOF A;  2YJK A;  4TOG A;  4M33 A;  1NFV A;  2GYD A;  3KA8 A;  5CMQ A;  1IES A;  2G38 B;  2BK6 A;  1H96 A;  2V2O A;  3F37 A;  2FL0 A;  1AEW A;  2PYB A;  3FRR A;  4KXR B;  2GYQ A;  5JAC A;  1VLG A;  2V2N A;  4MUD A;  4RC7 B;  3FSE A;  1JTS A;  1LKO A;  2G4H A;  1UVH A;  3TA8 A;  5D8Q A;  4QUW A;  4WJG 4;  1RCG A;  3GVY A;  4CVT A;  2JD7 0;  4EVC A;  1TJO A;  2OH3 A;  3C1Y A;  3NP0 X;  4LPM A;  4CMY V;  3E1Q A;  4CY9 A;  5GN8 A;  3AF7 X;  3PWF A;  3RGD A;  3BVK A;  1TKP A;  2WLA A;  4AM4 A;  4ZL5 A;  3C23 A;  4TOC A;  4KVR A;  3BVL A;  1B71 A;  3PZA A;  3E1P A;  1EUM A;  4DAS A;  4EVD A;  1JKV A;  1LKP A;  2ITB A;  4AM5 A;  5LS9 A;  3A9Q A;  4LQN A;  5K52 A;  5GN8 B;  5JKM A;  3BT5 A;  5LG2 A;  4IXK A;  3AK8 A;  2V8T A;  1S3Q A;  3FI6 A;  3PWQ A;  4AM2 A;  2WWX B;  5LBH A;  3E6R A;  4II4 A;  5JKL A;  4ZLW A;  2XJO A;  3O7S A;  3GGY A;  3E1J A;  2QF9 A;  1O9R A;  3C21 A;  4ZMC A;  4LQJ A;  5FFA A;  5GU0 X;  4LPN A;  2BKC A;  5HU6 D; 
#chains in the Genus database with same CATH homology
 3D19 A;  2CLU A;  5D8R A;  3VNX A;  2Z5R A;  3C1Z A;  4MXP A;  4ZKW A;  4ZL6 A;  1YUZ A;  3PVT A;  1F33 A;  4II4 B;  3AK9 A;  2JD8 0;  2OC5 A;  2CN6 A;  4DE6 A;  3R2K A;  2IY4 A;  3BVI A;  3KDQ A;  2CEI A;  3RBC A;  4LYX A;  2C2J A;  5J8W A;  1VJX A;  4ITW A;  5FFC A;  2Z90 A;  4CYA A;  4ETR A;  3F34 A;  5J93 A;  3PVT B;  3R2H A;  3PVY A;  3HL1 A;  1L8I A;  3QVD A;  3LKD A;  2C2U A;  1JI5 A;  1KRQ A;  1BFR A;  2VZB A;  3ERZ A;  4MN9 A;  5E1U A;  5C6F A;  3UOI A;  1IER A;  5D8P A;  2Z5P A;  3E6S A;  2AR0 A;  4A25 A;  1LKM A;  4DYY A;  4YXM A;  2WTL A;  2V8U A;  3RAV A;  1MOJ A;  4CVP A;  2FG8 A;  1RCI A;  2XJM A;  4TOA A;  3ES3 A;  5HQO A;  4P18 A;  2RBD A;  1S30 A;  1JKU A;  5JKM G;  1DVB A;  2C6R A;  2F7N A;  3F39 A;  4LQH A;  4DI0 A;  3AJQ A;  4TOD A;  3KXU A;  3H7G A;  3RE7 A;  4OYN A;  4W4L B;  3KA6 A;  5JKL G;  1OTK A;  2V2I A;  3R2L A;  4REU A;  3AF9 X;  2HR5 A;  4RC6 A;  5D8S A;  5J8S A;  3U90 A;  1RCC A;  3F38 A;  2Y3Q A;  3F35 A;  3Q4R A;  2CN7 A;  3KWO A;  3UNO A;  2ZA8 A;  3QZ3 A;  3PW8 A;  3KHK A;  4RC8 A;  1YV1 A;  2VXI A;  3KX9 A;  3KA3 A;  3JZA B;  4E40 A;  4MY7 A;  2D5K A;  3F32 A;  1YUX A;  2XJN A;  4X0J A;  4M34 A;  4XKU A;  3QD8 A;  4XKS A;  3E1L A;  3E1M A;  1BCF A;  3GGZ A;  5JDO A;  1Z4A A;  3DBY A;  2V2P A;  4ERU A;  4ITT A;  1FHA A;  5D8Y A;  3AF8 X;  3OJ5 A;  5HJF A;  3VVA A;  3V3K B;  3FRS A;  2ZG7 X;  4ZKH A;  3SE1 A;  3GE4 A;  2FFX J;  4KVQ A;  3EZ0 A;  5CZU A;  1J30 A;  3MPS A;  2C2F A;  3E1N A;  4TW3 A;  1JGC A;  3SH6 A;  1XZ1 A;  1ZS3 A;  3PW8 C;  3JZ9 A;  3QB9 A;  4M32 A;  5FFE A;  3Q4O A;  3R2O A;  2V2M A;  5GOU A;  3BKN A;  1NF6 A;  4XGS A;  3EGM A;  3UOF A;  1SQ3 A;  2V2L A;  2V2J A;  3PWQ C;  5K53 A;  2FKZ A;  3KA9 A;  4Z3B A;  2V2R A;  4EVE A;  3PW1 A;  3M6J A;  3NOZ X;  4IWJ A;  2X17 0;  3SHX A;  4EVB A;  4PGK A;  1HRS A;  3NP2 X;  5AXS A;  1SOF A;  3WVW A;  1MFR A;  1JRE A;  1RYT A;  2IB0 A;  2C41 A;  5FEJ A;  4TO9 A;  2VXX A;  2ZG9 X;  1VEL A;  4CMY A;  1RCD A;  4LPJ A;  3PVY B;  5J9V A;  5I4J A;  3PW1 B;  3IS8 A;  4W4K B;  3IQ1 A;  2ZG8 X;  4TOE A;  2YW6 A;  1DAT A;  3BVE A;  4Y08 A;  2FG4 A;  5LG8 A;  1Z6O A;  4ZJK A;  3T9J A;  1DPS A;  1F30 A;  3N6O A;  2OKC A;  5D8O A;  3A68 A;  3PVR A;  5E2D A;  3R2M A;  1QGH A;  5D8X A;  3EZU A;  3F33 A;  2CIH A;  2CF7 A;  4YKH A;  3AJP A;  5FFD A;  3O7R A;  1JI4 A;  2FJC A;  4PGI A;  3ISF A;  3Q4Q A;  5ERK A;  4TOB A;  3BVF A;  2YW7 A;  4DYU A;  2FHA A;  2N02 A;  4DZ0 A;  3R2R A;  2YJJ A;  4RC5 A;  5GU1 X;  1R03 A;  4IWK A;  2W0O A;  3PVR B;  1TKO A;  1NNQ A;  4MJY A;  4RC6 B;  2Z5Q A;  1Z6O M;  2CHP A;  3WNW A;  4MKU A;  3QHB A;  5CMR A;  3OGH A;  1VEI A;  5FFB A;  2ZA7 A;  3E1O A;  3SID A;  3GHQ A;  3WVV A;  2FZF A;  4RC5 B;  3E2C A;  2V15 A;  1QYB A;  4ZKX A;  3KA4 A;  4PG1 A;  3QHC A;  1L8H A;  5GU3 X;  3AJO A;  2BW1 A;  4M35 A;  1N1Q A;  5JDO B;  2ZUR X;  2CWL A;  3IS7 A;  1TK6 A;  2GS4 A;  4CVR A;  3WVU A;  1NF4 A;  2V2S A;  3VV9 A;  4ISM A;  1VEQ A;  4DYX A;  2XGW A;  2ZA6 A;  3ISE A;  4DYZ A;  3Q4N A;  4KVS A;  3W54 A;  4XKT A;  5IX6 A;  2MGY A;  1O9I A;  3L0M A;  2CHI A;  5GU2 X;  2UX1 A;  1S2Z A;  4CVS A;  4Z5S A;  2JD6 0;  4E6K A;  2IU2 A;  3HIU A;  5ERJ A;  4ISP A;  2BJY A;  1ZUJ A;  4LYU A;  1BG7 A;  1RCE A;  2Y44 A;  1UMN A;  4CYB A;  3R2S A;  4YXJ A;  2WLU A;  3F36 A;  5HJH A;  2XKQ A;  4TOH A;  1LB3 A;  2CLB A;  4YVZ A;  4LQV A;  1XZ3 A;  4R42 A;  2HTN A;  2Z6M A;  1GWG A;  4U3G A;  4ML5 A;  3UFB A;  3RD0 A;  1JIG A;  4ZTT A;  4RC7 A;  2QQY A;  1JYB A;  4PG0 A;  3FVB A;  4TOF A;  2YJK A;  4TOG A;  4M33 A;  1NFV A;  2GYD A;  3KA8 A;  5CMQ A;  1IES A;  2G38 B;  2BK6 A;  1H96 A;  2V2O A;  3F37 A;  2FL0 A;  1AEW A;  2PYB A;  3FRR A;  4KXR B;  2GYQ A;  5JAC A;  1VLG A;  2V2N A;  4MUD A;  4RC7 B;  3FSE A;  1JTS A;  1LKO A;  2G4H A;  1UVH A;  3TA8 A;  5D8Q A;  4QUW A;  4WJG 4;  1RCG A;  3GVY A;  4CVT A;  2JD7 0;  4EVC A;  1TJO A;  2OH3 A;  3C1Y A;  3NP0 X;  4LPM A;  4CMY V;  3E1Q A;  4CY9 A;  5GN8 A;  3AF7 X;  3PWF A;  3RGD A;  3BVK A;  1TKP A;  2WLA A;  4AM4 A;  4ZL5 A;  3C23 A;  4TOC A;  4KVR A;  3BVL A;  1B71 A;  3PZA A;  3E1P A;  1EUM A;  4DAS A;  4EVD A;  1JKV A;  1LKP A;  2ITB A;  4AM5 A;  5LS9 A;  3A9Q A;  4LQN A;  5K52 A;  5GN8 B;  5JKM A;  3BT5 A;  5LG2 A;  4IXK A;  3AK8 A;  2V8T A;  1S3Q A;  3FI6 A;  3PWQ A;  4AM2 A;  2WWX B;  5LBH A;  3E6R A;  4II4 A;  5JKL A;  4ZLW A;  2XJO A;  3O7S A;  3GGY A;  3E1J A;  2QF9 A;  1O9R A;  3C21 A;  4ZMC A;  4LQJ A;  5FFA A;  5GU0 X;  4LPN A;  2BKC A;  5HU6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...