3FRSA

Structure of human ist1(ntd) (residues 1-189)(p43212)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
176
structure length
175
Chain Sequence
GFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKLDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein KIAA0174
publication title Structural basis for ESCRT-III protein autoinhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 66
structure length 175
sequence length 176
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.60 Mainly Alpha Up-down Bundle Ferritin Ferritin 3frsA00
3GGZA 3FRRA 3GGYA 3FRSA
chains in the Genus database with same CATH superfamily
5JDOA 5FFAA 4YXMA 3AK8A 2VXIA 5CMQA 1BFRA 1LB3A 2IY4A 1XZ3A 3T9JA 3E1JA 4IWJA 2CN7A 3EZ0A 3PVTB 2CEIA 3FRRA 4TOEA 4DI0A 2GYQA 2Z5QA 2QQYA 3PWQC 5FFEA 3TA8A 3Q4QA 2CLUA 4PGKA 2CF7A 2D5KA 4DZ0A 3F34A 4TO9A 5JKMG 4XKSA 5FEJA 2C2FA 4IXKA 2Z5RA 1BCFA 2FL0A 3FRSA 5JDOB 4ITTA 2JD80 2CLBA 3F35A 1LKPA 2WLAA 2HTNA 3C1YA 2V2LA 1J30A 4Z5SA 4MUDA 3WVWA 5JKMA 1JKUA 3BVKA 1DVBA 3NP0X 2G38B 1MFRA 2WTLA 3F33A 5K52A 3KHKA 3RGDA 2VXXA 3BT5A 3AF7X 3R2KA 1TJOA 3R2HA 3FI6A 3HL1A 1L8HA 4TOCA 4TW3A 2FJCA 4LPNA 1R03A 4TOBA 3QB9A 1VEIA 1RCCA 3IS8A 5GN8A 1TKOA 3ERZA 3IQ1A 3KA6A 3RAVA 1DATA 2G4HA 4ZMCA 4PG1A 5CMRA 3QVDA 5HJFA 3PVRA 2V8UA 4DE6A 4W4LB 4MXPA 3PWFA 4OYNA 2ZA6A 4PGIA 3AJQA 1VELA 3E1QA 4P18A 1VJXA 3SIDA 3JZ9A 1JIGA 2N02A 3L0MA 2V2SA 4ZL6A 4M34A 4AM5A 4U3GA 5GN8B 4YXJA 5GU2X 1FHAA 5HQOA 2X170 3BVIA 3KX9A 5E1UA 3PVRB 2FG4A 3UFBA 3SHXA 4KXRB 3GVYA 3SE1A 2PYBA 4MKUA 4Z3BA 3C23A 3C21A 3QHCA 2V2RA 4MN9A 4AM2A 4A25A 3PZAA 2FFXJ 4TOAA 4CVSA 5D8QA 2OC5A 3HIUA 5I4JA 4ZKXA 4XKTA 2C2JA 4YVZA 4LPMA 3UNOA 1XZ1A 3BVEA 1JKVA 4EVCA 5GU3X 5LS9A 2ZA7A 4PG0A 4CVTA 2C2UA 1JYBA 3KA4A 5C6FA 1S30A 2ITBA 3WVUA 3PWQA 5D8XA 1JI5A 2CHIA 2UX1A 3AK9A 3E6SA 4YKHA 2V2PA 3H7GA 3QHBA 1EUMA 2OH3A 4KVSA 4RC6A 1QYBA 5FFBA 5J93A 5J8WA 3VNXA 1MOJA 2V15A 4ZKWA 4LYUA 3M6JA 4ITWA 4LQHA 3FVBA 4MJYA 4CVPA 4TOHA 3E1NA 4RC5A 3ES3A 5JKLG 1DPSA 1S2ZA 2GS4A 2ZA8A 5D8YA 4CYBA 2YJKA 4DYXA 3E1MA 4EVDA 1LKOA 4DYYA 2V2OA 3ISEA 3R2RA 3KXUA 4ZTTA 4CY9A 5JKLA 1YV1A 2CIHA 4LQVA 3VVAA 1JGCA 2C41A 3O7SA 3KWOA 3DBYA 4DYZA 1YUZA 4RC6B 3U90A 3F37A 2MGYA 1IESA 2C6RA 4LYXA 4CVRA 3E1PA 3V3KB 3R2OA 5GU1X 3AF9X 4RC5B 4E40A 2RBDA 1VLGA 5ERJA 2ZURX 5FFCA 3GGZA 4CMYA 2JD70 4II4A 1HRSA 2IB0A 2Z6MA 5J8SA 2XJOA 3KA3A 2CN6A 3UOFA 3IS7A 5FFDA 3KA8A 3KDQA 3E2CA 1ZS3A 3A68A 3GE4A 4ZL5A 4ISPA 1IERA 4TOGA 2QF9A 3OJ5A 4KVQA 2W0OA 3D19A 5HJHA 3AF8X 5AXSA 5LBHA 1NNQA 1Z6OA 2V2MA 2HR5A 4KVRA 1JI4A 1S3QA 2BW1A 5D8PA 2GYDA 1KRQA 4TODA 3NP2X 3UOIA 4ETRA 2V2IA 3JZAB 1NF6A 3R2MA 3SH6A 2XGWA 4RC7A 3F36A 5D8RA 4LQJA 4ZKHA 2Y44A 2Z5PA 1GWGA 1SQ3A 2XKQA 2IU2A 3MPSA 2BKCA 5J9VA 3C1ZA 4ISMA 3OGHA 3R2SA 1SOFA 3E6RA 4CYAA 2BK6A 3E1LA 2JD60 3BKNA 5D8OA 2V2NA 4EVBA 4M32A 4AM4A 1O9IA 1LKMA 3QZ3A 3E1OA 4IWKA 2OKCA 3F38A 3WVVA 2V2JA 1Z6OM 3BVLA 2Z90A 2Y3QA 1Z4AA 5GU0X 4XGSA 2FG8A 5ERKA 3EZUA 4RC7B 1RCGA 2AR0A 5CZUA 3N6OA 3BVFA 2XJMA 2VZBA 2F7NA 4MY7A 2CHPA 4W4KB 2YW7A 3W54A 3F32A 1B71A 2FHAA 5LG2A 2WWXB 4E6KA 4R42A 1VEQA 3GGYA 1JREA 3RD0A 3RBCA 3ISFA 3QD8A 1N1QA 5IX6A 3F39A 5HU6D 3Q4NA 4LQNA 4M35A 3O7RA 3WNWA 1L8IA 1O9RA 5E2DA 3VV9A 1OTKA 4CMYV 4ZJKA 5LG8A 4ML5A 3AJOA 3PVYA 2CWLA 1TK6A 4X0JA 3Q4RA 4Y08A 3NOZX 4TOFA 5JACA 2YJJA 2BJYA 3RE7A 1NFVA 3A9QA 1F33A 4DYUA 3KA9A 2YW6A 4QUWA 1RCEA 1AEWA 3PW8C 3PW1A 2WLUA 1JTSA 4REUA 4RC8A 4EVEA 2ZG9X 3R2LA 4ZLWA 2V8TA 4XKUA 1RCIA 1NF4A 2FZFA 1H96A 2ZG7X 3PW8A 5GOUA 1RCDA 5K53A 1F30A 5D8SA 3Q4OA 4LPJA 2XJNA 1UVHA 3PVYB 1UMNA 3FSEA 1RYTA 3PVTA 2FKZA 1ZUJA 4DASA 1TKPA 3EGMA 1QGHA 3LKDA 4II4B 4ERUA 2ZG8X 4WJG4 3GHQA 3AJPA 4M33A 1BG7A 3PW1B 1YUXA
chains in the Genus database with same CATH topology
5JDOA 5FFAA 4YXMA 3AK8A 2VXIA 5CMQA 1BFRA 1LB3A 2IY4A 1XZ3A 3T9JA 3E1JA 4IWJA 2CN7A 3EZ0A 3PVTB 2CEIA 3FRRA 4TOEA 4DI0A 2GYQA 2Z5QA 2QQYA 3PWQC 5FFEA 3TA8A 3Q4QA 2CLUA 4PGKA 2CF7A 2D5KA 4DZ0A 3F34A 4TO9A 5JKMG 4XKSA 5FEJA 2C2FA 4IXKA 2Z5RA 1BCFA 2FL0A 3FRSA 5JDOB 4ITTA 2JD80 2CLBA 3F35A 1LKPA 2WLAA 2HTNA 3C1YA 2V2LA 1J30A 4Z5SA 4MUDA 3WVWA 5JKMA 1JKUA 3BVKA 1DVBA 3NP0X 2G38B 1MFRA 2WTLA 3F33A 5K52A 3KHKA 3RGDA 2VXXA 3BT5A 3AF7X 3R2KA 1TJOA 3R2HA 3FI6A 3HL1A 1L8HA 4TOCA 4TW3A 2FJCA 4LPNA 1R03A 4TOBA 3QB9A 1VEIA 1RCCA 3IS8A 5GN8A 1TKOA 3ERZA 3IQ1A 3KA6A 3RAVA 1DATA 2G4HA 4ZMCA 4PG1A 5CMRA 3QVDA 5HJFA 3PVRA 2V8UA 4DE6A 4W4LB 4MXPA 3PWFA 4OYNA 2ZA6A 4PGIA 3AJQA 1VELA 3E1QA 4P18A 1VJXA 3SIDA 3JZ9A 1JIGA 2N02A 3L0MA 2V2SA 4ZL6A 4M34A 4AM5A 4U3GA 5GN8B 4YXJA 5GU2X 1FHAA 5HQOA 2X170 3BVIA 3KX9A 5E1UA 3PVRB 2FG4A 3UFBA 3SHXA 4KXRB 3GVYA 3SE1A 2PYBA 4MKUA 4Z3BA 3C23A 3C21A 3QHCA 2V2RA 4MN9A 4AM2A 4A25A 3PZAA 2FFXJ 4TOAA 4CVSA 5D8QA 2OC5A 3HIUA 5I4JA 4ZKXA 4XKTA 2C2JA 4YVZA 4LPMA 3UNOA 1XZ1A 3BVEA 1JKVA 4EVCA 5GU3X 5LS9A 2ZA7A 4PG0A 4CVTA 2C2UA 1JYBA 3KA4A 5C6FA 1S30A 2ITBA 3WVUA 3PWQA 5D8XA 1JI5A 2CHIA 2UX1A 3AK9A 3E6SA 4YKHA 2V2PA 3H7GA 3QHBA 1EUMA 2OH3A 4KVSA 4RC6A 1QYBA 5FFBA 5J93A 5J8WA 3VNXA 1MOJA 2V15A 4ZKWA 4LYUA 3M6JA 4ITWA 4LQHA 3FVBA 4MJYA 4CVPA 4TOHA 3E1NA 4RC5A 3ES3A 5JKLG 1DPSA 1S2ZA 2GS4A 2ZA8A 5D8YA 4CYBA 2YJKA 4DYXA 3E1MA 4EVDA 1LKOA 4DYYA 2V2OA 3ISEA 3R2RA 3KXUA 4ZTTA 4CY9A 5JKLA 1YV1A 2CIHA 4LQVA 3VVAA 1JGCA 2C41A 3O7SA 3KWOA 3DBYA 4DYZA 1YUZA 4RC6B 3U90A 3F37A 2MGYA 1IESA 2C6RA 4LYXA 4CVRA 3E1PA 3V3KB 3R2OA 5GU1X 3AF9X 4RC5B 4E40A 2RBDA 1VLGA 5ERJA 2ZURX 5FFCA 3GGZA 4CMYA 2JD70 4II4A 1HRSA 2IB0A 2Z6MA 5J8SA 2XJOA 3KA3A 2CN6A 3UOFA 3IS7A 5FFDA 3KA8A 3KDQA 3E2CA 1ZS3A 3A68A 3GE4A 4ZL5A 4ISPA 1IERA 4TOGA 2QF9A 3OJ5A 4KVQA 2W0OA 3D19A 5HJHA 3AF8X 5AXSA 5LBHA 1NNQA 1Z6OA 2V2MA 2HR5A 4KVRA 1JI4A 1S3QA 2BW1A 5D8PA 2GYDA 1KRQA 4TODA 3NP2X 3UOIA 4ETRA 2V2IA 3JZAB 1NF6A 3R2MA 3SH6A 2XGWA 4RC7A 3F36A 5D8RA 4LQJA 4ZKHA 2Y44A 2Z5PA 1GWGA 1SQ3A 2XKQA 2IU2A 3MPSA 2BKCA 5J9VA 3C1ZA 4ISMA 3OGHA 3R2SA 1SOFA 3E6RA 4CYAA 2BK6A 3E1LA 2JD60 3BKNA 5D8OA 2V2NA 4EVBA 4M32A 4AM4A 1O9IA 1LKMA 3QZ3A 3E1OA 4IWKA 2OKCA 3F38A 3WVVA 2V2JA 1Z6OM 3BVLA 2Z90A 2Y3QA 1Z4AA 5GU0X 4XGSA 2FG8A 5ERKA 3EZUA 4RC7B 1RCGA 2AR0A 5CZUA 3N6OA 3BVFA 2XJMA 2VZBA 2F7NA 4MY7A 2CHPA 4W4KB 2YW7A 3W54A 3F32A 1B71A 2FHAA 5LG2A 2WWXB 4E6KA 4R42A 1VEQA 3GGYA 1JREA 3RD0A 3RBCA 3ISFA 3QD8A 1N1QA 5IX6A 3F39A 5HU6D 3Q4NA 4LQNA 4M35A 3O7RA 3WNWA 1L8IA 1O9RA 5E2DA 3VV9A 1OTKA 4CMYV 4ZJKA 5LG8A 4ML5A 3AJOA 3PVYA 2CWLA 1TK6A 4X0JA 3Q4RA 4Y08A 3NOZX 4TOFA 5JACA 2YJJA 2BJYA 3RE7A 1NFVA 3A9QA 1F33A 4DYUA 3KA9A 2YW6A 4QUWA 1RCEA 1AEWA 3PW8C 3PW1A 2WLUA 1JTSA 4REUA 4RC8A 4EVEA 2ZG9X 3R2LA 4ZLWA 2V8TA 4XKUA 1RCIA 1NF4A 2FZFA 1H96A 2ZG7X 3PW8A 5GOUA 1RCDA 5K53A 1F30A 5D8SA 3Q4OA 4LPJA 2XJNA 1UVHA 3PVYB 1UMNA 3FSEA 1RYTA 3PVTA 2FKZA 1ZUJA 4DASA 1TKPA 3EGMA 1QGHA 3LKDA 4II4B 4ERUA 2ZG8X 4WJG4 3GHQA 3AJPA 4M33A 1BG7A 3PW1B 1YUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GGZ A;  3FRR A;  3GGY A;  3FRS A; 
#chains in the Genus database with same CATH topology
 5JDO A;  5FFA A;  4YXM A;  3AK8 A;  2VXI A;  5CMQ A;  1BFR A;  1LB3 A;  2IY4 A;  1XZ3 A;  3T9J A;  3E1J A;  4IWJ A;  2CN7 A;  3EZ0 A;  3PVT B;  2CEI A;  3FRR A;  4TOE A;  4DI0 A;  2GYQ A;  2Z5Q A;  2QQY A;  3PWQ C;  5FFE A;  3TA8 A;  3Q4Q A;  2CLU A;  4PGK A;  2CF7 A;  2D5K A;  4DZ0 A;  3F34 A;  4TO9 A;  5JKM G;  4XKS A;  5FEJ A;  2C2F A;  4IXK A;  2Z5R A;  1BCF A;  2FL0 A;  3FRS A;  5JDO B;  4ITT A;  2JD8 0;  2CLB A;  3F35 A;  1LKP A;  2WLA A;  2HTN A;  3C1Y A;  2V2L A;  1J30 A;  4Z5S A;  4MUD A;  3WVW A;  5JKM A;  1JKU A;  3BVK A;  1DVB A;  3NP0 X;  2G38 B;  1MFR A;  2WTL A;  3F33 A;  5K52 A;  3KHK A;  3RGD A;  2VXX A;  3BT5 A;  3AF7 X;  3R2K A;  1TJO A;  3R2H A;  3FI6 A;  3HL1 A;  1L8H A;  4TOC A;  4TW3 A;  2FJC A;  4LPN A;  1R03 A;  4TOB A;  3QB9 A;  1VEI A;  1RCC A;  3IS8 A;  5GN8 A;  1TKO A;  3ERZ A;  3IQ1 A;  3KA6 A;  3RAV A;  1DAT A;  2G4H A;  4ZMC A;  4PG1 A;  5CMR A;  3QVD A;  5HJF A;  3PVR A;  2V8U A;  4DE6 A;  4W4L B;  4MXP A;  3PWF A;  4OYN A;  2ZA6 A;  4PGI A;  3AJQ A;  1VEL A;  3E1Q A;  4P18 A;  1VJX A;  3SID A;  3JZ9 A;  1JIG A;  2N02 A;  3L0M A;  2V2S A;  4ZL6 A;  4M34 A;  4AM5 A;  4U3G A;  5GN8 B;  4YXJ A;  5GU2 X;  1FHA A;  5HQO A;  2X17 0;  3BVI A;  3KX9 A;  5E1U A;  3PVR B;  2FG4 A;  3UFB A;  3SHX A;  4KXR B;  3GVY A;  3SE1 A;  2PYB A;  4MKU A;  4Z3B A;  3C23 A;  3C21 A;  3QHC A;  2V2R A;  4MN9 A;  4AM2 A;  4A25 A;  3PZA A;  2FFX J;  4TOA A;  4CVS A;  5D8Q A;  2OC5 A;  3HIU A;  5I4J A;  4ZKX A;  4XKT A;  2C2J A;  4YVZ A;  4LPM A;  3UNO A;  1XZ1 A;  3BVE A;  1JKV A;  4EVC A;  5GU3 X;  5LS9 A;  2ZA7 A;  4PG0 A;  4CVT A;  2C2U A;  1JYB A;  3KA4 A;  5C6F A;  1S30 A;  2ITB A;  3WVU A;  3PWQ A;  5D8X A;  1JI5 A;  2CHI A;  2UX1 A;  3AK9 A;  3E6S A;  4YKH A;  2V2P A;  3H7G A;  3QHB A;  1EUM A;  2OH3 A;  4KVS A;  4RC6 A;  1QYB A;  5FFB A;  5J93 A;  5J8W A;  3VNX A;  1MOJ A;  2V15 A;  4ZKW A;  4LYU A;  3M6J A;  4ITW A;  4LQH A;  3FVB A;  4MJY A;  4CVP A;  4TOH A;  3E1N A;  4RC5 A;  3ES3 A;  5JKL G;  1DPS A;  1S2Z A;  2GS4 A;  2ZA8 A;  5D8Y A;  4CYB A;  2YJK A;  4DYX A;  3E1M A;  4EVD A;  1LKO A;  4DYY A;  2V2O A;  3ISE A;  3R2R A;  3KXU A;  4ZTT A;  4CY9 A;  5JKL A;  1YV1 A;  2CIH A;  4LQV A;  3VVA A;  1JGC A;  2C41 A;  3O7S A;  3KWO A;  3DBY A;  4DYZ A;  1YUZ A;  4RC6 B;  3U90 A;  3F37 A;  2MGY A;  1IES A;  2C6R A;  4LYX A;  4CVR A;  3E1P A;  3V3K B;  3R2O A;  5GU1 X;  3AF9 X;  4RC5 B;  4E40 A;  2RBD A;  1VLG A;  5ERJ A;  2ZUR X;  5FFC A;  3GGZ A;  4CMY A;  2JD7 0;  4II4 A;  1HRS A;  2IB0 A;  2Z6M A;  5J8S A;  2XJO A;  3KA3 A;  2CN6 A;  3UOF A;  3IS7 A;  5FFD A;  3KA8 A;  3KDQ A;  3E2C A;  1ZS3 A;  3A68 A;  3GE4 A;  4ZL5 A;  4ISP A;  1IER A;  4TOG A;  2QF9 A;  3OJ5 A;  4KVQ A;  2W0O A;  3D19 A;  5HJH A;  3AF8 X;  5AXS A;  5LBH A;  1NNQ A;  1Z6O A;  2V2M A;  2HR5 A;  4KVR A;  1JI4 A;  1S3Q A;  2BW1 A;  5D8P A;  2GYD A;  1KRQ A;  4TOD A;  3NP2 X;  3UOI A;  4ETR A;  2V2I A;  3JZA B;  1NF6 A;  3R2M A;  3SH6 A;  2XGW A;  4RC7 A;  3F36 A;  5D8R A;  4LQJ A;  4ZKH A;  2Y44 A;  2Z5P A;  1GWG A;  1SQ3 A;  2XKQ A;  2IU2 A;  3MPS A;  2BKC A;  5J9V A;  3C1Z A;  4ISM A;  3OGH A;  3R2S A;  1SOF A;  3E6R A;  4CYA A;  2BK6 A;  3E1L A;  2JD6 0;  3BKN A;  5D8O A;  2V2N A;  4EVB A;  4M32 A;  4AM4 A;  1O9I A;  1LKM A;  3QZ3 A;  3E1O A;  4IWK A;  2OKC A;  3F38 A;  3WVV A;  2V2J A;  1Z6O M;  3BVL A;  2Z90 A;  2Y3Q A;  1Z4A A;  5GU0 X;  4XGS A;  2FG8 A;  5ERK A;  3EZU A;  4RC7 B;  1RCG A;  2AR0 A;  5CZU A;  3N6O A;  3BVF A;  2XJM A;  2VZB A;  2F7N A;  4MY7 A;  2CHP A;  4W4K B;  2YW7 A;  3W54 A;  3F32 A;  1B71 A;  2FHA A;  5LG2 A;  2WWX B;  4E6K A;  4R42 A;  1VEQ A;  3GGY A;  1JRE A;  3RD0 A;  3RBC A;  3ISF A;  3QD8 A;  1N1Q A;  5IX6 A;  3F39 A;  5HU6 D;  3Q4N A;  4LQN A;  4M35 A;  3O7R A;  3WNW A;  1L8I A;  1O9R A;  5E2D A;  3VV9 A;  1OTK A;  4CMY V;  4ZJK A;  5LG8 A;  4ML5 A;  3AJO A;  3PVY A;  2CWL A;  1TK6 A;  4X0J A;  3Q4R A;  4Y08 A;  3NOZ X;  4TOF A;  5JAC A;  2YJJ A;  2BJY A;  3RE7 A;  1NFV A;  3A9Q A;  1F33 A;  4DYU A;  3KA9 A;  2YW6 A;  4QUW A;  1RCE A;  1AEW A;  3PW8 C;  3PW1 A;  2WLU A;  1JTS A;  4REU A;  4RC8 A;  4EVE A;  2ZG9 X;  3R2L A;  4ZLW A;  2V8T A;  4XKU A;  1RCI A;  1NF4 A;  2FZF A;  1H96 A;  2ZG7 X;  3PW8 A;  5GOU A;  1RCD A;  5K53 A;  1F30 A;  5D8S A;  3Q4O A;  4LPJ A;  2XJN A;  1UVH A;  3PVY B;  1UMN A;  3FSE A;  1RYT A;  3PVT A;  2FKZ A;  1ZUJ A;  4DAS A;  1TKP A;  3EGM A;  1QGH A;  3LKD A;  4II4 B;  4ERU A;  2ZG8 X;  4WJG 4;  3GHQ A;  3AJP A;  4M33 A;  1BG7 A;  3PW1 B;  1YUX A; 
#chains in the Genus database with same CATH homology
 5JDO A;  5FFA A;  4YXM A;  3AK8 A;  2VXI A;  5CMQ A;  1BFR A;  1LB3 A;  2IY4 A;  1XZ3 A;  3T9J A;  3E1J A;  4IWJ A;  2CN7 A;  3EZ0 A;  3PVT B;  2CEI A;  3FRR A;  4TOE A;  4DI0 A;  2GYQ A;  2Z5Q A;  2QQY A;  3PWQ C;  5FFE A;  3TA8 A;  3Q4Q A;  2CLU A;  4PGK A;  2CF7 A;  2D5K A;  4DZ0 A;  3F34 A;  4TO9 A;  5JKM G;  4XKS A;  5FEJ A;  2C2F A;  4IXK A;  2Z5R A;  1BCF A;  2FL0 A;  3FRS A;  5JDO B;  4ITT A;  2JD8 0;  2CLB A;  3F35 A;  1LKP A;  2WLA A;  2HTN A;  3C1Y A;  2V2L A;  1J30 A;  4Z5S A;  4MUD A;  3WVW A;  5JKM A;  1JKU A;  3BVK A;  1DVB A;  3NP0 X;  2G38 B;  1MFR A;  2WTL A;  3F33 A;  5K52 A;  3KHK A;  3RGD A;  2VXX A;  3BT5 A;  3AF7 X;  3R2K A;  1TJO A;  3R2H A;  3FI6 A;  3HL1 A;  1L8H A;  4TOC A;  4TW3 A;  2FJC A;  4LPN A;  1R03 A;  4TOB A;  3QB9 A;  1VEI A;  1RCC A;  3IS8 A;  5GN8 A;  1TKO A;  3ERZ A;  3IQ1 A;  3KA6 A;  3RAV A;  1DAT A;  2G4H A;  4ZMC A;  4PG1 A;  5CMR A;  3QVD A;  5HJF A;  3PVR A;  2V8U A;  4DE6 A;  4W4L B;  4MXP A;  3PWF A;  4OYN A;  2ZA6 A;  4PGI A;  3AJQ A;  1VEL A;  3E1Q A;  4P18 A;  1VJX A;  3SID A;  3JZ9 A;  1JIG A;  2N02 A;  3L0M A;  2V2S A;  4ZL6 A;  4M34 A;  4AM5 A;  4U3G A;  5GN8 B;  4YXJ A;  5GU2 X;  1FHA A;  5HQO A;  2X17 0;  3BVI A;  3KX9 A;  5E1U A;  3PVR B;  2FG4 A;  3UFB A;  3SHX A;  4KXR B;  3GVY A;  3SE1 A;  2PYB A;  4MKU A;  4Z3B A;  3C23 A;  3C21 A;  3QHC A;  2V2R A;  4MN9 A;  4AM2 A;  4A25 A;  3PZA A;  2FFX J;  4TOA A;  4CVS A;  5D8Q A;  2OC5 A;  3HIU A;  5I4J A;  4ZKX A;  4XKT A;  2C2J A;  4YVZ A;  4LPM A;  3UNO A;  1XZ1 A;  3BVE A;  1JKV A;  4EVC A;  5GU3 X;  5LS9 A;  2ZA7 A;  4PG0 A;  4CVT A;  2C2U A;  1JYB A;  3KA4 A;  5C6F A;  1S30 A;  2ITB A;  3WVU A;  3PWQ A;  5D8X A;  1JI5 A;  2CHI A;  2UX1 A;  3AK9 A;  3E6S A;  4YKH A;  2V2P A;  3H7G A;  3QHB A;  1EUM A;  2OH3 A;  4KVS A;  4RC6 A;  1QYB A;  5FFB A;  5J93 A;  5J8W A;  3VNX A;  1MOJ A;  2V15 A;  4ZKW A;  4LYU A;  3M6J A;  4ITW A;  4LQH A;  3FVB A;  4MJY A;  4CVP A;  4TOH A;  3E1N A;  4RC5 A;  3ES3 A;  5JKL G;  1DPS A;  1S2Z A;  2GS4 A;  2ZA8 A;  5D8Y A;  4CYB A;  2YJK A;  4DYX A;  3E1M A;  4EVD A;  1LKO A;  4DYY A;  2V2O A;  3ISE A;  3R2R A;  3KXU A;  4ZTT A;  4CY9 A;  5JKL A;  1YV1 A;  2CIH A;  4LQV A;  3VVA A;  1JGC A;  2C41 A;  3O7S A;  3KWO A;  3DBY A;  4DYZ A;  1YUZ A;  4RC6 B;  3U90 A;  3F37 A;  2MGY A;  1IES A;  2C6R A;  4LYX A;  4CVR A;  3E1P A;  3V3K B;  3R2O A;  5GU1 X;  3AF9 X;  4RC5 B;  4E40 A;  2RBD A;  1VLG A;  5ERJ A;  2ZUR X;  5FFC A;  3GGZ A;  4CMY A;  2JD7 0;  4II4 A;  1HRS A;  2IB0 A;  2Z6M A;  5J8S A;  2XJO A;  3KA3 A;  2CN6 A;  3UOF A;  3IS7 A;  5FFD A;  3KA8 A;  3KDQ A;  3E2C A;  1ZS3 A;  3A68 A;  3GE4 A;  4ZL5 A;  4ISP A;  1IER A;  4TOG A;  2QF9 A;  3OJ5 A;  4KVQ A;  2W0O A;  3D19 A;  5HJH A;  3AF8 X;  5AXS A;  5LBH A;  1NNQ A;  1Z6O A;  2V2M A;  2HR5 A;  4KVR A;  1JI4 A;  1S3Q A;  2BW1 A;  5D8P A;  2GYD A;  1KRQ A;  4TOD A;  3NP2 X;  3UOI A;  4ETR A;  2V2I A;  3JZA B;  1NF6 A;  3R2M A;  3SH6 A;  2XGW A;  4RC7 A;  3F36 A;  5D8R A;  4LQJ A;  4ZKH A;  2Y44 A;  2Z5P A;  1GWG A;  1SQ3 A;  2XKQ A;  2IU2 A;  3MPS A;  2BKC A;  5J9V A;  3C1Z A;  4ISM A;  3OGH A;  3R2S A;  1SOF A;  3E6R A;  4CYA A;  2BK6 A;  3E1L A;  2JD6 0;  3BKN A;  5D8O A;  2V2N A;  4EVB A;  4M32 A;  4AM4 A;  1O9I A;  1LKM A;  3QZ3 A;  3E1O A;  4IWK A;  2OKC A;  3F38 A;  3WVV A;  2V2J A;  1Z6O M;  3BVL A;  2Z90 A;  2Y3Q A;  1Z4A A;  5GU0 X;  4XGS A;  2FG8 A;  5ERK A;  3EZU A;  4RC7 B;  1RCG A;  2AR0 A;  5CZU A;  3N6O A;  3BVF A;  2XJM A;  2VZB A;  2F7N A;  4MY7 A;  2CHP A;  4W4K B;  2YW7 A;  3W54 A;  3F32 A;  1B71 A;  2FHA A;  5LG2 A;  2WWX B;  4E6K A;  4R42 A;  1VEQ A;  3GGY A;  1JRE A;  3RD0 A;  3RBC A;  3ISF A;  3QD8 A;  1N1Q A;  5IX6 A;  3F39 A;  5HU6 D;  3Q4N A;  4LQN A;  4M35 A;  3O7R A;  3WNW A;  1L8I A;  1O9R A;  5E2D A;  3VV9 A;  1OTK A;  4CMY V;  4ZJK A;  5LG8 A;  4ML5 A;  3AJO A;  3PVY A;  2CWL A;  1TK6 A;  4X0J A;  3Q4R A;  4Y08 A;  3NOZ X;  4TOF A;  5JAC A;  2YJJ A;  2BJY A;  3RE7 A;  1NFV A;  3A9Q A;  1F33 A;  4DYU A;  3KA9 A;  2YW6 A;  4QUW A;  1RCE A;  1AEW A;  3PW8 C;  3PW1 A;  2WLU A;  1JTS A;  4REU A;  4RC8 A;  4EVE A;  2ZG9 X;  3R2L A;  4ZLW A;  2V8T A;  4XKU A;  1RCI A;  1NF4 A;  2FZF A;  1H96 A;  2ZG7 X;  3PW8 A;  5GOU A;  1RCD A;  5K53 A;  1F30 A;  5D8S A;  3Q4O A;  4LPJ A;  2XJN A;  1UVH A;  3PVY B;  1UMN A;  3FSE A;  1RYT A;  3PVT A;  2FKZ A;  1ZUJ A;  4DAS A;  1TKP A;  3EGM A;  1QGH A;  3LKD A;  4II4 B;  4ERU A;  2ZG8 X;  4WJG 4;  3GHQ A;  3AJP A;  4M33 A;  1BG7 A;  3PW1 B;  1YUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...