4DYXA

Crystal structure of the cu-adduct of human h-ferritin variant 4his-delta c-star
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
172
structure length
172
Chain Sequence
b'TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFHHQSHEEHEHAHKLMKLQNQRGGRIFLQDIQKPDEDDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferritin heavy chain
publication title Re-engineering protein interfaces yields copper-inducible ferritin cage assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 75
structure length 172
sequence length 172
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4dyxA00
2OH3A 2ZG8X 4CMYV 3R2KA 3E1OA 3Q4QA 3WVWA 3WNWA 3QB9A 3FSEA 5JKLA 4U3GA 1IESA 1MFRA 4QUWA 4DYXA 3BVIA 4TOAA 5LBHA 4KVSA 1NF6A 1AEWA 3AF7X 3QZ3A 3ES3A 3WVVA 3F39A 2VXXA 3KA4A 1QYBA 2PYBA 4MKUA 2X170 2FL0A 5GU3X 4EVDA 5JACA 4XGSA 1MOJA 3ISFA 2YJKA 1EUMA 3O7SA 4YKHA 3UNOA 4DYYA 5ERKA 1HRSA 2ZURX 5GOUA 3AK9A 4RC5B 5HJFA 3SIDA 3QVDA 2C6RA 1J30A 2JD80 5I4JA 1F33A 3A9QA 3PVRA 4ZJKA 4DYZA 3QD8A 4EVCA 3KA3A 4REUA 4ERUA 3NP0X 3RD0A 2YW7A 2FG8A 1LKPA 4DYUA 4DI0A 3Q4RA 4LYXA 2YW6A 3R2HA 1RCCA 1B71A 1L8IA 3NP2X 3QHCA 5E1UA 5LS9A 5IX6A 2Z90A 1S30A 2GS4A 1JIGA 3U90A 5J93A 4TW3A 3E6RA 4CMYA 3PVTA 1OTKA 3RGDA 3IS8A 1YUXA 2YJJA 2C2UA 1JKUA 1TJOA 4CVTA 4CYAA 3QHBA 3Q4OA 2F7NA 3PW1B 3E1NA 1YUZA 2ZA8A 1XZ1A 4LPMA 2FG4A 3E1MA 1KRQA 5CMQA 3RBCA 2V2IA 4ZKWA 1RCDA 5FFBA 2V2RA 4MY7A 5ERJA 2CEIA 1RCEA 3BT5A 4RC6B 4TOFA 2UX1A 4ML5A 1SOFA 1NFVA 3AJPA 5K53A 4MUDA 4DZ0A 4Z3BA 3SHXA 1DATA 3RE7A 2CF7A 4P18A 1VJXA 2CLBA 4PGKA 4RC5A 4AM2A 4LYUA 3A68A 3ISEA 2GYDA 2W0OA 2ZG7X 2FKZA 3T9JA 1JREA 2CIHA 2G4HA 1DVBA 1UVHA 5J9VA 2Z5RA 1QGHA 2CHIA 4ETRA 2V2SA 2Z5PA 2WTLA 3SE1A 4CVRA 4KVRA 2IB0A 4ZL5A 4TOGA 5JKMG 3KA6A 2FZFA 4DASA 3UOFA 4E6KA 3FI6A 2CHPA 5D8YA 1JTSA 1S3QA 1BFRA 2FFXJ 4OYNA 1LKOA 1VELA 2FHAA 3PZAA 4ZKHA 1O9IA 1FHAA 3PVYA 1VEQA 3PW1A 3MPSA 4M35A 5GU2X 3VNXA 5E2DA 4ZLWA 1TKOA 2WLAA 1TKPA 3E1PA 3E6SA 2RBDA 1RCIA 3BVKA 3GVYA 4RC6A 5JKLG 3PWQC 4PG1A 3R2SA 5AXSA 3E1JA 1LB3A 4IWKA 2VZBA 1BCFA 2JD70 3PVYB 3BVLA 4IWJA 2Y3QA 4M34A 3FVBA 2BW1A 3KA9A 3ERZA 3KWOA 4PG0A 5FFDA 4A25A 1H96A 4MN9A 4RC7B 3F35A 4TOCA 3EZUA 4TO9A 5FFCA 4ISPA 2QF9A 4ISMA 2XJNA 3AF9X 4LQVA 2JD60 2V2NA 3BVFA 3EZ0A 1JI4A 1LKMA 2ZA6A 3O7RA 2CN6A 4MJYA 2GYQA 4DE6A 3IQ1A 1JYBA 1JKVA 2XJMA 5D8OA 4TODA 5J8SA 2XKQA 2V2LA 3OJ5A 1GWGA 5D8QA 3Q4NA 1UMNA 2IY4A 2CN7A 2C2FA 5FEJA 5C6FA 4XKTA 3AF8X 4PGIA 4EVBA 1NF4A 1IERA 4M32A 4II4B 4LPNA 2Z5QA 3BKNA 4LQHA 5GN8B 4CYBA 3F36A 1BG7A 3UOIA 1Z6OM 2V2PA 5HQOA 4LQNA 4TOBA 5LG2A 3PW8A 3PWQA 4ITTA 5D8PA 3E1LA 3NOZX 2ZA7A 4ITWA 5D8SA 3KA8A 1R03A 1ZUJA 4XKUA 3PWFA 3TA8A 4ZMCA 1ZS3A 2V2OA 5LG8A 2HR5A 1YV1A 3F38A 3KXUA 2ZG9X 3AJOA 1S2ZA 1Z6OA 4Z5SA 2C2JA 2V2MA 4EVEA 3R2LA 3E1QA 3R2OA 5GU0X 3R2RA 3AJQA 2WLUA 4KVQA 4CY9A 4ZTTA 3E2CA 2C41A 3SH6A 3F37A 1JGCA 1RCGA 2V2JA 5GU1X 3HIUA 1RYTA 4RC7A 2OC5A 5CMRA 3OGHA 1JI5A 4CVPA 3H7GA 4IXKA 2ITBA 5CZUA 5K52A 2IU2A 3R2MA 3PW8C 3GE4A 5J8WA 3PVRB 1VEIA 4TOEA 2BJYA 3F34A 2VXIA 1DPSA 4TOHA 4Y08A 1L8HA 3IS7A 3GHQA 5JKMA 1O9RA 4R42A 5D8RA 2V15A 2Z6MA 1SQ3A 5FFAA 2HTNA 2QQYA 5HJHA 2CLUA 4ZKXA 1F30A 4LQJA 3BVEA 3F33A 3KX9A 1TK6A 4II4A 5D8XA 1Z4AA 3EGMA 1XZ3A 1VLGA 5GN8A 4ZL6A 2BK6A 3HL1A 4XKSA 2BKCA 3F32A 2D5KA 3RAVA 2XGWA 5FFEA 2FJCA 1NNQA 4M33A 3WVUA 3AK8A 4CVSA 4AM5A 1N1QA 3PVTB 2XJOA 4LPJA 4AM4A 4RC8A
chains in the Genus database with same CATH superfamily
2OH3A 2ZG8X 4CMYV 3R2KA 3E1OA 3Q4QA 3WVWA 3WNWA 3QB9A 3FSEA 5JKLA 4U3GA 1IESA 1MFRA 4QUWA 4DYXA 3BVIA 4TOAA 5LBHA 4KVSA 1NF6A 1AEWA 3AF7X 3QZ3A 2AR0A 2WWXB 3ES3A 3WVVA 3F39A 2VXXA 4KXRB 3KA4A 1QYBA 2PYBA 4MKUA 2X170 2FL0A 5GU3X 4EVDA 5JACA 4XGSA 1MOJA 3ISFA 2YJKA 1EUMA 3O7SA 3L0MA 4YKHA 3UNOA 4DYYA 5ERKA 1HRSA 2ZURX 5GOUA 3AK9A 4RC5B 5HJFA 3SIDA 3QVDA 2C6RA 1J30A 2JD80 5I4JA 1F33A 3A9QA 3PVRA 4ZJKA 4DYZA 3QD8A 4EVCA 3KA3A 3UFBA 4REUA 4ERUA 3W54A 3NP0X 3RD0A 2YW7A 2FG8A 1LKPA 4DYUA 4DI0A 3Q4RA 4LYXA 2YW6A 3R2HA 1RCCA 1B71A 1L8IA 2V8UA 3NP2X 3QHCA 5E1UA 5LS9A 5IX6A 2Z90A 1S30A 2CWLA 2GS4A 1JIGA 3U90A 5J93A 4TW3A 3E6RA 4CMYA 3PVTA 1OTKA 3RGDA 3IS8A 1YUXA 2YJJA 2G38B 2C2UA 1JKUA 1TJOA 4CVTA 4CYAA 3QHBA 3Q4OA 2F7NA 3PW1B 3E1NA 1YUZA 2ZA8A 1XZ1A 4LPMA 2FG4A 3E1MA 1KRQA 5CMQA 3RBCA 2V2IA 4ZKWA 3D19A 1RCDA 5FFBA 2V2RA 4MY7A 5ERJA 2CEIA 1RCEA 3BT5A 4RC6B 4TOFA 2UX1A 4ML5A 1SOFA 1NFVA 3AJPA 5K53A 4MUDA 3M6JA 4DZ0A 4Z3BA 3SHXA 1DATA 3RE7A 2CF7A 4P18A 1VJXA 2CLBA 2N02A 4PGKA 4RC5A 4AM2A 4LYUA 3A68A 3C1ZA 3ISEA 2GYDA 2W0OA 2ZG7X 2FKZA 3T9JA 1JREA 2CIHA 2G4HA 1DVBA 1UVHA 5J9VA 2Z5RA 1QGHA 2CHIA 4ETRA 2V2SA 2Z5PA 2WTLA 3SE1A 4CVRA 4KVRA 2IB0A 4ZL5A 4TOGA 5JKMG 3KA6A 2FZFA 4DASA 3UOFA 4E6KA 4WJG4 3FI6A 2CHPA 5D8YA 1JTSA 1S3QA 1BFRA 2FFXJ 4OYNA 1LKOA 1VELA 2FHAA 3PZAA 4ZKHA 3JZAB 1O9IA 1FHAA 2MGYA 3PVYA 1VEQA 3PW1A 3MPSA 4M35A 5GU2X 3VNXA 5E2DA 4ZLWA 4W4KB 3KHKA 1TKOA 3V3KB 2WLAA 1TKPA 3DBYA 3E1PA 3E6SA 3C1YA 2RBDA 1RCIA 3BVKA 3GVYA 4RC6A 5JKLG 3PWQC 4PG1A 3R2SA 2V8TA 5AXSA 3VVAA 3E1JA 1LB3A 4IWKA 2VZBA 1BCFA 2JD70 3PVYB 2Y44A 3BVLA 4IWJA 2Y3QA 4M34A 3KDQA 3FVBA 2BW1A 3KA9A 3ERZA 3KWOA 4PG0A 5FFDA 4A25A 1H96A 4MN9A 4RC7B 3F35A 4TOCA 3EZUA 4TO9A 5FFCA 4ISPA 2QF9A 4ISMA 2XJNA 3AF9X 4LQVA 2JD60 2V2NA 3BVFA 4E40A 3EZ0A 1JI4A 1LKMA 2ZA6A 3O7RA 2CN6A 4MJYA 2GYQA 4DE6A 3IQ1A 1JYBA 1JKVA 2XJMA 3GGYA 5D8OA 4TODA 5J8SA 2XKQA 2V2LA 3OJ5A 1GWGA 5HU6D 5D8QA 3Q4NA 1UMNA 2IY4A 2CN7A 2C2FA 5FEJA 5C6FA 4XKTA 3AF8X 4PGIA 4W4LB 4EVBA 1NF4A 1IERA 4M32A 3N6OA 4II4B 4LPNA 2Z5QA 3BKNA 4LQHA 5GN8B 4CYBA 3F36A 1BG7A 3UOIA 1Z6OM 2V2PA 5HQOA 4LQNA 4TOBA 5LG2A 5JDOB 3PW8A 3PWQA 4ITTA 3C23A 5D8PA 3E1LA 3NOZX 2ZA7A 4ITWA 5D8SA 3KA8A 1R03A 1ZUJA 4XKUA 3PWFA 3TA8A 4ZMCA 3FRSA 3JZ9A 1ZS3A 2V2OA 5LG8A 2HR5A 1YV1A 4YVZA 3F38A 3KXUA 2ZG9X 3AJOA 1S2ZA 1Z6OA 4Z5SA 2C2JA 2V2MA 3VV9A 4EVEA 3R2LA 3E1QA 3R2OA 5GU0X 3R2RA 3AJQA 3FRRA 2WLUA 4KVQA 4CY9A 4ZTTA 3E2CA 2C41A 3SH6A 3F37A 1JGCA 1RCGA 2V2JA 5GU1X 3HIUA 1RYTA 4RC7A 4YXJA 2OC5A 5CMRA 3OGHA 1JI5A 4CVPA 2OKCA 3H7GA 4IXKA 2ITBA 5CZUA 5K52A 2IU2A 3R2MA 3PW8C 3GE4A 5J8WA 3PVRB 1VEIA 4TOEA 2BJYA 3F34A 2VXIA 1DPSA 4TOHA 4Y08A 1L8HA 3IS7A 3GHQA 3C21A 4MXPA 5JKMA 1O9RA 4X0JA 4R42A 5D8RA 2V15A 2Z6MA 1SQ3A 5FFAA 2HTNA 2QQYA 5HJHA 2CLUA 4ZKXA 1F30A 4LQJA 3BVEA 4YXMA 3F33A 3KX9A 1TK6A 4II4A 5D8XA 1Z4AA 3EGMA 1XZ3A 3LKDA 1VLGA 5GN8A 4ZL6A 2BK6A 3HL1A 5JDOA 4XKSA 2BKCA 3F32A 2D5KA 3RAVA 2XGWA 3GGZA 5FFEA 2FJCA 1NNQA 4M33A 3WVUA 3AK8A 4CVSA 4AM5A 1N1QA 3PVTB 2XJOA 4LPJA 4AM4A 4RC8A
chains in the Genus database with same CATH topology
2OH3A 2ZG8X 4CMYV 3R2KA 3E1OA 3Q4QA 3WVWA 3WNWA 3QB9A 3FSEA 5JKLA 4U3GA 1IESA 1MFRA 4QUWA 4DYXA 3BVIA 4TOAA 5LBHA 4KVSA 1NF6A 1AEWA 3AF7X 3QZ3A 2AR0A 2WWXB 3ES3A 3WVVA 3F39A 2VXXA 4KXRB 3KA4A 1QYBA 2PYBA 4MKUA 2X170 2FL0A 5GU3X 4EVDA 5JACA 4XGSA 1MOJA 3ISFA 2YJKA 1EUMA 3O7SA 3L0MA 4YKHA 3UNOA 4DYYA 5ERKA 1HRSA 2ZURX 5GOUA 3AK9A 4RC5B 5HJFA 3SIDA 3QVDA 2C6RA 1J30A 2JD80 5I4JA 1F33A 3A9QA 3PVRA 4ZJKA 4DYZA 3QD8A 4EVCA 3KA3A 3UFBA 4REUA 4ERUA 3W54A 3NP0X 3RD0A 2YW7A 2FG8A 1LKPA 4DYUA 4DI0A 3Q4RA 4LYXA 2YW6A 3R2HA 1RCCA 1B71A 1L8IA 2V8UA 3NP2X 3QHCA 5E1UA 5LS9A 5IX6A 2Z90A 1S30A 2CWLA 2GS4A 1JIGA 3U90A 5J93A 4TW3A 3E6RA 4CMYA 3PVTA 1OTKA 3RGDA 3IS8A 1YUXA 2YJJA 2G38B 2C2UA 1JKUA 1TJOA 4CVTA 4CYAA 3QHBA 3Q4OA 2F7NA 3PW1B 3E1NA 1YUZA 2ZA8A 1XZ1A 4LPMA 2FG4A 3E1MA 1KRQA 5CMQA 3RBCA 2V2IA 4ZKWA 3D19A 1RCDA 5FFBA 2V2RA 4MY7A 5ERJA 2CEIA 1RCEA 3BT5A 4RC6B 4TOFA 2UX1A 4ML5A 1SOFA 1NFVA 3AJPA 5K53A 4MUDA 3M6JA 4DZ0A 4Z3BA 3SHXA 1DATA 3RE7A 2CF7A 4P18A 1VJXA 2CLBA 2N02A 4PGKA 4RC5A 4AM2A 4LYUA 3A68A 3C1ZA 3ISEA 2GYDA 2W0OA 2ZG7X 2FKZA 3T9JA 1JREA 2CIHA 2G4HA 1DVBA 1UVHA 5J9VA 2Z5RA 1QGHA 2CHIA 4ETRA 2V2SA 2Z5PA 2WTLA 3SE1A 4CVRA 4KVRA 2IB0A 4ZL5A 4TOGA 5JKMG 3KA6A 2FZFA 4DASA 3UOFA 4E6KA 4WJG4 3FI6A 2CHPA 5D8YA 1JTSA 1S3QA 1BFRA 2FFXJ 4OYNA 1LKOA 1VELA 2FHAA 3PZAA 4ZKHA 3JZAB 1O9IA 1FHAA 2MGYA 3PVYA 1VEQA 3PW1A 3MPSA 4M35A 5GU2X 3VNXA 5E2DA 4ZLWA 4W4KB 3KHKA 1TKOA 3V3KB 2WLAA 1TKPA 3DBYA 3E1PA 3E6SA 3C1YA 2RBDA 1RCIA 3BVKA 3GVYA 4RC6A 5JKLG 3PWQC 4PG1A 3R2SA 2V8TA 5AXSA 3VVAA 3E1JA 1LB3A 4IWKA 2VZBA 1BCFA 2JD70 3PVYB 2Y44A 3BVLA 4IWJA 2Y3QA 4M34A 3KDQA 3FVBA 2BW1A 3KA9A 3ERZA 3KWOA 4PG0A 5FFDA 4A25A 1H96A 4MN9A 4RC7B 3F35A 4TOCA 3EZUA 4TO9A 5FFCA 4ISPA 2QF9A 4ISMA 2XJNA 3AF9X 4LQVA 2JD60 2V2NA 3BVFA 4E40A 3EZ0A 1JI4A 1LKMA 2ZA6A 3O7RA 2CN6A 4MJYA 2GYQA 4DE6A 3IQ1A 1JYBA 1JKVA 2XJMA 3GGYA 5D8OA 4TODA 5J8SA 2XKQA 2V2LA 3OJ5A 1GWGA 5HU6D 5D8QA 3Q4NA 1UMNA 2IY4A 2CN7A 2C2FA 5FEJA 5C6FA 4XKTA 3AF8X 4PGIA 4W4LB 4EVBA 1NF4A 1IERA 4M32A 3N6OA 4II4B 4LPNA 2Z5QA 3BKNA 4LQHA 5GN8B 4CYBA 3F36A 1BG7A 3UOIA 1Z6OM 2V2PA 5HQOA 4LQNA 4TOBA 5LG2A 5JDOB 3PW8A 3PWQA 4ITTA 3C23A 5D8PA 3E1LA 3NOZX 2ZA7A 4ITWA 5D8SA 3KA8A 1R03A 1ZUJA 4XKUA 3PWFA 3TA8A 4ZMCA 3FRSA 3JZ9A 1ZS3A 2V2OA 5LG8A 2HR5A 1YV1A 4YVZA 3F38A 3KXUA 2ZG9X 3AJOA 1S2ZA 1Z6OA 4Z5SA 2C2JA 2V2MA 3VV9A 4EVEA 3R2LA 3E1QA 3R2OA 5GU0X 3R2RA 3AJQA 3FRRA 2WLUA 4KVQA 4CY9A 4ZTTA 3E2CA 2C41A 3SH6A 3F37A 1JGCA 1RCGA 2V2JA 5GU1X 3HIUA 1RYTA 4RC7A 4YXJA 2OC5A 5CMRA 3OGHA 1JI5A 4CVPA 2OKCA 3H7GA 4IXKA 2ITBA 5CZUA 5K52A 2IU2A 3R2MA 3PW8C 3GE4A 5J8WA 3PVRB 1VEIA 4TOEA 2BJYA 3F34A 2VXIA 1DPSA 4TOHA 4Y08A 1L8HA 3IS7A 3GHQA 3C21A 4MXPA 5JKMA 1O9RA 4X0JA 4R42A 5D8RA 2V15A 2Z6MA 1SQ3A 5FFAA 2HTNA 2QQYA 5HJHA 2CLUA 4ZKXA 1F30A 4LQJA 3BVEA 4YXMA 3F33A 3KX9A 1TK6A 4II4A 5D8XA 1Z4AA 3EGMA 1XZ3A 3LKDA 1VLGA 5GN8A 4ZL6A 2BK6A 3HL1A 5JDOA 4XKSA 2BKCA 3F32A 2D5KA 3RAVA 2XGWA 3GGZA 5FFEA 2FJCA 1NNQA 4M33A 3WVUA 3AK8A 4CVSA 4AM5A 1N1QA 3PVTB 2XJOA 4LPJA 4AM4A 4RC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OH3 A;  2ZG8 X;  4CMY V;  3R2K A;  3E1O A;  3Q4Q A;  3WVW A;  3WNW A;  3QB9 A;  3FSE A;  5JKL A;  4U3G A;  1IES A;  1MFR A;  4QUW A;  4DYX A;  3BVI A;  4TOA A;  5LBH A;  4KVS A;  1NF6 A;  1AEW A;  3AF7 X;  3QZ3 A;  3ES3 A;  3WVV A;  3F39 A;  2VXX A;  3KA4 A;  1QYB A;  2PYB A;  4MKU A;  2X17 0;  2FL0 A;  5GU3 X;  4EVD A;  5JAC A;  4XGS A;  1MOJ A;  3ISF A;  2YJK A;  1EUM A;  3O7S A;  4YKH A;  3UNO A;  4DYY A;  5ERK A;  1HRS A;  2ZUR X;  5GOU A;  3AK9 A;  4RC5 B;  5HJF A;  3SID A;  3QVD A;  2C6R A;  1J30 A;  2JD8 0;  5I4J A;  1F33 A;  3A9Q A;  3PVR A;  4ZJK A;  4DYZ A;  3QD8 A;  4EVC A;  3KA3 A;  4REU A;  4ERU A;  3NP0 X;  3RD0 A;  2YW7 A;  2FG8 A;  1LKP A;  4DYU A;  4DI0 A;  3Q4R A;  4LYX A;  2YW6 A;  3R2H A;  1RCC A;  1B71 A;  1L8I A;  3NP2 X;  3QHC A;  5E1U A;  5LS9 A;  5IX6 A;  2Z90 A;  1S30 A;  2GS4 A;  1JIG A;  3U90 A;  5J93 A;  4TW3 A;  3E6R A;  4CMY A;  3PVT A;  1OTK A;  3RGD A;  3IS8 A;  1YUX A;  2YJJ A;  2C2U A;  1JKU A;  1TJO A;  4CVT A;  4CYA A;  3QHB A;  3Q4O A;  2F7N A;  3PW1 B;  3E1N A;  1YUZ A;  2ZA8 A;  1XZ1 A;  4LPM A;  2FG4 A;  3E1M A;  1KRQ A;  5CMQ A;  3RBC A;  2V2I A;  4ZKW A;  1RCD A;  5FFB A;  2V2R A;  4MY7 A;  5ERJ A;  2CEI A;  1RCE A;  3BT5 A;  4RC6 B;  4TOF A;  2UX1 A;  4ML5 A;  1SOF A;  1NFV A;  3AJP A;  5K53 A;  4MUD A;  4DZ0 A;  4Z3B A;  3SHX A;  1DAT A;  3RE7 A;  2CF7 A;  4P18 A;  1VJX A;  2CLB A;  4PGK A;  4RC5 A;  4AM2 A;  4LYU A;  3A68 A;  3ISE A;  2GYD A;  2W0O A;  2ZG7 X;  2FKZ A;  3T9J A;  1JRE A;  2CIH A;  2G4H A;  1DVB A;  1UVH A;  5J9V A;  2Z5R A;  1QGH A;  2CHI A;  4ETR A;  2V2S A;  2Z5P A;  2WTL A;  3SE1 A;  4CVR A;  4KVR A;  2IB0 A;  4ZL5 A;  4TOG A;  5JKM G;  3KA6 A;  2FZF A;  4DAS A;  3UOF A;  4E6K A;  3FI6 A;  2CHP A;  5D8Y A;  1JTS A;  1S3Q A;  1BFR A;  2FFX J;  4OYN A;  1LKO A;  1VEL A;  2FHA A;  3PZA A;  4ZKH A;  1O9I A;  1FHA A;  3PVY A;  1VEQ A;  3PW1 A;  3MPS A;  4M35 A;  5GU2 X;  3VNX A;  5E2D A;  4ZLW A;  1TKO A;  2WLA A;  1TKP A;  3E1P A;  3E6S A;  2RBD A;  1RCI A;  3BVK A;  3GVY A;  4RC6 A;  5JKL G;  3PWQ C;  4PG1 A;  3R2S A;  5AXS A;  3E1J A;  1LB3 A;  4IWK A;  2VZB A;  1BCF A;  2JD7 0;  3PVY B;  3BVL A;  4IWJ A;  2Y3Q A;  4M34 A;  3FVB A;  2BW1 A;  3KA9 A;  3ERZ A;  3KWO A;  4PG0 A;  5FFD A;  4A25 A;  1H96 A;  4MN9 A;  4RC7 B;  3F35 A;  4TOC A;  3EZU A;  4TO9 A;  5FFC A;  4ISP A;  2QF9 A;  4ISM A;  2XJN A;  3AF9 X;  4LQV A;  2JD6 0;  2V2N A;  3BVF A;  3EZ0 A;  1JI4 A;  1LKM A;  2ZA6 A;  3O7R A;  2CN6 A;  4MJY A;  2GYQ A;  4DE6 A;  3IQ1 A;  1JYB A;  1JKV A;  2XJM A;  5D8O A;  4TOD A;  5J8S A;  2XKQ A;  2V2L A;  3OJ5 A;  1GWG A;  5D8Q A;  3Q4N A;  1UMN A;  2IY4 A;  2CN7 A;  2C2F A;  5FEJ A;  5C6F A;  4XKT A;  3AF8 X;  4PGI A;  4EVB A;  1NF4 A;  1IER A;  4M32 A;  4II4 B;  4LPN A;  2Z5Q A;  3BKN A;  4LQH A;  5GN8 B;  4CYB A;  3F36 A;  1BG7 A;  3UOI A;  1Z6O M;  2V2P A;  5HQO A;  4LQN A;  4TOB A;  5LG2 A;  3PW8 A;  3PWQ A;  4ITT A;  5D8P A;  3E1L A;  3NOZ X;  2ZA7 A;  4ITW A;  5D8S A;  3KA8 A;  1R03 A;  1ZUJ A;  4XKU A;  3PWF A;  3TA8 A;  4ZMC A;  1ZS3 A;  2V2O A;  5LG8 A;  2HR5 A;  1YV1 A;  3F38 A;  3KXU A;  2ZG9 X;  3AJO A;  1S2Z A;  1Z6O A;  4Z5S A;  2C2J A;  2V2M A;  4EVE A;  3R2L A;  3E1Q A;  3R2O A;  5GU0 X;  3R2R A;  3AJQ A;  2WLU A;  4KVQ A;  4CY9 A;  4ZTT A;  3E2C A;  2C41 A;  3SH6 A;  3F37 A;  1JGC A;  1RCG A;  2V2J A;  5GU1 X;  3HIU A;  1RYT A;  4RC7 A;  2OC5 A;  5CMR A;  3OGH A;  1JI5 A;  4CVP A;  3H7G A;  4IXK A;  2ITB A;  5CZU A;  5K52 A;  2IU2 A;  3R2M A;  3PW8 C;  3GE4 A;  5J8W A;  3PVR B;  1VEI A;  4TOE A;  2BJY A;  3F34 A;  2VXI A;  1DPS A;  4TOH A;  4Y08 A;  1L8H A;  3IS7 A;  3GHQ A;  5JKM A;  1O9R A;  4R42 A;  5D8R A;  2V15 A;  2Z6M A;  1SQ3 A;  5FFA A;  2HTN A;  2QQY A;  5HJH A;  2CLU A;  4ZKX A;  1F30 A;  4LQJ A;  3BVE A;  3F33 A;  3KX9 A;  1TK6 A;  4II4 A;  5D8X A;  1Z4A A;  3EGM A;  1XZ3 A;  1VLG A;  5GN8 A;  4ZL6 A;  2BK6 A;  3HL1 A;  4XKS A;  2BKC A;  3F32 A;  2D5K A;  3RAV A;  2XGW A;  5FFE A;  2FJC A;  1NNQ A;  4M33 A;  3WVU A;  3AK8 A;  4CVS A;  4AM5 A;  1N1Q A;  3PVT B;  2XJO A;  4LPJ A;  4AM4 A;  4RC8 A; 
#chains in the Genus database with same CATH topology
 2OH3 A;  2ZG8 X;  4CMY V;  3R2K A;  3E1O A;  3Q4Q A;  3WVW A;  3WNW A;  3QB9 A;  3FSE A;  5JKL A;  4U3G A;  1IES A;  1MFR A;  4QUW A;  4DYX A;  3BVI A;  4TOA A;  5LBH A;  4KVS A;  1NF6 A;  1AEW A;  3AF7 X;  3QZ3 A;  2AR0 A;  2WWX B;  3ES3 A;  3WVV A;  3F39 A;  2VXX A;  4KXR B;  3KA4 A;  1QYB A;  2PYB A;  4MKU A;  2X17 0;  2FL0 A;  5GU3 X;  4EVD A;  5JAC A;  4XGS A;  1MOJ A;  3ISF A;  2YJK A;  1EUM A;  3O7S A;  3L0M A;  4YKH A;  3UNO A;  4DYY A;  5ERK A;  1HRS A;  2ZUR X;  5GOU A;  3AK9 A;  4RC5 B;  5HJF A;  3SID A;  3QVD A;  2C6R A;  1J30 A;  2JD8 0;  5I4J A;  1F33 A;  3A9Q A;  3PVR A;  4ZJK A;  4DYZ A;  3QD8 A;  4EVC A;  3KA3 A;  3UFB A;  4REU A;  4ERU A;  3W54 A;  3NP0 X;  3RD0 A;  2YW7 A;  2FG8 A;  1LKP A;  4DYU A;  4DI0 A;  3Q4R A;  4LYX A;  2YW6 A;  3R2H A;  1RCC A;  1B71 A;  1L8I A;  2V8U A;  3NP2 X;  3QHC A;  5E1U A;  5LS9 A;  5IX6 A;  2Z90 A;  1S30 A;  2CWL A;  2GS4 A;  1JIG A;  3U90 A;  5J93 A;  4TW3 A;  3E6R A;  4CMY A;  3PVT A;  1OTK A;  3RGD A;  3IS8 A;  1YUX A;  2YJJ A;  2G38 B;  2C2U A;  1JKU A;  1TJO A;  4CVT A;  4CYA A;  3QHB A;  3Q4O A;  2F7N A;  3PW1 B;  3E1N A;  1YUZ A;  2ZA8 A;  1XZ1 A;  4LPM A;  2FG4 A;  3E1M A;  1KRQ A;  5CMQ A;  3RBC A;  2V2I A;  4ZKW A;  3D19 A;  1RCD A;  5FFB A;  2V2R A;  4MY7 A;  5ERJ A;  2CEI A;  1RCE A;  3BT5 A;  4RC6 B;  4TOF A;  2UX1 A;  4ML5 A;  1SOF A;  1NFV A;  3AJP A;  5K53 A;  4MUD A;  3M6J A;  4DZ0 A;  4Z3B A;  3SHX A;  1DAT A;  3RE7 A;  2CF7 A;  4P18 A;  1VJX A;  2CLB A;  2N02 A;  4PGK A;  4RC5 A;  4AM2 A;  4LYU A;  3A68 A;  3C1Z A;  3ISE A;  2GYD A;  2W0O A;  2ZG7 X;  2FKZ A;  3T9J A;  1JRE A;  2CIH A;  2G4H A;  1DVB A;  1UVH A;  5J9V A;  2Z5R A;  1QGH A;  2CHI A;  4ETR A;  2V2S A;  2Z5P A;  2WTL A;  3SE1 A;  4CVR A;  4KVR A;  2IB0 A;  4ZL5 A;  4TOG A;  5JKM G;  3KA6 A;  2FZF A;  4DAS A;  3UOF A;  4E6K A;  4WJG 4;  3FI6 A;  2CHP A;  5D8Y A;  1JTS A;  1S3Q A;  1BFR A;  2FFX J;  4OYN A;  1LKO A;  1VEL A;  2FHA A;  3PZA A;  4ZKH A;  3JZA B;  1O9I A;  1FHA A;  2MGY A;  3PVY A;  1VEQ A;  3PW1 A;  3MPS A;  4M35 A;  5GU2 X;  3VNX A;  5E2D A;  4ZLW A;  4W4K B;  3KHK A;  1TKO A;  3V3K B;  2WLA A;  1TKP A;  3DBY A;  3E1P A;  3E6S A;  3C1Y A;  2RBD A;  1RCI A;  3BVK A;  3GVY A;  4RC6 A;  5JKL G;  3PWQ C;  4PG1 A;  3R2S A;  2V8T A;  5AXS A;  3VVA A;  3E1J A;  1LB3 A;  4IWK A;  2VZB A;  1BCF A;  2JD7 0;  3PVY B;  2Y44 A;  3BVL A;  4IWJ A;  2Y3Q A;  4M34 A;  3KDQ A;  3FVB A;  2BW1 A;  3KA9 A;  3ERZ A;  3KWO A;  4PG0 A;  5FFD A;  4A25 A;  1H96 A;  4MN9 A;  4RC7 B;  3F35 A;  4TOC A;  3EZU A;  4TO9 A;  5FFC A;  4ISP A;  2QF9 A;  4ISM A;  2XJN A;  3AF9 X;  4LQV A;  2JD6 0;  2V2N A;  3BVF A;  4E40 A;  3EZ0 A;  1JI4 A;  1LKM A;  2ZA6 A;  3O7R A;  2CN6 A;  4MJY A;  2GYQ A;  4DE6 A;  3IQ1 A;  1JYB A;  1JKV A;  2XJM A;  3GGY A;  5D8O A;  4TOD A;  5J8S A;  2XKQ A;  2V2L A;  3OJ5 A;  1GWG A;  5HU6 D;  5D8Q A;  3Q4N A;  1UMN A;  2IY4 A;  2CN7 A;  2C2F A;  5FEJ A;  5C6F A;  4XKT A;  3AF8 X;  4PGI A;  4W4L B;  4EVB A;  1NF4 A;  1IER A;  4M32 A;  3N6O A;  4II4 B;  4LPN A;  2Z5Q A;  3BKN A;  4LQH A;  5GN8 B;  4CYB A;  3F36 A;  1BG7 A;  3UOI A;  1Z6O M;  2V2P A;  5HQO A;  4LQN A;  4TOB A;  5LG2 A;  5JDO B;  3PW8 A;  3PWQ A;  4ITT A;  3C23 A;  5D8P A;  3E1L A;  3NOZ X;  2ZA7 A;  4ITW A;  5D8S A;  3KA8 A;  1R03 A;  1ZUJ A;  4XKU A;  3PWF A;  3TA8 A;  4ZMC A;  3FRS A;  3JZ9 A;  1ZS3 A;  2V2O A;  5LG8 A;  2HR5 A;  1YV1 A;  4YVZ A;  3F38 A;  3KXU A;  2ZG9 X;  3AJO A;  1S2Z A;  1Z6O A;  4Z5S A;  2C2J A;  2V2M A;  3VV9 A;  4EVE A;  3R2L A;  3E1Q A;  3R2O A;  5GU0 X;  3R2R A;  3AJQ A;  3FRR A;  2WLU A;  4KVQ A;  4CY9 A;  4ZTT A;  3E2C A;  2C41 A;  3SH6 A;  3F37 A;  1JGC A;  1RCG A;  2V2J A;  5GU1 X;  3HIU A;  1RYT A;  4RC7 A;  4YXJ A;  2OC5 A;  5CMR A;  3OGH A;  1JI5 A;  4CVP A;  2OKC A;  3H7G A;  4IXK A;  2ITB A;  5CZU A;  5K52 A;  2IU2 A;  3R2M A;  3PW8 C;  3GE4 A;  5J8W A;  3PVR B;  1VEI A;  4TOE A;  2BJY A;  3F34 A;  2VXI A;  1DPS A;  4TOH A;  4Y08 A;  1L8H A;  3IS7 A;  3GHQ A;  3C21 A;  4MXP A;  5JKM A;  1O9R A;  4X0J A;  4R42 A;  5D8R A;  2V15 A;  2Z6M A;  1SQ3 A;  5FFA A;  2HTN A;  2QQY A;  5HJH A;  2CLU A;  4ZKX A;  1F30 A;  4LQJ A;  3BVE A;  4YXM A;  3F33 A;  3KX9 A;  1TK6 A;  4II4 A;  5D8X A;  1Z4A A;  3EGM A;  1XZ3 A;  3LKD A;  1VLG A;  5GN8 A;  4ZL6 A;  2BK6 A;  3HL1 A;  5JDO A;  4XKS A;  2BKC A;  3F32 A;  2D5K A;  3RAV A;  2XGW A;  3GGZ A;  5FFE A;  2FJC A;  1NNQ A;  4M33 A;  3WVU A;  3AK8 A;  4CVS A;  4AM5 A;  1N1Q A;  3PVT B;  2XJO A;  4LPJ A;  4AM4 A;  4RC8 A; 
#chains in the Genus database with same CATH homology
 2OH3 A;  2ZG8 X;  4CMY V;  3R2K A;  3E1O A;  3Q4Q A;  3WVW A;  3WNW A;  3QB9 A;  3FSE A;  5JKL A;  4U3G A;  1IES A;  1MFR A;  4QUW A;  4DYX A;  3BVI A;  4TOA A;  5LBH A;  4KVS A;  1NF6 A;  1AEW A;  3AF7 X;  3QZ3 A;  2AR0 A;  2WWX B;  3ES3 A;  3WVV A;  3F39 A;  2VXX A;  4KXR B;  3KA4 A;  1QYB A;  2PYB A;  4MKU A;  2X17 0;  2FL0 A;  5GU3 X;  4EVD A;  5JAC A;  4XGS A;  1MOJ A;  3ISF A;  2YJK A;  1EUM A;  3O7S A;  3L0M A;  4YKH A;  3UNO A;  4DYY A;  5ERK A;  1HRS A;  2ZUR X;  5GOU A;  3AK9 A;  4RC5 B;  5HJF A;  3SID A;  3QVD A;  2C6R A;  1J30 A;  2JD8 0;  5I4J A;  1F33 A;  3A9Q A;  3PVR A;  4ZJK A;  4DYZ A;  3QD8 A;  4EVC A;  3KA3 A;  3UFB A;  4REU A;  4ERU A;  3W54 A;  3NP0 X;  3RD0 A;  2YW7 A;  2FG8 A;  1LKP A;  4DYU A;  4DI0 A;  3Q4R A;  4LYX A;  2YW6 A;  3R2H A;  1RCC A;  1B71 A;  1L8I A;  2V8U A;  3NP2 X;  3QHC A;  5E1U A;  5LS9 A;  5IX6 A;  2Z90 A;  1S30 A;  2CWL A;  2GS4 A;  1JIG A;  3U90 A;  5J93 A;  4TW3 A;  3E6R A;  4CMY A;  3PVT A;  1OTK A;  3RGD A;  3IS8 A;  1YUX A;  2YJJ A;  2G38 B;  2C2U A;  1JKU A;  1TJO A;  4CVT A;  4CYA A;  3QHB A;  3Q4O A;  2F7N A;  3PW1 B;  3E1N A;  1YUZ A;  2ZA8 A;  1XZ1 A;  4LPM A;  2FG4 A;  3E1M A;  1KRQ A;  5CMQ A;  3RBC A;  2V2I A;  4ZKW A;  3D19 A;  1RCD A;  5FFB A;  2V2R A;  4MY7 A;  5ERJ A;  2CEI A;  1RCE A;  3BT5 A;  4RC6 B;  4TOF A;  2UX1 A;  4ML5 A;  1SOF A;  1NFV A;  3AJP A;  5K53 A;  4MUD A;  3M6J A;  4DZ0 A;  4Z3B A;  3SHX A;  1DAT A;  3RE7 A;  2CF7 A;  4P18 A;  1VJX A;  2CLB A;  2N02 A;  4PGK A;  4RC5 A;  4AM2 A;  4LYU A;  3A68 A;  3C1Z A;  3ISE A;  2GYD A;  2W0O A;  2ZG7 X;  2FKZ A;  3T9J A;  1JRE A;  2CIH A;  2G4H A;  1DVB A;  1UVH A;  5J9V A;  2Z5R A;  1QGH A;  2CHI A;  4ETR A;  2V2S A;  2Z5P A;  2WTL A;  3SE1 A;  4CVR A;  4KVR A;  2IB0 A;  4ZL5 A;  4TOG A;  5JKM G;  3KA6 A;  2FZF A;  4DAS A;  3UOF A;  4E6K A;  4WJG 4;  3FI6 A;  2CHP A;  5D8Y A;  1JTS A;  1S3Q A;  1BFR A;  2FFX J;  4OYN A;  1LKO A;  1VEL A;  2FHA A;  3PZA A;  4ZKH A;  3JZA B;  1O9I A;  1FHA A;  2MGY A;  3PVY A;  1VEQ A;  3PW1 A;  3MPS A;  4M35 A;  5GU2 X;  3VNX A;  5E2D A;  4ZLW A;  4W4K B;  3KHK A;  1TKO A;  3V3K B;  2WLA A;  1TKP A;  3DBY A;  3E1P A;  3E6S A;  3C1Y A;  2RBD A;  1RCI A;  3BVK A;  3GVY A;  4RC6 A;  5JKL G;  3PWQ C;  4PG1 A;  3R2S A;  2V8T A;  5AXS A;  3VVA A;  3E1J A;  1LB3 A;  4IWK A;  2VZB A;  1BCF A;  2JD7 0;  3PVY B;  2Y44 A;  3BVL A;  4IWJ A;  2Y3Q A;  4M34 A;  3KDQ A;  3FVB A;  2BW1 A;  3KA9 A;  3ERZ A;  3KWO A;  4PG0 A;  5FFD A;  4A25 A;  1H96 A;  4MN9 A;  4RC7 B;  3F35 A;  4TOC A;  3EZU A;  4TO9 A;  5FFC A;  4ISP A;  2QF9 A;  4ISM A;  2XJN A;  3AF9 X;  4LQV A;  2JD6 0;  2V2N A;  3BVF A;  4E40 A;  3EZ0 A;  1JI4 A;  1LKM A;  2ZA6 A;  3O7R A;  2CN6 A;  4MJY A;  2GYQ A;  4DE6 A;  3IQ1 A;  1JYB A;  1JKV A;  2XJM A;  3GGY A;  5D8O A;  4TOD A;  5J8S A;  2XKQ A;  2V2L A;  3OJ5 A;  1GWG A;  5HU6 D;  5D8Q A;  3Q4N A;  1UMN A;  2IY4 A;  2CN7 A;  2C2F A;  5FEJ A;  5C6F A;  4XKT A;  3AF8 X;  4PGI A;  4W4L B;  4EVB A;  1NF4 A;  1IER A;  4M32 A;  3N6O A;  4II4 B;  4LPN A;  2Z5Q A;  3BKN A;  4LQH A;  5GN8 B;  4CYB A;  3F36 A;  1BG7 A;  3UOI A;  1Z6O M;  2V2P A;  5HQO A;  4LQN A;  4TOB A;  5LG2 A;  5JDO B;  3PW8 A;  3PWQ A;  4ITT A;  3C23 A;  5D8P A;  3E1L A;  3NOZ X;  2ZA7 A;  4ITW A;  5D8S A;  3KA8 A;  1R03 A;  1ZUJ A;  4XKU A;  3PWF A;  3TA8 A;  4ZMC A;  3FRS A;  3JZ9 A;  1ZS3 A;  2V2O A;  5LG8 A;  2HR5 A;  1YV1 A;  4YVZ A;  3F38 A;  3KXU A;  2ZG9 X;  3AJO A;  1S2Z A;  1Z6O A;  4Z5S A;  2C2J A;  2V2M A;  3VV9 A;  4EVE A;  3R2L A;  3E1Q A;  3R2O A;  5GU0 X;  3R2R A;  3AJQ A;  3FRR A;  2WLU A;  4KVQ A;  4CY9 A;  4ZTT A;  3E2C A;  2C41 A;  3SH6 A;  3F37 A;  1JGC A;  1RCG A;  2V2J A;  5GU1 X;  3HIU A;  1RYT A;  4RC7 A;  4YXJ A;  2OC5 A;  5CMR A;  3OGH A;  1JI5 A;  4CVP A;  2OKC A;  3H7G A;  4IXK A;  2ITB A;  5CZU A;  5K52 A;  2IU2 A;  3R2M A;  3PW8 C;  3GE4 A;  5J8W A;  3PVR B;  1VEI A;  4TOE A;  2BJY A;  3F34 A;  2VXI A;  1DPS A;  4TOH A;  4Y08 A;  1L8H A;  3IS7 A;  3GHQ A;  3C21 A;  4MXP A;  5JKM A;  1O9R A;  4X0J A;  4R42 A;  5D8R A;  2V15 A;  2Z6M A;  1SQ3 A;  5FFA A;  2HTN A;  2QQY A;  5HJH A;  2CLU A;  4ZKX A;  1F30 A;  4LQJ A;  3BVE A;  4YXM A;  3F33 A;  3KX9 A;  1TK6 A;  4II4 A;  5D8X A;  1Z4A A;  3EGM A;  1XZ3 A;  3LKD A;  1VLG A;  5GN8 A;  4ZL6 A;  2BK6 A;  3HL1 A;  5JDO A;  4XKS A;  2BKC A;  3F32 A;  2D5K A;  3RAV A;  2XGW A;  3GGZ A;  5FFE A;  2FJC A;  1NNQ A;  4M33 A;  3WVU A;  3AK8 A;  4CVS A;  4AM5 A;  1N1Q A;  3PVT B;  2XJO A;  4LPJ A;  4AM4 A;  4RC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...