4DYXA

Crystal structure of the cu-adduct of human h-ferritin variant 4his-delta c-star
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
172
structure length
172
Chain Sequence
TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFHHQSHEEHEHAHKLMKLQNQRGGRIFLQDIQKPDEDDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin heavy chain
publication title Re-engineering protein interfaces yields copper-inducible ferritin cage assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 172
sequence length 172
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4dyxA00
3TA8A 3RGDA 1JKVA 3PZAA 1O9IA 4LQNA 3PW1B 1ZS3A 2BJYA 2FKZA 4M34A 4DE6A 5D8SA 4RC7B 5LS9A 1F30A 1L8HA 1LB3A 2GYDA 3AF9X 3E6SA 1RCCA 1RCGA 3SH6A 3E1PA 4TOGA 3PWQA 4AM5A 2Z5PA 3E1OA 3SE1A 2FL0A 2QF9A 3A68A 5LG2A 4EVEA 1Z6OM 3KA3A 3QHBA 2VXXA 2XJMA 4XGSA 3RAVA 5GU3X 1DPSA 4RC5B 3AK9A 5HJHA 2WLAA 3EGMA 5D8RA 5ERJA 4CVSA 4DASA 5D8YA 5CMRA 3PVRB 4M33A 3KX9A 1TKPA 4ZKXA 4MJYA 1B71A 3BVFA 4Z3BA 3O7SA 3FSEA 4PG1A 5HJFA 2BW1A 5LG8A 2C2UA 2YJKA 2ZA8A 4IXKA 2OC5A 3KA9A 2JD60 4TOFA 4CMYV 1JREA 4ERUA 3QZ3A 3PW8C 5K53A 3HIUA 1MFRA 1S2ZA 4MY7A 3PWFA 3F35A 4LQHA 4PGKA 5E1UA 3ISFA 1KRQA 1TJOA 4ZTTA 1O9RA 4ITTA 1TK6A 3Q4NA 5GN8B 4LPJA 2V2NA 4CY9A 1VELA 4ZKWA 3F38A 3PVTB 5JKMA 3KA8A 3NP0X 3OGHA 4LQVA 2QQYA 5GOUA 3IS8A 4EVDA 4ML5A 3IQ1A 3WVUA 2CHPA 2Z90A 3F34A 4TOEA 3UOFA 1TKOA 3AK8A 5FFDA 1LKPA 3ISEA 3AF7X 3Q4OA 3EZ0A 2Y3QA 2CHIA 3R2OA 1F33A 2RBDA 2X170 4DYYA 5IX6A 3RBCA 1QGHA 3SIDA 1IESA 3QHCA 5CZUA 2V2SA 2V2RA 2FHAA 1NF6A 2JD70 2F7NA 4DI0A 4OYNA 2PYBA 3KA4A 4A25A 3FVBA 4LYXA 4QUWA 3KA6A 4Y08A 1JTSA 4U3GA 1RCDA 3E1MA 4TOAA 3O7RA 5J8SA 2VXIA 5GU0X 2ZURX 4TODA 2D5KA 2CLUA 2V2IA 2BKCA 3QB9A 5CMQA 5D8OA 3E1NA 1MOJA 5GU1X 5JKMG 1UMNA 5ERKA 4II4A 1VLGA 2C41A 1S30A 3HL1A 5FFBA 3E1LA 3ERZA 4IWKA 4DZ0A 3AF8X 1YUXA 3PW1A 4AM4A 4M35A 2FFXJ 1ZUJA 4ZL5A 4M32A 1JIGA 2XKQA 4TOCA 4RC6B 1JGCA 1VJXA 3GVYA 4E6KA 1VEIA 1RYTA 4MUDA 3KWOA 1J30A 2V2PA 2YJJA 4RC5A 1SOFA 3PVYB 4ZKHA 5AXSA 5J9VA 4PG0A 3WNWA 4RC8A 3VNXA 4EVCA 1VEQA 3R2LA 1DVBA 3R2SA 3PVRA 1JKUA 3PWQC 1FHAA 3FI6A 1BCFA 2CN6A 2GS4A 3IS7A 3OJ5A 3Q4QA 2Z5RA 2C2FA 4CYBA 3ES3A 2HR5A 2Z6MA 2HTNA 5JKLA 2CLBA 5FFCA 4ITWA 5C6FA 2CF7A 1NF4A 5E2DA 3A9QA 3E6RA 3WVVA 2FG8A 2IU2A 3T9JA 1OTKA 2CIHA 1DATA 3F39A 4MN9A 2BK6A 4CVPA 1XZ1A 3GHQA 4KVSA 5GN8A 4AM2A 3SHXA 2ZG7X 1SQ3A 2ZG9X 1Z6OA 4REUA 3PVTA 1BG7A 5GU2X 1RCEA 1LKOA 4ZL6A 4CMYA 3BVIA 4LQJA 1NNQA 2CEIA 3EZUA 2V2JA 5FEJA 4Z5SA 3R2RA 5JACA 4TOBA 5FFEA 1N1QA 3MPSA 2ZA7A 5D8PA 4DYZA 4TOHA 3PW8A 3UOIA 3WVWA 1JI4A 1BFRA 2V15A 3QD8A 3E1QA 1UVHA 4CYAA 1JYBA 1GWGA 2IB0A 2JD80 5JKLG 4DYUA 3AJOA 4LYUA 4LPMA 2V2OA 4ETRA 3RE7A 2WTLA 3F37A 4ZJKA 1L8IA 2OH3A 4CVRA 4RC7A 1RCIA 4ISMA 4DYXA 5J8WA 2C2JA 3E1JA 4ISPA 5D8QA 4XKTA 2XJOA 2WLUA 2ZA6A 4KVQA 4KVRA 1LKMA 2Z5QA 3RD0A 1H96A 4XKSA 3U90A 2IY4A 1AEWA 3BVLA 2VZBA 3F36A 5HQOA 3F32A 4TO9A 2ZG8X 2YW7A 4IWJA 5FFAA 4XKUA 4R42A 1Z4AA 5D8XA 3UNOA 5I4JA 1S3QA 4EVBA 2W0OA 1IERA 2GYQA 1JI5A 3BKNA 1R03A 4YKHA 1YV1A 3NOZX 3R2MA 1YUZA 2FJCA 3F33A 4ZLWA 3BVKA 4RC6A 3BT5A 4LPNA 1NFVA 4ZMCA 3BVEA 5J93A 1EUMA 3AJQA 3PVYA 4PGIA 2G4HA 3NP2X 3R2HA 1HRSA 2CN7A 3R2KA 3GE4A 2YW6A 2V2LA 3KXUA 2ITBA 2XGWA 2XJNA 2V2MA 3H7GA 4MKUA 4P18A 5K52A 3AJPA 2UX1A 1XZ3A 2FZFA 3E2CA 1QYBA 4CVTA 4TW3A 4II4B 5LBHA 2C6RA 3Q4RA 2FG4A 3QVDA
chains in the Genus database with same CATH superfamily
3TA8A 3RGDA 1JKVA 3PZAA 1O9IA 4LQNA 3PW1B 1ZS3A 2BJYA 2FKZA 4M34A 4DE6A 5D8SA 4RC7B 2Y44A 5LS9A 1F30A 1L8HA 1LB3A 2GYDA 3AF9X 3E6SA 1RCCA 1RCGA 3SH6A 3E1PA 4TOGA 3PWQA 4AM5A 2Z5PA 4KXRB 3E1OA 3SE1A 2FL0A 2QF9A 3A68A 5LG2A 4EVEA 1Z6OM 3KA3A 3QHBA 2VXXA 2XJMA 4XGSA 3RAVA 3VVAA 5GU3X 1DPSA 4RC5B 3AK9A 5HJHA 2WLAA 3EGMA 5D8RA 5ERJA 4CVSA 4DASA 5D8YA 5CMRA 3PVRB 4M33A 3KX9A 1TKPA 4ZKXA 4MJYA 1B71A 3BVFA 4Z3BA 3O7SA 3DBYA 3FSEA 4PG1A 5HJFA 3D19A 2BW1A 5LG8A 2C2UA 2YJKA 2ZA8A 2V8UA 4IXKA 2OC5A 3KA9A 2JD60 4TOFA 4CMYV 1JREA 4ERUA 3QZ3A 3PW8C 5K53A 3HIUA 1MFRA 1S2ZA 4MY7A 3PWFA 3F35A 4LQHA 4PGKA 5E1UA 3ISFA 1KRQA 1TJOA 4ZTTA 1O9RA 4ITTA 1TK6A 3Q4NA 5GN8B 4LPJA 2V2NA 4CY9A 1VELA 4ZKWA 3F38A 3PVTB 5JKMA 3KA8A 3NP0X 3OGHA 4LQVA 2QQYA 5GOUA 3KHKA 3IS8A 4EVDA 4ML5A 3IQ1A 3WVUA 2CHPA 2Z90A 2CWLA 3F34A 4TOEA 3UOFA 1TKOA 3AK8A 5FFDA 4MXPA 1LKPA 3ISEA 3AF7X 3Q4OA 3EZ0A 2Y3QA 2CHIA 3R2OA 1F33A 2RBDA 2X170 4DYYA 5IX6A 3RBCA 4YXJA 1QGHA 3SIDA 1IESA 3QHCA 5CZUA 2V2SA 2V2RA 2FHAA 1NF6A 5JDOB 2JD70 2F7NA 2N02A 4DI0A 4OYNA 2PYBA 3KA4A 4A25A 3FVBA 4LYXA 4QUWA 3KA6A 4Y08A 1JTSA 4U3GA 1RCDA 3E1MA 4TOAA 3O7RA 5J8SA 2VXIA 4W4LB 5GU0X 2ZURX 4TODA 2D5KA 2CLUA 2V2IA 2BKCA 3QB9A 5CMQA 5D8OA 3E1NA 1MOJA 5GU1X 5JKMG 3FRRA 1UMNA 5ERKA 4II4A 3KDQA 1VLGA 2C41A 2MGYA 1S30A 3HL1A 3GGZA 5FFBA 3E1LA 3ERZA 4IWKA 4DZ0A 3AF8X 1YUXA 3PW1A 4AM4A 4M35A 4X0JA 4W4KB 2FFXJ 4YXMA 1ZUJA 4ZL5A 4M32A 1JIGA 2XKQA 4TOCA 4RC6B 1JGCA 1VJXA 3GVYA 4E6KA 3FRSA 1VEIA 1RYTA 4MUDA 3KWOA 2G38B 1J30A 2V2PA 2YJJA 2WWXB 4RC5A 1SOFA 3PVYB 4ZKHA 5AXSA 5J9VA 4PG0A 3WNWA 4RC8A 3VNXA 4EVCA 1VEQA 3R2LA 1DVBA 3R2SA 3PVRA 1JKUA 3GGYA 3PWQC 1FHAA 2AR0A 3FI6A 1BCFA 2CN6A 2GS4A 3IS7A 3OJ5A 3Q4QA 2Z5RA 2C2FA 4CYBA 3ES3A 4WJG4 2HR5A 2Z6MA 3JZ9A 2HTNA 5JKLA 2CLBA 5FFCA 4ITWA 5C6FA 2CF7A 1NF4A 5E2DA 3A9QA 3E6RA 3WVVA 2FG8A 2IU2A 3T9JA 3N6OA 1OTKA 2CIHA 1DATA 3F39A 4MN9A 2BK6A 4CVPA 1XZ1A 3C23A 3GHQA 4KVSA 5GN8A 4AM2A 3SHXA 2ZG7X 3JZAB 1SQ3A 2ZG9X 1Z6OA 3C1YA 4REUA 3PVTA 1BG7A 5GU2X 1RCEA 1LKOA 4ZL6A 4CMYA 3BVIA 4LQJA 1NNQA 2CEIA 3EZUA 2V2JA 5FEJA 4Z5SA 2V8TA 3R2RA 5JACA 4TOBA 5FFEA 1N1QA 3MPSA 2ZA7A 5D8PA 4DYZA 4TOHA 3PW8A 3UOIA 3WVWA 1JI4A 1BFRA 2V15A 3QD8A 3E1QA 1UVHA 4CYAA 1JYBA 1GWGA 2IB0A 2JD80 5JKLG 4DYUA 3AJOA 4LYUA 4LPMA 2V2OA 4ETRA 5JDOA 3RE7A 2WTLA 3F37A 4ZJKA 1L8IA 2OH3A 4CVRA 4RC7A 1RCIA 4ISMA 4DYXA 5J8WA 3M6JA 2C2JA 3E1JA 4ISPA 5HU6D 5D8QA 4XKTA 2XJOA 2WLUA 2ZA6A 4KVQA 4KVRA 1LKMA 2Z5QA 3RD0A 1H96A 4XKSA 3U90A 2IY4A 1AEWA 3BVLA 2VZBA 3F36A 5HQOA 3VV9A 3F32A 4TO9A 2ZG8X 2YW7A 4IWJA 5FFAA 4XKUA 4R42A 4E40A 1Z4AA 5D8XA 3W54A 3UNOA 5I4JA 1S3QA 4EVBA 2W0OA 1IERA 2GYQA 1JI5A 3BKNA 1R03A 4YKHA 1YV1A 3NOZX 3R2MA 1YUZA 2FJCA 3F33A 4ZLWA 3BVKA 3L0MA 4RC6A 3BT5A 4LPNA 1NFVA 4ZMCA 3BVEA 5J93A 3C21A 1EUMA 2OKCA 3AJQA 3PVYA 4PGIA 2G4HA 3NP2X 3R2HA 3V3KB 1HRSA 2CN7A 3R2KA 4YVZA 3GE4A 2YW6A 2V2LA 3KXUA 2ITBA 2XGWA 2XJNA 2V2MA 3H7GA 4MKUA 4P18A 5K52A 3AJPA 3LKDA 2UX1A 1XZ3A 3UFBA 2FZFA 3E2CA 3C1ZA 1QYBA 4CVTA 4TW3A 4II4B 5LBHA 2C6RA 3Q4RA 2FG4A 3QVDA
chains in the Genus database with same CATH topology
3TA8A 3RGDA 1JKVA 3PZAA 1O9IA 4LQNA 3PW1B 1ZS3A 2BJYA 2FKZA 4M34A 4DE6A 5D8SA 4RC7B 2Y44A 5LS9A 1F30A 1L8HA 1LB3A 2GYDA 3AF9X 3E6SA 1RCCA 1RCGA 3SH6A 3E1PA 4TOGA 3PWQA 4AM5A 2Z5PA 4KXRB 3E1OA 3SE1A 2FL0A 2QF9A 3A68A 5LG2A 4EVEA 1Z6OM 3KA3A 3QHBA 2VXXA 2XJMA 4XGSA 3RAVA 3VVAA 5GU3X 1DPSA 4RC5B 3AK9A 5HJHA 2WLAA 3EGMA 5D8RA 5ERJA 4CVSA 4DASA 5D8YA 5CMRA 3PVRB 4M33A 3KX9A 1TKPA 4ZKXA 4MJYA 1B71A 3BVFA 4Z3BA 3O7SA 3DBYA 3FSEA 4PG1A 5HJFA 3D19A 2BW1A 5LG8A 2C2UA 2YJKA 2ZA8A 2V8UA 4IXKA 2OC5A 3KA9A 2JD60 4TOFA 4CMYV 1JREA 4ERUA 3QZ3A 3PW8C 5K53A 3HIUA 1MFRA 1S2ZA 4MY7A 3PWFA 3F35A 4LQHA 4PGKA 5E1UA 3ISFA 1KRQA 1TJOA 4ZTTA 1O9RA 4ITTA 1TK6A 3Q4NA 5GN8B 4LPJA 2V2NA 4CY9A 1VELA 4ZKWA 3F38A 3PVTB 5JKMA 3KA8A 3NP0X 3OGHA 4LQVA 2QQYA 5GOUA 3KHKA 3IS8A 4EVDA 4ML5A 3IQ1A 3WVUA 2CHPA 2Z90A 2CWLA 3F34A 4TOEA 3UOFA 1TKOA 3AK8A 5FFDA 4MXPA 1LKPA 3ISEA 3AF7X 3Q4OA 3EZ0A 2Y3QA 2CHIA 3R2OA 1F33A 2RBDA 2X170 4DYYA 5IX6A 3RBCA 4YXJA 1QGHA 3SIDA 1IESA 3QHCA 5CZUA 2V2SA 2V2RA 2FHAA 1NF6A 5JDOB 2JD70 2F7NA 2N02A 4DI0A 4OYNA 2PYBA 3KA4A 4A25A 3FVBA 4LYXA 4QUWA 3KA6A 4Y08A 1JTSA 4U3GA 1RCDA 3E1MA 4TOAA 3O7RA 5J8SA 2VXIA 4W4LB 5GU0X 2ZURX 4TODA 2D5KA 2CLUA 2V2IA 2BKCA 3QB9A 5CMQA 5D8OA 3E1NA 1MOJA 5GU1X 5JKMG 3FRRA 1UMNA 5ERKA 4II4A 3KDQA 1VLGA 2C41A 2MGYA 1S30A 3HL1A 3GGZA 5FFBA 3E1LA 3ERZA 4IWKA 4DZ0A 3AF8X 1YUXA 3PW1A 4AM4A 4M35A 4X0JA 4W4KB 2FFXJ 4YXMA 1ZUJA 4ZL5A 4M32A 1JIGA 2XKQA 4TOCA 4RC6B 1JGCA 1VJXA 3GVYA 4E6KA 3FRSA 1VEIA 1RYTA 4MUDA 3KWOA 2G38B 1J30A 2V2PA 2YJJA 2WWXB 4RC5A 1SOFA 3PVYB 4ZKHA 5AXSA 5J9VA 4PG0A 3WNWA 4RC8A 3VNXA 4EVCA 1VEQA 3R2LA 1DVBA 3R2SA 3PVRA 1JKUA 3GGYA 3PWQC 1FHAA 2AR0A 3FI6A 1BCFA 2CN6A 2GS4A 3IS7A 3OJ5A 3Q4QA 2Z5RA 2C2FA 4CYBA 3ES3A 4WJG4 2HR5A 2Z6MA 3JZ9A 2HTNA 5JKLA 2CLBA 5FFCA 4ITWA 5C6FA 2CF7A 1NF4A 5E2DA 3A9QA 3E6RA 3WVVA 2FG8A 2IU2A 3T9JA 3N6OA 1OTKA 2CIHA 1DATA 3F39A 4MN9A 2BK6A 4CVPA 1XZ1A 3C23A 3GHQA 4KVSA 5GN8A 4AM2A 3SHXA 2ZG7X 3JZAB 1SQ3A 2ZG9X 1Z6OA 3C1YA 4REUA 3PVTA 1BG7A 5GU2X 1RCEA 1LKOA 4ZL6A 4CMYA 3BVIA 4LQJA 1NNQA 2CEIA 3EZUA 2V2JA 5FEJA 4Z5SA 2V8TA 3R2RA 5JACA 4TOBA 5FFEA 1N1QA 3MPSA 2ZA7A 5D8PA 4DYZA 4TOHA 3PW8A 3UOIA 3WVWA 1JI4A 1BFRA 2V15A 3QD8A 3E1QA 1UVHA 4CYAA 1JYBA 1GWGA 2IB0A 2JD80 5JKLG 4DYUA 3AJOA 4LYUA 4LPMA 2V2OA 4ETRA 5JDOA 3RE7A 2WTLA 3F37A 4ZJKA 1L8IA 2OH3A 4CVRA 4RC7A 1RCIA 4ISMA 4DYXA 5J8WA 3M6JA 2C2JA 3E1JA 4ISPA 5HU6D 5D8QA 4XKTA 2XJOA 2WLUA 2ZA6A 4KVQA 4KVRA 1LKMA 2Z5QA 3RD0A 1H96A 4XKSA 3U90A 2IY4A 1AEWA 3BVLA 2VZBA 3F36A 5HQOA 3VV9A 3F32A 4TO9A 2ZG8X 2YW7A 4IWJA 5FFAA 4XKUA 4R42A 4E40A 1Z4AA 5D8XA 3W54A 3UNOA 5I4JA 1S3QA 4EVBA 2W0OA 1IERA 2GYQA 1JI5A 3BKNA 1R03A 4YKHA 1YV1A 3NOZX 3R2MA 1YUZA 2FJCA 3F33A 4ZLWA 3BVKA 3L0MA 4RC6A 3BT5A 4LPNA 1NFVA 4ZMCA 3BVEA 5J93A 3C21A 1EUMA 2OKCA 3AJQA 3PVYA 4PGIA 2G4HA 3NP2X 3R2HA 3V3KB 1HRSA 2CN7A 3R2KA 4YVZA 3GE4A 2YW6A 2V2LA 3KXUA 2ITBA 2XGWA 2XJNA 2V2MA 3H7GA 4MKUA 4P18A 5K52A 3AJPA 3LKDA 2UX1A 1XZ3A 3UFBA 2FZFA 3E2CA 3C1ZA 1QYBA 4CVTA 4TW3A 4II4B 5LBHA 2C6RA 3Q4RA 2FG4A 3QVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TA8 A;  3RGD A;  1JKV A;  3PZA A;  1O9I A;  4LQN A;  3PW1 B;  1ZS3 A;  2BJY A;  2FKZ A;  4M34 A;  4DE6 A;  5D8S A;  4RC7 B;  5LS9 A;  1F30 A;  1L8H A;  1LB3 A;  2GYD A;  3AF9 X;  3E6S A;  1RCC A;  1RCG A;  3SH6 A;  3E1P A;  4TOG A;  3PWQ A;  4AM5 A;  2Z5P A;  3E1O A;  3SE1 A;  2FL0 A;  2QF9 A;  3A68 A;  5LG2 A;  4EVE A;  1Z6O M;  3KA3 A;  3QHB A;  2VXX A;  2XJM A;  4XGS A;  3RAV A;  5GU3 X;  1DPS A;  4RC5 B;  3AK9 A;  5HJH A;  2WLA A;  3EGM A;  5D8R A;  5ERJ A;  4CVS A;  4DAS A;  5D8Y A;  5CMR A;  3PVR B;  4M33 A;  3KX9 A;  1TKP A;  4ZKX A;  4MJY A;  1B71 A;  3BVF A;  4Z3B A;  3O7S A;  3FSE A;  4PG1 A;  5HJF A;  2BW1 A;  5LG8 A;  2C2U A;  2YJK A;  2ZA8 A;  4IXK A;  2OC5 A;  3KA9 A;  2JD6 0;  4TOF A;  4CMY V;  1JRE A;  4ERU A;  3QZ3 A;  3PW8 C;  5K53 A;  3HIU A;  1MFR A;  1S2Z A;  4MY7 A;  3PWF A;  3F35 A;  4LQH A;  4PGK A;  5E1U A;  3ISF A;  1KRQ A;  1TJO A;  4ZTT A;  1O9R A;  4ITT A;  1TK6 A;  3Q4N A;  5GN8 B;  4LPJ A;  2V2N A;  4CY9 A;  1VEL A;  4ZKW A;  3F38 A;  3PVT B;  5JKM A;  3KA8 A;  3NP0 X;  3OGH A;  4LQV A;  2QQY A;  5GOU A;  3IS8 A;  4EVD A;  4ML5 A;  3IQ1 A;  3WVU A;  2CHP A;  2Z90 A;  3F34 A;  4TOE A;  3UOF A;  1TKO A;  3AK8 A;  5FFD A;  1LKP A;  3ISE A;  3AF7 X;  3Q4O A;  3EZ0 A;  2Y3Q A;  2CHI A;  3R2O A;  1F33 A;  2RBD A;  2X17 0;  4DYY A;  5IX6 A;  3RBC A;  1QGH A;  3SID A;  1IES A;  3QHC A;  5CZU A;  2V2S A;  2V2R A;  2FHA A;  1NF6 A;  2JD7 0;  2F7N A;  4DI0 A;  4OYN A;  2PYB A;  3KA4 A;  4A25 A;  3FVB A;  4LYX A;  4QUW A;  3KA6 A;  4Y08 A;  1JTS A;  4U3G A;  1RCD A;  3E1M A;  4TOA A;  3O7R A;  5J8S A;  2VXI A;  5GU0 X;  2ZUR X;  4TOD A;  2D5K A;  2CLU A;  2V2I A;  2BKC A;  3QB9 A;  5CMQ A;  5D8O A;  3E1N A;  1MOJ A;  5GU1 X;  5JKM G;  1UMN A;  5ERK A;  4II4 A;  1VLG A;  2C41 A;  1S30 A;  3HL1 A;  5FFB A;  3E1L A;  3ERZ A;  4IWK A;  4DZ0 A;  3AF8 X;  1YUX A;  3PW1 A;  4AM4 A;  4M35 A;  2FFX J;  1ZUJ A;  4ZL5 A;  4M32 A;  1JIG A;  2XKQ A;  4TOC A;  4RC6 B;  1JGC A;  1VJX A;  3GVY A;  4E6K A;  1VEI A;  1RYT A;  4MUD A;  3KWO A;  1J30 A;  2V2P A;  2YJJ A;  4RC5 A;  1SOF A;  3PVY B;  4ZKH A;  5AXS A;  5J9V A;  4PG0 A;  3WNW A;  4RC8 A;  3VNX A;  4EVC A;  1VEQ A;  3R2L A;  1DVB A;  3R2S A;  3PVR A;  1JKU A;  3PWQ C;  1FHA A;  3FI6 A;  1BCF A;  2CN6 A;  2GS4 A;  3IS7 A;  3OJ5 A;  3Q4Q A;  2Z5R A;  2C2F A;  4CYB A;  3ES3 A;  2HR5 A;  2Z6M A;  2HTN A;  5JKL A;  2CLB A;  5FFC A;  4ITW A;  5C6F A;  2CF7 A;  1NF4 A;  5E2D A;  3A9Q A;  3E6R A;  3WVV A;  2FG8 A;  2IU2 A;  3T9J A;  1OTK A;  2CIH A;  1DAT A;  3F39 A;  4MN9 A;  2BK6 A;  4CVP A;  1XZ1 A;  3GHQ A;  4KVS A;  5GN8 A;  4AM2 A;  3SHX A;  2ZG7 X;  1SQ3 A;  2ZG9 X;  1Z6O A;  4REU A;  3PVT A;  1BG7 A;  5GU2 X;  1RCE A;  1LKO A;  4ZL6 A;  4CMY A;  3BVI A;  4LQJ A;  1NNQ A;  2CEI A;  3EZU A;  2V2J A;  5FEJ A;  4Z5S A;  3R2R A;  5JAC A;  4TOB A;  5FFE A;  1N1Q A;  3MPS A;  2ZA7 A;  5D8P A;  4DYZ A;  4TOH A;  3PW8 A;  3UOI A;  3WVW A;  1JI4 A;  1BFR A;  2V15 A;  3QD8 A;  3E1Q A;  1UVH A;  4CYA A;  1JYB A;  1GWG A;  2IB0 A;  2JD8 0;  5JKL G;  4DYU A;  3AJO A;  4LYU A;  4LPM A;  2V2O A;  4ETR A;  3RE7 A;  2WTL A;  3F37 A;  4ZJK A;  1L8I A;  2OH3 A;  4CVR A;  4RC7 A;  1RCI A;  4ISM A;  4DYX A;  5J8W A;  2C2J A;  3E1J A;  4ISP A;  5D8Q A;  4XKT A;  2XJO A;  2WLU A;  2ZA6 A;  4KVQ A;  4KVR A;  1LKM A;  2Z5Q A;  3RD0 A;  1H96 A;  4XKS A;  3U90 A;  2IY4 A;  1AEW A;  3BVL A;  2VZB A;  3F36 A;  5HQO A;  3F32 A;  4TO9 A;  2ZG8 X;  2YW7 A;  4IWJ A;  5FFA A;  4XKU A;  4R42 A;  1Z4A A;  5D8X A;  3UNO A;  5I4J A;  1S3Q A;  4EVB A;  2W0O A;  1IER A;  2GYQ A;  1JI5 A;  3BKN A;  1R03 A;  4YKH A;  1YV1 A;  3NOZ X;  3R2M A;  1YUZ A;  2FJC A;  3F33 A;  4ZLW A;  3BVK A;  4RC6 A;  3BT5 A;  4LPN A;  1NFV A;  4ZMC A;  3BVE A;  5J93 A;  1EUM A;  3AJQ A;  3PVY A;  4PGI A;  2G4H A;  3NP2 X;  3R2H A;  1HRS A;  2CN7 A;  3R2K A;  3GE4 A;  2YW6 A;  2V2L A;  3KXU A;  2ITB A;  2XGW A;  2XJN A;  2V2M A;  3H7G A;  4MKU A;  4P18 A;  5K52 A;  3AJP A;  2UX1 A;  1XZ3 A;  2FZF A;  3E2C A;  1QYB A;  4CVT A;  4TW3 A;  4II4 B;  5LBH A;  2C6R A;  3Q4R A;  2FG4 A;  3QVD A; 
#chains in the Genus database with same CATH topology
 3TA8 A;  3RGD A;  1JKV A;  3PZA A;  1O9I A;  4LQN A;  3PW1 B;  1ZS3 A;  2BJY A;  2FKZ A;  4M34 A;  4DE6 A;  5D8S A;  4RC7 B;  2Y44 A;  5LS9 A;  1F30 A;  1L8H A;  1LB3 A;  2GYD A;  3AF9 X;  3E6S A;  1RCC A;  1RCG A;  3SH6 A;  3E1P A;  4TOG A;  3PWQ A;  4AM5 A;  2Z5P A;  4KXR B;  3E1O A;  3SE1 A;  2FL0 A;  2QF9 A;  3A68 A;  5LG2 A;  4EVE A;  1Z6O M;  3KA3 A;  3QHB A;  2VXX A;  2XJM A;  4XGS A;  3RAV A;  3VVA A;  5GU3 X;  1DPS A;  4RC5 B;  3AK9 A;  5HJH A;  2WLA A;  3EGM A;  5D8R A;  5ERJ A;  4CVS A;  4DAS A;  5D8Y A;  5CMR A;  3PVR B;  4M33 A;  3KX9 A;  1TKP A;  4ZKX A;  4MJY A;  1B71 A;  3BVF A;  4Z3B A;  3O7S A;  3DBY A;  3FSE A;  4PG1 A;  5HJF A;  3D19 A;  2BW1 A;  5LG8 A;  2C2U A;  2YJK A;  2ZA8 A;  2V8U A;  4IXK A;  2OC5 A;  3KA9 A;  2JD6 0;  4TOF A;  4CMY V;  1JRE A;  4ERU A;  3QZ3 A;  3PW8 C;  5K53 A;  3HIU A;  1MFR A;  1S2Z A;  4MY7 A;  3PWF A;  3F35 A;  4LQH A;  4PGK A;  5E1U A;  3ISF A;  1KRQ A;  1TJO A;  4ZTT A;  1O9R A;  4ITT A;  1TK6 A;  3Q4N A;  5GN8 B;  4LPJ A;  2V2N A;  4CY9 A;  1VEL A;  4ZKW A;  3F38 A;  3PVT B;  5JKM A;  3KA8 A;  3NP0 X;  3OGH A;  4LQV A;  2QQY A;  5GOU A;  3KHK A;  3IS8 A;  4EVD A;  4ML5 A;  3IQ1 A;  3WVU A;  2CHP A;  2Z90 A;  2CWL A;  3F34 A;  4TOE A;  3UOF A;  1TKO A;  3AK8 A;  5FFD A;  4MXP A;  1LKP A;  3ISE A;  3AF7 X;  3Q4O A;  3EZ0 A;  2Y3Q A;  2CHI A;  3R2O A;  1F33 A;  2RBD A;  2X17 0;  4DYY A;  5IX6 A;  3RBC A;  4YXJ A;  1QGH A;  3SID A;  1IES A;  3QHC A;  5CZU A;  2V2S A;  2V2R A;  2FHA A;  1NF6 A;  5JDO B;  2JD7 0;  2F7N A;  2N02 A;  4DI0 A;  4OYN A;  2PYB A;  3KA4 A;  4A25 A;  3FVB A;  4LYX A;  4QUW A;  3KA6 A;  4Y08 A;  1JTS A;  4U3G A;  1RCD A;  3E1M A;  4TOA A;  3O7R A;  5J8S A;  2VXI A;  4W4L B;  5GU0 X;  2ZUR X;  4TOD A;  2D5K A;  2CLU A;  2V2I A;  2BKC A;  3QB9 A;  5CMQ A;  5D8O A;  3E1N A;  1MOJ A;  5GU1 X;  5JKM G;  3FRR A;  1UMN A;  5ERK A;  4II4 A;  3KDQ A;  1VLG A;  2C41 A;  2MGY A;  1S30 A;  3HL1 A;  3GGZ A;  5FFB A;  3E1L A;  3ERZ A;  4IWK A;  4DZ0 A;  3AF8 X;  1YUX A;  3PW1 A;  4AM4 A;  4M35 A;  4X0J A;  4W4K B;  2FFX J;  4YXM A;  1ZUJ A;  4ZL5 A;  4M32 A;  1JIG A;  2XKQ A;  4TOC A;  4RC6 B;  1JGC A;  1VJX A;  3GVY A;  4E6K A;  3FRS A;  1VEI A;  1RYT A;  4MUD A;  3KWO A;  2G38 B;  1J30 A;  2V2P A;  2YJJ A;  2WWX B;  4RC5 A;  1SOF A;  3PVY B;  4ZKH A;  5AXS A;  5J9V A;  4PG0 A;  3WNW A;  4RC8 A;  3VNX A;  4EVC A;  1VEQ A;  3R2L A;  1DVB A;  3R2S A;  3PVR A;  1JKU A;  3GGY A;  3PWQ C;  1FHA A;  2AR0 A;  3FI6 A;  1BCF A;  2CN6 A;  2GS4 A;  3IS7 A;  3OJ5 A;  3Q4Q A;  2Z5R A;  2C2F A;  4CYB A;  3ES3 A;  4WJG 4;  2HR5 A;  2Z6M A;  3JZ9 A;  2HTN A;  5JKL A;  2CLB A;  5FFC A;  4ITW A;  5C6F A;  2CF7 A;  1NF4 A;  5E2D A;  3A9Q A;  3E6R A;  3WVV A;  2FG8 A;  2IU2 A;  3T9J A;  3N6O A;  1OTK A;  2CIH A;  1DAT A;  3F39 A;  4MN9 A;  2BK6 A;  4CVP A;  1XZ1 A;  3C23 A;  3GHQ A;  4KVS A;  5GN8 A;  4AM2 A;  3SHX A;  2ZG7 X;  3JZA B;  1SQ3 A;  2ZG9 X;  1Z6O A;  3C1Y A;  4REU A;  3PVT A;  1BG7 A;  5GU2 X;  1RCE A;  1LKO A;  4ZL6 A;  4CMY A;  3BVI A;  4LQJ A;  1NNQ A;  2CEI A;  3EZU A;  2V2J A;  5FEJ A;  4Z5S A;  2V8T A;  3R2R A;  5JAC A;  4TOB A;  5FFE A;  1N1Q A;  3MPS A;  2ZA7 A;  5D8P A;  4DYZ A;  4TOH A;  3PW8 A;  3UOI A;  3WVW A;  1JI4 A;  1BFR A;  2V15 A;  3QD8 A;  3E1Q A;  1UVH A;  4CYA A;  1JYB A;  1GWG A;  2IB0 A;  2JD8 0;  5JKL G;  4DYU A;  3AJO A;  4LYU A;  4LPM A;  2V2O A;  4ETR A;  5JDO A;  3RE7 A;  2WTL A;  3F37 A;  4ZJK A;  1L8I A;  2OH3 A;  4CVR A;  4RC7 A;  1RCI A;  4ISM A;  4DYX A;  5J8W A;  3M6J A;  2C2J A;  3E1J A;  4ISP A;  5HU6 D;  5D8Q A;  4XKT A;  2XJO A;  2WLU A;  2ZA6 A;  4KVQ A;  4KVR A;  1LKM A;  2Z5Q A;  3RD0 A;  1H96 A;  4XKS A;  3U90 A;  2IY4 A;  1AEW A;  3BVL A;  2VZB A;  3F36 A;  5HQO A;  3VV9 A;  3F32 A;  4TO9 A;  2ZG8 X;  2YW7 A;  4IWJ A;  5FFA A;  4XKU A;  4R42 A;  4E40 A;  1Z4A A;  5D8X A;  3W54 A;  3UNO A;  5I4J A;  1S3Q A;  4EVB A;  2W0O A;  1IER A;  2GYQ A;  1JI5 A;  3BKN A;  1R03 A;  4YKH A;  1YV1 A;  3NOZ X;  3R2M A;  1YUZ A;  2FJC A;  3F33 A;  4ZLW A;  3BVK A;  3L0M A;  4RC6 A;  3BT5 A;  4LPN A;  1NFV A;  4ZMC A;  3BVE A;  5J93 A;  3C21 A;  1EUM A;  2OKC A;  3AJQ A;  3PVY A;  4PGI A;  2G4H A;  3NP2 X;  3R2H A;  3V3K B;  1HRS A;  2CN7 A;  3R2K A;  4YVZ A;  3GE4 A;  2YW6 A;  2V2L A;  3KXU A;  2ITB A;  2XGW A;  2XJN A;  2V2M A;  3H7G A;  4MKU A;  4P18 A;  5K52 A;  3AJP A;  3LKD A;  2UX1 A;  1XZ3 A;  3UFB A;  2FZF A;  3E2C A;  3C1Z A;  1QYB A;  4CVT A;  4TW3 A;  4II4 B;  5LBH A;  2C6R A;  3Q4R A;  2FG4 A;  3QVD A; 
#chains in the Genus database with same CATH homology
 3TA8 A;  3RGD A;  1JKV A;  3PZA A;  1O9I A;  4LQN A;  3PW1 B;  1ZS3 A;  2BJY A;  2FKZ A;  4M34 A;  4DE6 A;  5D8S A;  4RC7 B;  2Y44 A;  5LS9 A;  1F30 A;  1L8H A;  1LB3 A;  2GYD A;  3AF9 X;  3E6S A;  1RCC A;  1RCG A;  3SH6 A;  3E1P A;  4TOG A;  3PWQ A;  4AM5 A;  2Z5P A;  4KXR B;  3E1O A;  3SE1 A;  2FL0 A;  2QF9 A;  3A68 A;  5LG2 A;  4EVE A;  1Z6O M;  3KA3 A;  3QHB A;  2VXX A;  2XJM A;  4XGS A;  3RAV A;  3VVA A;  5GU3 X;  1DPS A;  4RC5 B;  3AK9 A;  5HJH A;  2WLA A;  3EGM A;  5D8R A;  5ERJ A;  4CVS A;  4DAS A;  5D8Y A;  5CMR A;  3PVR B;  4M33 A;  3KX9 A;  1TKP A;  4ZKX A;  4MJY A;  1B71 A;  3BVF A;  4Z3B A;  3O7S A;  3DBY A;  3FSE A;  4PG1 A;  5HJF A;  3D19 A;  2BW1 A;  5LG8 A;  2C2U A;  2YJK A;  2ZA8 A;  2V8U A;  4IXK A;  2OC5 A;  3KA9 A;  2JD6 0;  4TOF A;  4CMY V;  1JRE A;  4ERU A;  3QZ3 A;  3PW8 C;  5K53 A;  3HIU A;  1MFR A;  1S2Z A;  4MY7 A;  3PWF A;  3F35 A;  4LQH A;  4PGK A;  5E1U A;  3ISF A;  1KRQ A;  1TJO A;  4ZTT A;  1O9R A;  4ITT A;  1TK6 A;  3Q4N A;  5GN8 B;  4LPJ A;  2V2N A;  4CY9 A;  1VEL A;  4ZKW A;  3F38 A;  3PVT B;  5JKM A;  3KA8 A;  3NP0 X;  3OGH A;  4LQV A;  2QQY A;  5GOU A;  3KHK A;  3IS8 A;  4EVD A;  4ML5 A;  3IQ1 A;  3WVU A;  2CHP A;  2Z90 A;  2CWL A;  3F34 A;  4TOE A;  3UOF A;  1TKO A;  3AK8 A;  5FFD A;  4MXP A;  1LKP A;  3ISE A;  3AF7 X;  3Q4O A;  3EZ0 A;  2Y3Q A;  2CHI A;  3R2O A;  1F33 A;  2RBD A;  2X17 0;  4DYY A;  5IX6 A;  3RBC A;  4YXJ A;  1QGH A;  3SID A;  1IES A;  3QHC A;  5CZU A;  2V2S A;  2V2R A;  2FHA A;  1NF6 A;  5JDO B;  2JD7 0;  2F7N A;  2N02 A;  4DI0 A;  4OYN A;  2PYB A;  3KA4 A;  4A25 A;  3FVB A;  4LYX A;  4QUW A;  3KA6 A;  4Y08 A;  1JTS A;  4U3G A;  1RCD A;  3E1M A;  4TOA A;  3O7R A;  5J8S A;  2VXI A;  4W4L B;  5GU0 X;  2ZUR X;  4TOD A;  2D5K A;  2CLU A;  2V2I A;  2BKC A;  3QB9 A;  5CMQ A;  5D8O A;  3E1N A;  1MOJ A;  5GU1 X;  5JKM G;  3FRR A;  1UMN A;  5ERK A;  4II4 A;  3KDQ A;  1VLG A;  2C41 A;  2MGY A;  1S30 A;  3HL1 A;  3GGZ A;  5FFB A;  3E1L A;  3ERZ A;  4IWK A;  4DZ0 A;  3AF8 X;  1YUX A;  3PW1 A;  4AM4 A;  4M35 A;  4X0J A;  4W4K B;  2FFX J;  4YXM A;  1ZUJ A;  4ZL5 A;  4M32 A;  1JIG A;  2XKQ A;  4TOC A;  4RC6 B;  1JGC A;  1VJX A;  3GVY A;  4E6K A;  3FRS A;  1VEI A;  1RYT A;  4MUD A;  3KWO A;  2G38 B;  1J30 A;  2V2P A;  2YJJ A;  2WWX B;  4RC5 A;  1SOF A;  3PVY B;  4ZKH A;  5AXS A;  5J9V A;  4PG0 A;  3WNW A;  4RC8 A;  3VNX A;  4EVC A;  1VEQ A;  3R2L A;  1DVB A;  3R2S A;  3PVR A;  1JKU A;  3GGY A;  3PWQ C;  1FHA A;  2AR0 A;  3FI6 A;  1BCF A;  2CN6 A;  2GS4 A;  3IS7 A;  3OJ5 A;  3Q4Q A;  2Z5R A;  2C2F A;  4CYB A;  3ES3 A;  4WJG 4;  2HR5 A;  2Z6M A;  3JZ9 A;  2HTN A;  5JKL A;  2CLB A;  5FFC A;  4ITW A;  5C6F A;  2CF7 A;  1NF4 A;  5E2D A;  3A9Q A;  3E6R A;  3WVV A;  2FG8 A;  2IU2 A;  3T9J A;  3N6O A;  1OTK A;  2CIH A;  1DAT A;  3F39 A;  4MN9 A;  2BK6 A;  4CVP A;  1XZ1 A;  3C23 A;  3GHQ A;  4KVS A;  5GN8 A;  4AM2 A;  3SHX A;  2ZG7 X;  3JZA B;  1SQ3 A;  2ZG9 X;  1Z6O A;  3C1Y A;  4REU A;  3PVT A;  1BG7 A;  5GU2 X;  1RCE A;  1LKO A;  4ZL6 A;  4CMY A;  3BVI A;  4LQJ A;  1NNQ A;  2CEI A;  3EZU A;  2V2J A;  5FEJ A;  4Z5S A;  2V8T A;  3R2R A;  5JAC A;  4TOB A;  5FFE A;  1N1Q A;  3MPS A;  2ZA7 A;  5D8P A;  4DYZ A;  4TOH A;  3PW8 A;  3UOI A;  3WVW A;  1JI4 A;  1BFR A;  2V15 A;  3QD8 A;  3E1Q A;  1UVH A;  4CYA A;  1JYB A;  1GWG A;  2IB0 A;  2JD8 0;  5JKL G;  4DYU A;  3AJO A;  4LYU A;  4LPM A;  2V2O A;  4ETR A;  5JDO A;  3RE7 A;  2WTL A;  3F37 A;  4ZJK A;  1L8I A;  2OH3 A;  4CVR A;  4RC7 A;  1RCI A;  4ISM A;  4DYX A;  5J8W A;  3M6J A;  2C2J A;  3E1J A;  4ISP A;  5HU6 D;  5D8Q A;  4XKT A;  2XJO A;  2WLU A;  2ZA6 A;  4KVQ A;  4KVR A;  1LKM A;  2Z5Q A;  3RD0 A;  1H96 A;  4XKS A;  3U90 A;  2IY4 A;  1AEW A;  3BVL A;  2VZB A;  3F36 A;  5HQO A;  3VV9 A;  3F32 A;  4TO9 A;  2ZG8 X;  2YW7 A;  4IWJ A;  5FFA A;  4XKU A;  4R42 A;  4E40 A;  1Z4A A;  5D8X A;  3W54 A;  3UNO A;  5I4J A;  1S3Q A;  4EVB A;  2W0O A;  1IER A;  2GYQ A;  1JI5 A;  3BKN A;  1R03 A;  4YKH A;  1YV1 A;  3NOZ X;  3R2M A;  1YUZ A;  2FJC A;  3F33 A;  4ZLW A;  3BVK A;  3L0M A;  4RC6 A;  3BT5 A;  4LPN A;  1NFV A;  4ZMC A;  3BVE A;  5J93 A;  3C21 A;  1EUM A;  2OKC A;  3AJQ A;  3PVY A;  4PGI A;  2G4H A;  3NP2 X;  3R2H A;  3V3K B;  1HRS A;  2CN7 A;  3R2K A;  4YVZ A;  3GE4 A;  2YW6 A;  2V2L A;  3KXU A;  2ITB A;  2XGW A;  2XJN A;  2V2M A;  3H7G A;  4MKU A;  4P18 A;  5K52 A;  3AJP A;  3LKD A;  2UX1 A;  1XZ3 A;  3UFB A;  2FZF A;  3E2C A;  3C1Z A;  1QYB A;  4CVT A;  4TW3 A;  4II4 B;  5LBH A;  2C6R A;  3Q4R A;  2FG4 A;  3QVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...