4CMYA

Chlorobium tepidum ferritin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
163
structure length
163
Chain Sequence
MLSKTILDKLNHQVNFEAASAHLYLQMSAWLLTQSLDSTAAFFRAHAEEEKAHMMKLFDYINETGSLALIGEVATPAPEWKSHIELLEAAYNHELAITQSINDLVDTALREKDYSTFQFLQWYVAEQHEEEYLFSSMLHKARIINTMDGRALFRFDEEVRKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERRITIN
publication title The Crystal Structure of Ferritin from Chlorobium Tepidum Reveals a New Conformation of the 4-Fold Channel for This Protein Family.
pubmed doi rcsb
source organism Chlorobaculum tepidum
total genus 76
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, W, X
ec nomenclature
pdb deposition date 2014-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4cmyA00
5D8XA 3E6SA 4ETRA 4DYUA 1BG7A 3SHXA 4PG0A 3H7GA 5GU0X 1OTKA 2YJKA 4AM5A 1LKOA 4MY7A 5JKMA 4KVQA 2Z6MA 3F35A 3KA3A 2CLBA 1SOFA 3WVUA 2V2JA 4M33A 5JKLA 4XKSA 2HR5A 3QHCA 4ZKWA 4MKUA 5ERJA 2C41A 4Z5SA 3ISEA 3E1PA 2V2PA 3AK8A 2YJJA 4AM2A 4II4A 3PW8A 3F37A 3E1LA 1YUZA 4RC7B 1JI5A 3QVDA 2XJNA 4DE6A 2QQYA 3QD8A 3E1MA 1EUMA 1DVBA 4REUA 3AJQA 3IS8A 1R03A 2FZFA 2XJOA 1VJXA 5D8QA 3F33A 3BKNA 1NF4A 4ERUA 1IESA 2PYBA 4XKTA 3FVBA 5LG2A 1RCGA 3HIUA 3UNOA 1YV1A 3SIDA 4EVDA 2IB0A 5GN8A 3UOIA 5D8SA 1XZ1A 1SQ3A 2CF7A 4TOCA 2RBDA 4LYUA 1DPSA 1VEQA 3OJ5A 4TOBA 4AM4A 4OYNA 2V2OA 2GYQA 3E1QA 3AJPA 1F30A 2Z5QA 4MUDA 4CYBA 3WNWA 2V2IA 3F39A 3ISFA 2Y3QA 4M32A 2BK6A 5FFCA 1L8HA 2XKQA 4CY9A 2OH3A 1ZS3A 3GVYA 4ISPA 2ZURX 3EZUA 3PW1B 3KA9A 4LPJA 1UMNA 4DASA 5FFAA 1YUXA 4XKUA 1NF6A 5IX6A 1VLGA 5AXSA 4ZMCA 3KXUA 3PVRB 1BCFA 5GU2X 3KX9A 2JD80 3MPSA 4ZKHA 3E1OA 4EVBA 4MN9A 3R2HA 4TW3A 1H96A 3HL1A 5FFBA 4A25A 3SE1A 4P18A 1RCEA 2YW7A 4ISMA 4KVSA 2CIHA 2ITBA 3R2SA 4TOGA 3O7RA 1RCIA 4IWJA 4U3GA 2D5KA 4TOFA 2ZA7A 4PG1A 3KA6A 1FHAA 3TA8A 1S3QA 3AK9A 5JACA 5D8RA 3GE4A 1L8IA 4ZL6A 1JI4A 3BVKA 3BVEA 2BW1A 3F38A 3UOFA 3BVIA 5D8YA 3BVFA 3F36A 4Z3BA 2OC5A 2XGWA 4LYXA 2GYDA 2ZA8A 2ZG7X 2FKZA 4LPNA 3E6RA 2X170 1NNQA 5GOUA 4CVTA 4YKHA 3R2LA 3QHBA 3AF7X 1B71A 3PW1A 4TOEA 3A9QA 2BKCA 3ERZA 5E2DA 3Q4QA 2QF9A 2C6RA 5E1UA 1HRSA 4EVCA 2FG8A 1AEWA 2FG4A 3PVRA 3BT5A 5HJFA 2V2RA 2ZA6A 3NP0X 5FEJA 1BFRA 1S2ZA 1JKVA 2C2FA 4ITTA 3A68A 3PZAA 5FFEA 1RYTA 4R42A 1TK6A 2CN6A 2CHPA 4LPMA 3QB9A 4ZLWA 5J93A 1JKUA 3PWQC 4MJYA 2WLAA 3AJOA 2JD70 1IERA 2V2NA 4CYAA 4XGSA 1JREA 4CVRA 3E1NA 2CEIA 2JD60 4LQHA 1QYBA 4LQJA 3PVYB 2XJMA 5GU3X 2Z90A 3NOZX 4ITWA 4EVEA 1O9RA 1Z6OA 3SH6A 4CMYV 3R2RA 3AF8X 4KVRA 1TKOA 4RC7A 3WVWA 2FL0A 2G4HA 4TODA 2WLUA 4RC6B 3RD0A 5FFDA 1JIGA 3ES3A 2BJYA 2VZBA 2ZG8X 5CMQA 1F33A 3EZ0A 3PVTB 5HJHA 1KRQA 2CLUA 2FHAA 3Q4OA 5D8OA 2IY4A 1VELA 3VNXA 1MFRA 2VXXA 3OGHA 3PWFA 1Z6OM 1ZUJA 1S30A 5JKMG 1GWGA 1TKPA 1JYBA 4RC5B 3EGMA 1JGCA 3U90A 5JKLG 2V2SA 3NP2X 4TO9A 5CMRA 4PGIA 3E2CA 5C6FA 3Q4RA 2GS4A 3GHQA 3T9JA 1LKMA 3QZ3A 4M35A 2FJCA 4ML5A 3F32A 3O7SA 3KWOA 1O9IA 4CVPA 4DYYA 4IWKA 3IQ1A 4QUWA 2Z5PA 3IS7A 5K52A 3PWQA 2V15A 2C2JA 2YW6A 5ERKA 4CVSA 3PVYA 1LKPA 1Z4AA 1RCDA 5I4JA 2CN7A 5J9VA 4RC8A 2CHIA 5J8SA 4DZ0A 1VEIA 3F34A 5D8PA 4IXKA 1QGHA 4ZKXA 1XZ3A 3R2OA 4Y08A 4ZL5A 2HTNA 4RC6A 3R2MA 3FSEA 3PW8C 2W0OA 4DYXA 3RGDA 1UVHA 4TOAA 4ZJKA 5LS9A 1RCCA 3PVTA 4CMYA 4LQNA 3KA8A 2ZG9X 4II4B 5HQOA 3R2KA 5GU1X 5LBHA 1J30A 2WTLA 2C2UA 4TOHA 1DATA 4E6KA 2FFXJ 3KA4A 5CZUA 4LQVA 2V2MA 2Z5RA 1TJOA 4PGKA 2V2LA 4DI0A 3RE7A 3AF9X 3E1JA 5J8WA 1JTSA 1NFVA 4RC5A 3FI6A 4M34A 5LG8A 3Q4NA 3WVVA 5K53A 2IU2A 2UX1A 1MOJA 3BVLA 1N1QA 3RAVA 4ZTTA 5GN8B 2F7NA 3RBCA 1LB3A 2VXIA 4DYZA
chains in the Genus database with same CATH superfamily
5D8XA 3E6SA 4ETRA 4DYUA 2MGYA 1BG7A 3SHXA 4PG0A 3H7GA 5GU0X 1OTKA 2YJKA 4AM5A 1LKOA 3KHKA 4MY7A 5JKMA 4KVQA 2Z6MA 3F35A 3KA3A 2CLBA 1SOFA 3WVUA 2WWXB 2V2JA 4M33A 5JKLA 4XKSA 2HR5A 3QHCA 4ZKWA 4MKUA 5ERJA 2C41A 3M6JA 4Z5SA 3ISEA 3E1PA 2V2PA 3AK8A 2YJJA 4AM2A 4II4A 3PW8A 3F37A 3E1LA 1YUZA 4RC7B 1JI5A 3QVDA 2XJNA 4DE6A 2QQYA 3FRRA 3QD8A 3E1MA 1EUMA 1DVBA 4REUA 3AJQA 3C23A 3IS8A 1R03A 2FZFA 2XJOA 1VJXA 5D8QA 4KXRB 3F33A 3BKNA 1NF4A 4ERUA 1IESA 2PYBA 3C1ZA 4XKTA 4YVZA 3FVBA 3LKDA 5LG2A 1RCGA 3HIUA 3UNOA 1YV1A 3SIDA 4EVDA 3JZ9A 2IB0A 3DBYA 5GN8A 3UOIA 5D8SA 1XZ1A 1SQ3A 2CF7A 4TOCA 2RBDA 4LYUA 1DPSA 1VEQA 3OJ5A 4TOBA 4AM4A 4OYNA 2V2OA 3VV9A 2GYQA 3E1QA 3AJPA 1F30A 2Z5QA 3FRSA 4MUDA 4CYBA 3WNWA 2V2IA 3F39A 4W4KB 3ISFA 2Y3QA 4M32A 4WJG4 2BK6A 5FFCA 1L8HA 2AR0A 2XKQA 4CY9A 2OH3A 1ZS3A 3GVYA 4ISPA 2ZURX 3EZUA 3PW1B 3KA9A 4LPJA 1UMNA 4DASA 5FFAA 1YUXA 3C1YA 4X0JA 4XKUA 1NF6A 5IX6A 1VLGA 5AXSA 4ZMCA 3KXUA 3PVRB 1BCFA 5GU2X 3KX9A 2JD80 3MPSA 4ZKHA 3E1OA 4EVBA 4MN9A 3R2HA 4TW3A 1H96A 3HL1A 3VVAA 3L0MA 5FFBA 4A25A 3SE1A 4P18A 1RCEA 2YW7A 4ISMA 4KVSA 2CIHA 2ITBA 3R2SA 4TOGA 3O7RA 1RCIA 4IWJA 4U3GA 2D5KA 4TOFA 2ZA7A 4PG1A 3KA6A 1FHAA 3TA8A 1S3QA 3AK9A 5JACA 5D8RA 3GE4A 1L8IA 4ZL6A 1JI4A 3BVKA 3BVEA 2BW1A 3F38A 3UOFA 3BVIA 5D8YA 3BVFA 3F36A 4Z3BA 3N6OA 2OC5A 2XGWA 4LYXA 2GYDA 2ZA8A 2ZG7X 2FKZA 3GGZA 2Y44A 4LPNA 3E6RA 2X170 1NNQA 5GOUA 4CVTA 4YKHA 3R2LA 3QHBA 3AF7X 1B71A 3PW1A 4TOEA 3A9QA 2BKCA 3ERZA 5E2DA 3Q4QA 2QF9A 2C6RA 5E1UA 3V3KB 1HRSA 4EVCA 2FG8A 1AEWA 2FG4A 3PVRA 3BT5A 5HJFA 4YXMA 2V2RA 2ZA6A 3NP0X 5FEJA 1BFRA 1S2ZA 1JKVA 2C2FA 4ITTA 3A68A 3PZAA 5FFEA 1RYTA 4R42A 5JDOB 1TK6A 2G38B 2CN6A 2CHPA 4LPMA 3QB9A 4ZLWA 5J93A 1JKUA 3PWQC 4MJYA 2WLAA 3AJOA 2JD70 1IERA 2V2NA 4CYAA 4XGSA 1JREA 3GGYA 4CVRA 3E1NA 2CEIA 2JD60 4LQHA 1QYBA 2N02A 4LQJA 3PVYB 2XJMA 5GU3X 2Z90A 3NOZX 4ITWA 4EVEA 1O9RA 1Z6OA 3SH6A 4CMYV 3R2RA 3AF8X 4KVRA 1TKOA 4RC7A 3WVWA 2FL0A 2G4HA 4TODA 2WLUA 4RC6B 3RD0A 5FFDA 3W54A 1JIGA 3ES3A 2BJYA 5HU6D 2VZBA 2ZG8X 5CMQA 1F33A 3EZ0A 3PVTB 2OKCA 5HJHA 1KRQA 2CLUA 2FHAA 3Q4OA 5D8OA 2IY4A 1VELA 3VNXA 1MFRA 2VXXA 3OGHA 3PWFA 1Z6OM 1ZUJA 4W4LB 1S30A 5JKMG 3C21A 1GWGA 1TKPA 1JYBA 4RC5B 3EGMA 1JGCA 3U90A 5JKLG 2V2SA 3NP2X 4TO9A 5CMRA 2V8UA 4PGIA 3E2CA 5C6FA 3Q4RA 4YXJA 2GS4A 3GHQA 3T9JA 1LKMA 5JDOA 3QZ3A 4M35A 2FJCA 4ML5A 3F32A 3O7SA 3KWOA 1O9IA 4CVPA 4DYYA 4IWKA 3IQ1A 4QUWA 2Z5PA 3IS7A 5K52A 3PWQA 2V15A 2C2JA 2YW6A 5ERKA 4CVSA 3UFBA 3PVYA 1LKPA 1Z4AA 1RCDA 5I4JA 2CN7A 5J9VA 4RC8A 2CHIA 5J8SA 4DZ0A 1VEIA 3F34A 5D8PA 4IXKA 1QGHA 4ZKXA 1XZ3A 2CWLA 3R2OA 4Y08A 4ZL5A 2HTNA 4E40A 4RC6A 3R2MA 3FSEA 3PW8C 2W0OA 4DYXA 3RGDA 1UVHA 4TOAA 4ZJKA 3JZAB 5LS9A 1RCCA 3PVTA 4CMYA 4LQNA 3KA8A 2ZG9X 4II4B 5HQOA 3R2KA 5GU1X 5LBHA 1J30A 2WTLA 2C2UA 3KDQA 4TOHA 1DATA 4E6KA 2FFXJ 3KA4A 5CZUA 4LQVA 2V2MA 2Z5RA 1TJOA 4PGKA 2V2LA 4DI0A 3RE7A 3AF9X 3E1JA 5J8WA 1JTSA 1NFVA 2V8TA 4RC5A 3FI6A 4MXPA 4M34A 5LG8A 3Q4NA 3WVVA 5K53A 2IU2A 2UX1A 1MOJA 3BVLA 1N1QA 3RAVA 4ZTTA 5GN8B 2F7NA 3D19A 3RBCA 1LB3A 2VXIA 4DYZA
chains in the Genus database with same CATH topology
5D8XA 3E6SA 4ETRA 4DYUA 2MGYA 1BG7A 3SHXA 4PG0A 3H7GA 5GU0X 1OTKA 2YJKA 4AM5A 1LKOA 3KHKA 4MY7A 5JKMA 4KVQA 2Z6MA 3F35A 3KA3A 2CLBA 1SOFA 3WVUA 2WWXB 2V2JA 4M33A 5JKLA 4XKSA 2HR5A 3QHCA 4ZKWA 4MKUA 5ERJA 2C41A 3M6JA 4Z5SA 3ISEA 3E1PA 2V2PA 3AK8A 2YJJA 4AM2A 4II4A 3PW8A 3F37A 3E1LA 1YUZA 4RC7B 1JI5A 3QVDA 2XJNA 4DE6A 2QQYA 3FRRA 3QD8A 3E1MA 1EUMA 1DVBA 4REUA 3AJQA 3C23A 3IS8A 1R03A 2FZFA 2XJOA 1VJXA 5D8QA 4KXRB 3F33A 3BKNA 1NF4A 4ERUA 1IESA 2PYBA 3C1ZA 4XKTA 4YVZA 3FVBA 3LKDA 5LG2A 1RCGA 3HIUA 3UNOA 1YV1A 3SIDA 4EVDA 3JZ9A 2IB0A 3DBYA 5GN8A 3UOIA 5D8SA 1XZ1A 1SQ3A 2CF7A 4TOCA 2RBDA 4LYUA 1DPSA 1VEQA 3OJ5A 4TOBA 4AM4A 4OYNA 2V2OA 3VV9A 2GYQA 3E1QA 3AJPA 1F30A 2Z5QA 3FRSA 4MUDA 4CYBA 3WNWA 2V2IA 3F39A 4W4KB 3ISFA 2Y3QA 4M32A 4WJG4 2BK6A 5FFCA 1L8HA 2AR0A 2XKQA 4CY9A 2OH3A 1ZS3A 3GVYA 4ISPA 2ZURX 3EZUA 3PW1B 3KA9A 4LPJA 1UMNA 4DASA 5FFAA 1YUXA 3C1YA 4X0JA 4XKUA 1NF6A 5IX6A 1VLGA 5AXSA 4ZMCA 3KXUA 3PVRB 1BCFA 5GU2X 3KX9A 2JD80 3MPSA 4ZKHA 3E1OA 4EVBA 4MN9A 3R2HA 4TW3A 1H96A 3HL1A 3VVAA 3L0MA 5FFBA 4A25A 3SE1A 4P18A 1RCEA 2YW7A 4ISMA 4KVSA 2CIHA 2ITBA 3R2SA 4TOGA 3O7RA 1RCIA 4IWJA 4U3GA 2D5KA 4TOFA 2ZA7A 4PG1A 3KA6A 1FHAA 3TA8A 1S3QA 3AK9A 5JACA 5D8RA 3GE4A 1L8IA 4ZL6A 1JI4A 3BVKA 3BVEA 2BW1A 3F38A 3UOFA 3BVIA 5D8YA 3BVFA 3F36A 4Z3BA 3N6OA 2OC5A 2XGWA 4LYXA 2GYDA 2ZA8A 2ZG7X 2FKZA 3GGZA 2Y44A 4LPNA 3E6RA 2X170 1NNQA 5GOUA 4CVTA 4YKHA 3R2LA 3QHBA 3AF7X 1B71A 3PW1A 4TOEA 3A9QA 2BKCA 3ERZA 5E2DA 3Q4QA 2QF9A 2C6RA 5E1UA 3V3KB 1HRSA 4EVCA 2FG8A 1AEWA 2FG4A 3PVRA 3BT5A 5HJFA 4YXMA 2V2RA 2ZA6A 3NP0X 5FEJA 1BFRA 1S2ZA 1JKVA 2C2FA 4ITTA 3A68A 3PZAA 5FFEA 1RYTA 4R42A 5JDOB 1TK6A 2G38B 2CN6A 2CHPA 4LPMA 3QB9A 4ZLWA 5J93A 1JKUA 3PWQC 4MJYA 2WLAA 3AJOA 2JD70 1IERA 2V2NA 4CYAA 4XGSA 1JREA 3GGYA 4CVRA 3E1NA 2CEIA 2JD60 4LQHA 1QYBA 2N02A 4LQJA 3PVYB 2XJMA 5GU3X 2Z90A 3NOZX 4ITWA 4EVEA 1O9RA 1Z6OA 3SH6A 4CMYV 3R2RA 3AF8X 4KVRA 1TKOA 4RC7A 3WVWA 2FL0A 2G4HA 4TODA 2WLUA 4RC6B 3RD0A 5FFDA 3W54A 1JIGA 3ES3A 2BJYA 5HU6D 2VZBA 2ZG8X 5CMQA 1F33A 3EZ0A 3PVTB 2OKCA 5HJHA 1KRQA 2CLUA 2FHAA 3Q4OA 5D8OA 2IY4A 1VELA 3VNXA 1MFRA 2VXXA 3OGHA 3PWFA 1Z6OM 1ZUJA 4W4LB 1S30A 5JKMG 3C21A 1GWGA 1TKPA 1JYBA 4RC5B 3EGMA 1JGCA 3U90A 5JKLG 2V2SA 3NP2X 4TO9A 5CMRA 2V8UA 4PGIA 3E2CA 5C6FA 3Q4RA 4YXJA 2GS4A 3GHQA 3T9JA 1LKMA 5JDOA 3QZ3A 4M35A 2FJCA 4ML5A 3F32A 3O7SA 3KWOA 1O9IA 4CVPA 4DYYA 4IWKA 3IQ1A 4QUWA 2Z5PA 3IS7A 5K52A 3PWQA 2V15A 2C2JA 2YW6A 5ERKA 4CVSA 3UFBA 3PVYA 1LKPA 1Z4AA 1RCDA 5I4JA 2CN7A 5J9VA 4RC8A 2CHIA 5J8SA 4DZ0A 1VEIA 3F34A 5D8PA 4IXKA 1QGHA 4ZKXA 1XZ3A 2CWLA 3R2OA 4Y08A 4ZL5A 2HTNA 4E40A 4RC6A 3R2MA 3FSEA 3PW8C 2W0OA 4DYXA 3RGDA 1UVHA 4TOAA 4ZJKA 3JZAB 5LS9A 1RCCA 3PVTA 4CMYA 4LQNA 3KA8A 2ZG9X 4II4B 5HQOA 3R2KA 5GU1X 5LBHA 1J30A 2WTLA 2C2UA 3KDQA 4TOHA 1DATA 4E6KA 2FFXJ 3KA4A 5CZUA 4LQVA 2V2MA 2Z5RA 1TJOA 4PGKA 2V2LA 4DI0A 3RE7A 3AF9X 3E1JA 5J8WA 1JTSA 1NFVA 2V8TA 4RC5A 3FI6A 4MXPA 4M34A 5LG8A 3Q4NA 3WVVA 5K53A 2IU2A 2UX1A 1MOJA 3BVLA 1N1QA 3RAVA 4ZTTA 5GN8B 2F7NA 3D19A 3RBCA 1LB3A 2VXIA 4DYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8X A;  3E6S A;  4ETR A;  4DYU A;  1BG7 A;  3SHX A;  4PG0 A;  3H7G A;  5GU0 X;  1OTK A;  2YJK A;  4AM5 A;  1LKO A;  4MY7 A;  5JKM A;  4KVQ A;  2Z6M A;  3F35 A;  3KA3 A;  2CLB A;  1SOF A;  3WVU A;  2V2J A;  4M33 A;  5JKL A;  4XKS A;  2HR5 A;  3QHC A;  4ZKW A;  4MKU A;  5ERJ A;  2C41 A;  4Z5S A;  3ISE A;  3E1P A;  2V2P A;  3AK8 A;  2YJJ A;  4AM2 A;  4II4 A;  3PW8 A;  3F37 A;  3E1L A;  1YUZ A;  4RC7 B;  1JI5 A;  3QVD A;  2XJN A;  4DE6 A;  2QQY A;  3QD8 A;  3E1M A;  1EUM A;  1DVB A;  4REU A;  3AJQ A;  3IS8 A;  1R03 A;  2FZF A;  2XJO A;  1VJX A;  5D8Q A;  3F33 A;  3BKN A;  1NF4 A;  4ERU A;  1IES A;  2PYB A;  4XKT A;  3FVB A;  5LG2 A;  1RCG A;  3HIU A;  3UNO A;  1YV1 A;  3SID A;  4EVD A;  2IB0 A;  5GN8 A;  3UOI A;  5D8S A;  1XZ1 A;  1SQ3 A;  2CF7 A;  4TOC A;  2RBD A;  4LYU A;  1DPS A;  1VEQ A;  3OJ5 A;  4TOB A;  4AM4 A;  4OYN A;  2V2O A;  2GYQ A;  3E1Q A;  3AJP A;  1F30 A;  2Z5Q A;  4MUD A;  4CYB A;  3WNW A;  2V2I A;  3F39 A;  3ISF A;  2Y3Q A;  4M32 A;  2BK6 A;  5FFC A;  1L8H A;  2XKQ A;  4CY9 A;  2OH3 A;  1ZS3 A;  3GVY A;  4ISP A;  2ZUR X;  3EZU A;  3PW1 B;  3KA9 A;  4LPJ A;  1UMN A;  4DAS A;  5FFA A;  1YUX A;  4XKU A;  1NF6 A;  5IX6 A;  1VLG A;  5AXS A;  4ZMC A;  3KXU A;  3PVR B;  1BCF A;  5GU2 X;  3KX9 A;  2JD8 0;  3MPS A;  4ZKH A;  3E1O A;  4EVB A;  4MN9 A;  3R2H A;  4TW3 A;  1H96 A;  3HL1 A;  5FFB A;  4A25 A;  3SE1 A;  4P18 A;  1RCE A;  2YW7 A;  4ISM A;  4KVS A;  2CIH A;  2ITB A;  3R2S A;  4TOG A;  3O7R A;  1RCI A;  4IWJ A;  4U3G A;  2D5K A;  4TOF A;  2ZA7 A;  4PG1 A;  3KA6 A;  1FHA A;  3TA8 A;  1S3Q A;  3AK9 A;  5JAC A;  5D8R A;  3GE4 A;  1L8I A;  4ZL6 A;  1JI4 A;  3BVK A;  3BVE A;  2BW1 A;  3F38 A;  3UOF A;  3BVI A;  5D8Y A;  3BVF A;  3F36 A;  4Z3B A;  2OC5 A;  2XGW A;  4LYX A;  2GYD A;  2ZA8 A;  2ZG7 X;  2FKZ A;  4LPN A;  3E6R A;  2X17 0;  1NNQ A;  5GOU A;  4CVT A;  4YKH A;  3R2L A;  3QHB A;  3AF7 X;  1B71 A;  3PW1 A;  4TOE A;  3A9Q A;  2BKC A;  3ERZ A;  5E2D A;  3Q4Q A;  2QF9 A;  2C6R A;  5E1U A;  1HRS A;  4EVC A;  2FG8 A;  1AEW A;  2FG4 A;  3PVR A;  3BT5 A;  5HJF A;  2V2R A;  2ZA6 A;  3NP0 X;  5FEJ A;  1BFR A;  1S2Z A;  1JKV A;  2C2F A;  4ITT A;  3A68 A;  3PZA A;  5FFE A;  1RYT A;  4R42 A;  1TK6 A;  2CN6 A;  2CHP A;  4LPM A;  3QB9 A;  4ZLW A;  5J93 A;  1JKU A;  3PWQ C;  4MJY A;  2WLA A;  3AJO A;  2JD7 0;  1IER A;  2V2N A;  4CYA A;  4XGS A;  1JRE A;  4CVR A;  3E1N A;  2CEI A;  2JD6 0;  4LQH A;  1QYB A;  4LQJ A;  3PVY B;  2XJM A;  5GU3 X;  2Z90 A;  3NOZ X;  4ITW A;  4EVE A;  1O9R A;  1Z6O A;  3SH6 A;  4CMY V;  3R2R A;  3AF8 X;  4KVR A;  1TKO A;  4RC7 A;  3WVW A;  2FL0 A;  2G4H A;  4TOD A;  2WLU A;  4RC6 B;  3RD0 A;  5FFD A;  1JIG A;  3ES3 A;  2BJY A;  2VZB A;  2ZG8 X;  5CMQ A;  1F33 A;  3EZ0 A;  3PVT B;  5HJH A;  1KRQ A;  2CLU A;  2FHA A;  3Q4O A;  5D8O A;  2IY4 A;  1VEL A;  3VNX A;  1MFR A;  2VXX A;  3OGH A;  3PWF A;  1Z6O M;  1ZUJ A;  1S30 A;  5JKM G;  1GWG A;  1TKP A;  1JYB A;  4RC5 B;  3EGM A;  1JGC A;  3U90 A;  5JKL G;  2V2S A;  3NP2 X;  4TO9 A;  5CMR A;  4PGI A;  3E2C A;  5C6F A;  3Q4R A;  2GS4 A;  3GHQ A;  3T9J A;  1LKM A;  3QZ3 A;  4M35 A;  2FJC A;  4ML5 A;  3F32 A;  3O7S A;  3KWO A;  1O9I A;  4CVP A;  4DYY A;  4IWK A;  3IQ1 A;  4QUW A;  2Z5P A;  3IS7 A;  5K52 A;  3PWQ A;  2V15 A;  2C2J A;  2YW6 A;  5ERK A;  4CVS A;  3PVY A;  1LKP A;  1Z4A A;  1RCD A;  5I4J A;  2CN7 A;  5J9V A;  4RC8 A;  2CHI A;  5J8S A;  4DZ0 A;  1VEI A;  3F34 A;  5D8P A;  4IXK A;  1QGH A;  4ZKX A;  1XZ3 A;  3R2O A;  4Y08 A;  4ZL5 A;  2HTN A;  4RC6 A;  3R2M A;  3FSE A;  3PW8 C;  2W0O A;  4DYX A;  3RGD A;  1UVH A;  4TOA A;  4ZJK A;  5LS9 A;  1RCC A;  3PVT A;  4CMY A;  4LQN A;  3KA8 A;  2ZG9 X;  4II4 B;  5HQO A;  3R2K A;  5GU1 X;  5LBH A;  1J30 A;  2WTL A;  2C2U A;  4TOH A;  1DAT A;  4E6K A;  2FFX J;  3KA4 A;  5CZU A;  4LQV A;  2V2M A;  2Z5R A;  1TJO A;  4PGK A;  2V2L A;  4DI0 A;  3RE7 A;  3AF9 X;  3E1J A;  5J8W A;  1JTS A;  1NFV A;  4RC5 A;  3FI6 A;  4M34 A;  5LG8 A;  3Q4N A;  3WVV A;  5K53 A;  2IU2 A;  2UX1 A;  1MOJ A;  3BVL A;  1N1Q A;  3RAV A;  4ZTT A;  5GN8 B;  2F7N A;  3RBC A;  1LB3 A;  2VXI A;  4DYZ A; 
#chains in the Genus database with same CATH topology
 5D8X A;  3E6S A;  4ETR A;  4DYU A;  2MGY A;  1BG7 A;  3SHX A;  4PG0 A;  3H7G A;  5GU0 X;  1OTK A;  2YJK A;  4AM5 A;  1LKO A;  3KHK A;  4MY7 A;  5JKM A;  4KVQ A;  2Z6M A;  3F35 A;  3KA3 A;  2CLB A;  1SOF A;  3WVU A;  2WWX B;  2V2J A;  4M33 A;  5JKL A;  4XKS A;  2HR5 A;  3QHC A;  4ZKW A;  4MKU A;  5ERJ A;  2C41 A;  3M6J A;  4Z5S A;  3ISE A;  3E1P A;  2V2P A;  3AK8 A;  2YJJ A;  4AM2 A;  4II4 A;  3PW8 A;  3F37 A;  3E1L A;  1YUZ A;  4RC7 B;  1JI5 A;  3QVD A;  2XJN A;  4DE6 A;  2QQY A;  3FRR A;  3QD8 A;  3E1M A;  1EUM A;  1DVB A;  4REU A;  3AJQ A;  3C23 A;  3IS8 A;  1R03 A;  2FZF A;  2XJO A;  1VJX A;  5D8Q A;  4KXR B;  3F33 A;  3BKN A;  1NF4 A;  4ERU A;  1IES A;  2PYB A;  3C1Z A;  4XKT A;  4YVZ A;  3FVB A;  3LKD A;  5LG2 A;  1RCG A;  3HIU A;  3UNO A;  1YV1 A;  3SID A;  4EVD A;  3JZ9 A;  2IB0 A;  3DBY A;  5GN8 A;  3UOI A;  5D8S A;  1XZ1 A;  1SQ3 A;  2CF7 A;  4TOC A;  2RBD A;  4LYU A;  1DPS A;  1VEQ A;  3OJ5 A;  4TOB A;  4AM4 A;  4OYN A;  2V2O A;  3VV9 A;  2GYQ A;  3E1Q A;  3AJP A;  1F30 A;  2Z5Q A;  3FRS A;  4MUD A;  4CYB A;  3WNW A;  2V2I A;  3F39 A;  4W4K B;  3ISF A;  2Y3Q A;  4M32 A;  4WJG 4;  2BK6 A;  5FFC A;  1L8H A;  2AR0 A;  2XKQ A;  4CY9 A;  2OH3 A;  1ZS3 A;  3GVY A;  4ISP A;  2ZUR X;  3EZU A;  3PW1 B;  3KA9 A;  4LPJ A;  1UMN A;  4DAS A;  5FFA A;  1YUX A;  3C1Y A;  4X0J A;  4XKU A;  1NF6 A;  5IX6 A;  1VLG A;  5AXS A;  4ZMC A;  3KXU A;  3PVR B;  1BCF A;  5GU2 X;  3KX9 A;  2JD8 0;  3MPS A;  4ZKH A;  3E1O A;  4EVB A;  4MN9 A;  3R2H A;  4TW3 A;  1H96 A;  3HL1 A;  3VVA A;  3L0M A;  5FFB A;  4A25 A;  3SE1 A;  4P18 A;  1RCE A;  2YW7 A;  4ISM A;  4KVS A;  2CIH A;  2ITB A;  3R2S A;  4TOG A;  3O7R A;  1RCI A;  4IWJ A;  4U3G A;  2D5K A;  4TOF A;  2ZA7 A;  4PG1 A;  3KA6 A;  1FHA A;  3TA8 A;  1S3Q A;  3AK9 A;  5JAC A;  5D8R A;  3GE4 A;  1L8I A;  4ZL6 A;  1JI4 A;  3BVK A;  3BVE A;  2BW1 A;  3F38 A;  3UOF A;  3BVI A;  5D8Y A;  3BVF A;  3F36 A;  4Z3B A;  3N6O A;  2OC5 A;  2XGW A;  4LYX A;  2GYD A;  2ZA8 A;  2ZG7 X;  2FKZ A;  3GGZ A;  2Y44 A;  4LPN A;  3E6R A;  2X17 0;  1NNQ A;  5GOU A;  4CVT A;  4YKH A;  3R2L A;  3QHB A;  3AF7 X;  1B71 A;  3PW1 A;  4TOE A;  3A9Q A;  2BKC A;  3ERZ A;  5E2D A;  3Q4Q A;  2QF9 A;  2C6R A;  5E1U A;  3V3K B;  1HRS A;  4EVC A;  2FG8 A;  1AEW A;  2FG4 A;  3PVR A;  3BT5 A;  5HJF A;  4YXM A;  2V2R A;  2ZA6 A;  3NP0 X;  5FEJ A;  1BFR A;  1S2Z A;  1JKV A;  2C2F A;  4ITT A;  3A68 A;  3PZA A;  5FFE A;  1RYT A;  4R42 A;  5JDO B;  1TK6 A;  2G38 B;  2CN6 A;  2CHP A;  4LPM A;  3QB9 A;  4ZLW A;  5J93 A;  1JKU A;  3PWQ C;  4MJY A;  2WLA A;  3AJO A;  2JD7 0;  1IER A;  2V2N A;  4CYA A;  4XGS A;  1JRE A;  3GGY A;  4CVR A;  3E1N A;  2CEI A;  2JD6 0;  4LQH A;  1QYB A;  2N02 A;  4LQJ A;  3PVY B;  2XJM A;  5GU3 X;  2Z90 A;  3NOZ X;  4ITW A;  4EVE A;  1O9R A;  1Z6O A;  3SH6 A;  4CMY V;  3R2R A;  3AF8 X;  4KVR A;  1TKO A;  4RC7 A;  3WVW A;  2FL0 A;  2G4H A;  4TOD A;  2WLU A;  4RC6 B;  3RD0 A;  5FFD A;  3W54 A;  1JIG A;  3ES3 A;  2BJY A;  5HU6 D;  2VZB A;  2ZG8 X;  5CMQ A;  1F33 A;  3EZ0 A;  3PVT B;  2OKC A;  5HJH A;  1KRQ A;  2CLU A;  2FHA A;  3Q4O A;  5D8O A;  2IY4 A;  1VEL A;  3VNX A;  1MFR A;  2VXX A;  3OGH A;  3PWF A;  1Z6O M;  1ZUJ A;  4W4L B;  1S30 A;  5JKM G;  3C21 A;  1GWG A;  1TKP A;  1JYB A;  4RC5 B;  3EGM A;  1JGC A;  3U90 A;  5JKL G;  2V2S A;  3NP2 X;  4TO9 A;  5CMR A;  2V8U A;  4PGI A;  3E2C A;  5C6F A;  3Q4R A;  4YXJ A;  2GS4 A;  3GHQ A;  3T9J A;  1LKM A;  5JDO A;  3QZ3 A;  4M35 A;  2FJC A;  4ML5 A;  3F32 A;  3O7S A;  3KWO A;  1O9I A;  4CVP A;  4DYY A;  4IWK A;  3IQ1 A;  4QUW A;  2Z5P A;  3IS7 A;  5K52 A;  3PWQ A;  2V15 A;  2C2J A;  2YW6 A;  5ERK A;  4CVS A;  3UFB A;  3PVY A;  1LKP A;  1Z4A A;  1RCD A;  5I4J A;  2CN7 A;  5J9V A;  4RC8 A;  2CHI A;  5J8S A;  4DZ0 A;  1VEI A;  3F34 A;  5D8P A;  4IXK A;  1QGH A;  4ZKX A;  1XZ3 A;  2CWL A;  3R2O A;  4Y08 A;  4ZL5 A;  2HTN A;  4E40 A;  4RC6 A;  3R2M A;  3FSE A;  3PW8 C;  2W0O A;  4DYX A;  3RGD A;  1UVH A;  4TOA A;  4ZJK A;  3JZA B;  5LS9 A;  1RCC A;  3PVT A;  4CMY A;  4LQN A;  3KA8 A;  2ZG9 X;  4II4 B;  5HQO A;  3R2K A;  5GU1 X;  5LBH A;  1J30 A;  2WTL A;  2C2U A;  3KDQ A;  4TOH A;  1DAT A;  4E6K A;  2FFX J;  3KA4 A;  5CZU A;  4LQV A;  2V2M A;  2Z5R A;  1TJO A;  4PGK A;  2V2L A;  4DI0 A;  3RE7 A;  3AF9 X;  3E1J A;  5J8W A;  1JTS A;  1NFV A;  2V8T A;  4RC5 A;  3FI6 A;  4MXP A;  4M34 A;  5LG8 A;  3Q4N A;  3WVV A;  5K53 A;  2IU2 A;  2UX1 A;  1MOJ A;  3BVL A;  1N1Q A;  3RAV A;  4ZTT A;  5GN8 B;  2F7N A;  3D19 A;  3RBC A;  1LB3 A;  2VXI A;  4DYZ A; 
#chains in the Genus database with same CATH homology
 5D8X A;  3E6S A;  4ETR A;  4DYU A;  2MGY A;  1BG7 A;  3SHX A;  4PG0 A;  3H7G A;  5GU0 X;  1OTK A;  2YJK A;  4AM5 A;  1LKO A;  3KHK A;  4MY7 A;  5JKM A;  4KVQ A;  2Z6M A;  3F35 A;  3KA3 A;  2CLB A;  1SOF A;  3WVU A;  2WWX B;  2V2J A;  4M33 A;  5JKL A;  4XKS A;  2HR5 A;  3QHC A;  4ZKW A;  4MKU A;  5ERJ A;  2C41 A;  3M6J A;  4Z5S A;  3ISE A;  3E1P A;  2V2P A;  3AK8 A;  2YJJ A;  4AM2 A;  4II4 A;  3PW8 A;  3F37 A;  3E1L A;  1YUZ A;  4RC7 B;  1JI5 A;  3QVD A;  2XJN A;  4DE6 A;  2QQY A;  3FRR A;  3QD8 A;  3E1M A;  1EUM A;  1DVB A;  4REU A;  3AJQ A;  3C23 A;  3IS8 A;  1R03 A;  2FZF A;  2XJO A;  1VJX A;  5D8Q A;  4KXR B;  3F33 A;  3BKN A;  1NF4 A;  4ERU A;  1IES A;  2PYB A;  3C1Z A;  4XKT A;  4YVZ A;  3FVB A;  3LKD A;  5LG2 A;  1RCG A;  3HIU A;  3UNO A;  1YV1 A;  3SID A;  4EVD A;  3JZ9 A;  2IB0 A;  3DBY A;  5GN8 A;  3UOI A;  5D8S A;  1XZ1 A;  1SQ3 A;  2CF7 A;  4TOC A;  2RBD A;  4LYU A;  1DPS A;  1VEQ A;  3OJ5 A;  4TOB A;  4AM4 A;  4OYN A;  2V2O A;  3VV9 A;  2GYQ A;  3E1Q A;  3AJP A;  1F30 A;  2Z5Q A;  3FRS A;  4MUD A;  4CYB A;  3WNW A;  2V2I A;  3F39 A;  4W4K B;  3ISF A;  2Y3Q A;  4M32 A;  4WJG 4;  2BK6 A;  5FFC A;  1L8H A;  2AR0 A;  2XKQ A;  4CY9 A;  2OH3 A;  1ZS3 A;  3GVY A;  4ISP A;  2ZUR X;  3EZU A;  3PW1 B;  3KA9 A;  4LPJ A;  1UMN A;  4DAS A;  5FFA A;  1YUX A;  3C1Y A;  4X0J A;  4XKU A;  1NF6 A;  5IX6 A;  1VLG A;  5AXS A;  4ZMC A;  3KXU A;  3PVR B;  1BCF A;  5GU2 X;  3KX9 A;  2JD8 0;  3MPS A;  4ZKH A;  3E1O A;  4EVB A;  4MN9 A;  3R2H A;  4TW3 A;  1H96 A;  3HL1 A;  3VVA A;  3L0M A;  5FFB A;  4A25 A;  3SE1 A;  4P18 A;  1RCE A;  2YW7 A;  4ISM A;  4KVS A;  2CIH A;  2ITB A;  3R2S A;  4TOG A;  3O7R A;  1RCI A;  4IWJ A;  4U3G A;  2D5K A;  4TOF A;  2ZA7 A;  4PG1 A;  3KA6 A;  1FHA A;  3TA8 A;  1S3Q A;  3AK9 A;  5JAC A;  5D8R A;  3GE4 A;  1L8I A;  4ZL6 A;  1JI4 A;  3BVK A;  3BVE A;  2BW1 A;  3F38 A;  3UOF A;  3BVI A;  5D8Y A;  3BVF A;  3F36 A;  4Z3B A;  3N6O A;  2OC5 A;  2XGW A;  4LYX A;  2GYD A;  2ZA8 A;  2ZG7 X;  2FKZ A;  3GGZ A;  2Y44 A;  4LPN A;  3E6R A;  2X17 0;  1NNQ A;  5GOU A;  4CVT A;  4YKH A;  3R2L A;  3QHB A;  3AF7 X;  1B71 A;  3PW1 A;  4TOE A;  3A9Q A;  2BKC A;  3ERZ A;  5E2D A;  3Q4Q A;  2QF9 A;  2C6R A;  5E1U A;  3V3K B;  1HRS A;  4EVC A;  2FG8 A;  1AEW A;  2FG4 A;  3PVR A;  3BT5 A;  5HJF A;  4YXM A;  2V2R A;  2ZA6 A;  3NP0 X;  5FEJ A;  1BFR A;  1S2Z A;  1JKV A;  2C2F A;  4ITT A;  3A68 A;  3PZA A;  5FFE A;  1RYT A;  4R42 A;  5JDO B;  1TK6 A;  2G38 B;  2CN6 A;  2CHP A;  4LPM A;  3QB9 A;  4ZLW A;  5J93 A;  1JKU A;  3PWQ C;  4MJY A;  2WLA A;  3AJO A;  2JD7 0;  1IER A;  2V2N A;  4CYA A;  4XGS A;  1JRE A;  3GGY A;  4CVR A;  3E1N A;  2CEI A;  2JD6 0;  4LQH A;  1QYB A;  2N02 A;  4LQJ A;  3PVY B;  2XJM A;  5GU3 X;  2Z90 A;  3NOZ X;  4ITW A;  4EVE A;  1O9R A;  1Z6O A;  3SH6 A;  4CMY V;  3R2R A;  3AF8 X;  4KVR A;  1TKO A;  4RC7 A;  3WVW A;  2FL0 A;  2G4H A;  4TOD A;  2WLU A;  4RC6 B;  3RD0 A;  5FFD A;  3W54 A;  1JIG A;  3ES3 A;  2BJY A;  5HU6 D;  2VZB A;  2ZG8 X;  5CMQ A;  1F33 A;  3EZ0 A;  3PVT B;  2OKC A;  5HJH A;  1KRQ A;  2CLU A;  2FHA A;  3Q4O A;  5D8O A;  2IY4 A;  1VEL A;  3VNX A;  1MFR A;  2VXX A;  3OGH A;  3PWF A;  1Z6O M;  1ZUJ A;  4W4L B;  1S30 A;  5JKM G;  3C21 A;  1GWG A;  1TKP A;  1JYB A;  4RC5 B;  3EGM A;  1JGC A;  3U90 A;  5JKL G;  2V2S A;  3NP2 X;  4TO9 A;  5CMR A;  2V8U A;  4PGI A;  3E2C A;  5C6F A;  3Q4R A;  4YXJ A;  2GS4 A;  3GHQ A;  3T9J A;  1LKM A;  5JDO A;  3QZ3 A;  4M35 A;  2FJC A;  4ML5 A;  3F32 A;  3O7S A;  3KWO A;  1O9I A;  4CVP A;  4DYY A;  4IWK A;  3IQ1 A;  4QUW A;  2Z5P A;  3IS7 A;  5K52 A;  3PWQ A;  2V15 A;  2C2J A;  2YW6 A;  5ERK A;  4CVS A;  3UFB A;  3PVY A;  1LKP A;  1Z4A A;  1RCD A;  5I4J A;  2CN7 A;  5J9V A;  4RC8 A;  2CHI A;  5J8S A;  4DZ0 A;  1VEI A;  3F34 A;  5D8P A;  4IXK A;  1QGH A;  4ZKX A;  1XZ3 A;  2CWL A;  3R2O A;  4Y08 A;  4ZL5 A;  2HTN A;  4E40 A;  4RC6 A;  3R2M A;  3FSE A;  3PW8 C;  2W0O A;  4DYX A;  3RGD A;  1UVH A;  4TOA A;  4ZJK A;  3JZA B;  5LS9 A;  1RCC A;  3PVT A;  4CMY A;  4LQN A;  3KA8 A;  2ZG9 X;  4II4 B;  5HQO A;  3R2K A;  5GU1 X;  5LBH A;  1J30 A;  2WTL A;  2C2U A;  3KDQ A;  4TOH A;  1DAT A;  4E6K A;  2FFX J;  3KA4 A;  5CZU A;  4LQV A;  2V2M A;  2Z5R A;  1TJO A;  4PGK A;  2V2L A;  4DI0 A;  3RE7 A;  3AF9 X;  3E1J A;  5J8W A;  1JTS A;  1NFV A;  2V8T A;  4RC5 A;  3FI6 A;  4MXP A;  4M34 A;  5LG8 A;  3Q4N A;  3WVV A;  5K53 A;  2IU2 A;  2UX1 A;  1MOJ A;  3BVL A;  1N1Q A;  3RAV A;  4ZTT A;  5GN8 B;  2F7N A;  3D19 A;  3RBC A;  1LB3 A;  2VXI A;  4DYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...