5FFBA

Copm in the apo form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
152
structure length
135
Chain Sequence
WTDQSFIEMMTPHHQDAIDMAEMALQKAEHPELKKLARNIIRDQEREIKEMKTWYQQWFKRPVPAMDLDALATAQNFDREFIRQMIPHHQMAVMMASNLKTNTERPEMDKLMDDIIRSQSAEIKQMKQWYQNWYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CopM
publication title Structural basis for copper/silver binding by the Synechocystis metallochaperone CopM
doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 59
structure length 135
sequence length 152
ec nomenclature
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03713 DUF305 Domain of unknown function (DUF305)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5ffbA00
4LYXA 1JTSA 4IWJA 4LPJA 3KXUA 3EZ0A 3FI6A 2V2NA 1VLGA 4XGSA 4KVRA 2PYBA 3AF8X 1ZS3A 5FFBA 3WVUA 2V15A 3EZUA 4DI0A 5FFEA 2V2MA 5D8QA 2YJKA 3F36A 2GYDA 4EVEA 5I4JA 5J9VA 1SOFA 3UOFA 2Z5PA 5CMQA 3AJPA 2ITBA 3AK9A 1JKUA 3PW8A 3RBCA 4AM5A 3PVTA 3UNOA 1NF4A 1RCCA 4YKHA 4ZL5A 2Z5QA 5GN8A 4P18A 2ZG9X 2CN7A 3HL1A 4CVRA 2FL0A 5J93A 4ZLWA 2FG8A 5FFDA 2UX1A 3R2RA 3AF7X 4LYUA 2G4HA 2W0OA 2ZG8X 2D5KA 2XJMA 1J30A 3E6SA 3WVVA 4CVSA 1O9IA 3BVFA 2Z6MA 2FFXJ 2QF9A 2CHIA 1LKPA 2VXXA 3NP0X 4TODA 4RC5B 4IWKA 4LPMA 2BK6A 5C6FA 3PW8C 1L8IA 1DPSA 4Z5SA 2CEIA 4XKTA 5LS9A 5K53A 4MJYA 4RC5A 1GWGA 3SE1A 2FG4A 1JIGA 3O7RA 4LPNA 4ZKHA 1NFVA 2CF7A 3ISFA 3QD8A 4PGIA 1BCFA 2BW1A 3BVIA 4OYNA 2GS4A 3QZ3A 1OTKA 5D8RA 1S2ZA 5E2DA 5CMRA 3PWQC 4TOCA 2F7NA 2YW6A 3T9JA 3E2CA 1NF6A 3NP2X 4IXKA 4CYAA 1IESA 4ZL6A 2CLUA 4DZ0A 1RCEA 4LQVA 2ZA7A 1YUZA 4TW3A 3QHCA 2JD60 5JKMA 3IS7A 5JACA 1RYTA 2JD80 5FFAA 3GE4A 3PW1B 1AEWA 1XZ3A 3H7GA 1VEQA 4Z3BA 2IB0A 1TJOA 1LB3A 5J8WA 1JREA 4PG0A 2V2JA 1UMNA 3PVYB 4LQHA 4TOFA 5GU1X 3SH6A 3RE7A 3PZAA 2C41A 1S3QA 3OJ5A 3FSEA 2Z90A 3RAVA 1EUMA 2FHAA 1TKPA 4AM4A 4EVCA 2XJNA 4E6KA 4REUA 5E1UA 2FJCA 2CIHA 5HJFA 4AM2A 2OC5A 1MFRA 4CMYA 4DASA 5LG8A 5ERJA 3AJOA 2FKZA 2HTNA 1MOJA 3KX9A 3FVBA 3QHBA 2X170 5J8SA 2VXIA 4U3GA 4II4B 2IU2A 1S30A 2V2SA 4Y08A 4CYBA 2WLUA 3BT5A 4MN9A 4CMYV 4TOEA 3A68A 3R2LA 3PWQA 4II4A 3EGMA 2ZG7X 3F33A 4RC8A 2V2OA 4KVSA 1QGHA 2OH3A 2V2LA 2GYQA 3E1PA 5GOUA 5GU3X 2JD70 3Q4QA 3E1JA 1ZUJA 3Q4RA 4RC7B 1JYBA 3KA4A 2V2PA 1Z4AA 3F37A 3TA8A 3E1LA 1O9RA 5D8YA 3GVYA 4ITTA 2BKCA 3R2HA 3RGDA 1VEIA 1RCDA 1RCGA 4ISMA 5GU0X 4ISPA 3R2SA 4M35A 3WVWA 5JKLG 3F39A 1Z6OA 2C2FA 1RCIA 4ERUA 3F32A 5D8XA 5HQOA 1DVBA 2ZA6A 2BJYA 1DATA 2ZURX 1HRSA 4MUDA 2ZA8A 1QYBA 3VNXA 4EVBA 1R03A 1VJXA 3O7SA 5GU2X 3ISEA 4DYXA 4MY7A 3WNWA 3PW1A 1FHAA 2V2IA 3E1OA 2XGWA 1TK6A 4R42A 3E6RA 3KA9A 3PVYA 3GHQA 5LBHA 1YUXA 3R2KA 5LG2A 3RD0A 1F30A 1JGCA 3E1QA 4PG1A 3ES3A 2CN6A 3AJQA 3KA6A 5D8PA 3AK8A 3QB9A 1BFRA 1VELA 4TOHA 3BKNA 3A9QA 4DE6A 3ERZA 5JKMG 3Q4OA 4M32A 3PVTB 2WTLA 3KA8A 1F33A 2RBDA 4ZTTA 1Z6OM 3R2MA 5HJHA 2VZBA 5GN8B 2XKQA 3SHXA 4RC6B 3IQ1A 3F35A 5ERKA 3U90A 1L8HA 3BVLA 4CVPA 4ZKWA 4RC6A 3UOIA 2HR5A 2QQYA 5JKLA 3MPSA 1LKOA 2C6RA 2CLBA 4XKSA 4DYUA 3E1NA 4XKUA 3Q4NA 1NNQA 1H96A 5CZUA 4TOAA 3F38A 3SIDA 1UVHA 5FEJA 4RC7A 4LQNA 4ITWA 4MKUA 2Z5RA 4PGKA 2XJOA 1JI5A 3KA3A 4ZKXA 4KVQA 5D8SA 2FZFA 3HIUA 5IX6A 1JKVA 1XZ1A 2V2RA 2YW7A 3OGHA 4TOBA 1YV1A 4ZJKA 1N1QA 4LQJA 3BVKA 2C2JA 2CHPA 4A25A 4M33A 4M34A 3F34A 1JI4A 1IERA 2C2UA 2IY4A 3AF9X 4ML5A 5K52A 3KWOA 3PVRB 2WLAA 3IS8A 4TOGA 5FFCA 4DYZA 1KRQA 1BG7A 1TKOA 2Y3QA 4CVTA 1B71A 3R2OA 4ZMCA 3PVRA 2YJJA 1SQ3A 4ETRA 5D8OA 4QUWA 4CY9A 3BVEA 5AXSA 4EVDA 3E1MA 1LKMA 3NOZX 3PWFA 4TO9A 3QVDA 4DYYA
chains in the Genus database with same CATH superfamily
2V8TA 3D19A 4LYXA 1JTSA 4IWJA 4LPJA 3VVAA 3KXUA 3EZ0A 3FI6A 2V2NA 1VLGA 4XGSA 3UFBA 4KVRA 2PYBA 3AF8X 1ZS3A 5FFBA 3WVUA 2V15A 3EZUA 4DI0A 5FFEA 2V2MA 5D8QA 2YJKA 3F36A 2GYDA 2MGYA 4EVEA 5I4JA 4X0JA 5J9VA 1SOFA 3UOFA 2Z5PA 5CMQA 3AJPA 2ITBA 3AK9A 1JKUA 3PW8A 3RBCA 4AM5A 3PVTA 3UNOA 2AR0A 1NF4A 1RCCA 4YKHA 3C1ZA 4KXRB 4ZL5A 2Z5QA 3DBYA 2ZG9X 4P18A 5GN8A 2CN7A 3HL1A 4CVRA 2FL0A 5J93A 4ZLWA 2FG8A 5FFDA 2UX1A 3R2RA 3AF7X 4LYUA 2OKCA 2G4HA 2W0OA 2ZG8X 2D5KA 2XJMA 1J30A 3E6SA 3WVVA 4CVSA 1O9IA 3BVFA 2Z6MA 2FFXJ 2QF9A 2CHIA 1LKPA 2VXXA 3NP0X 4TODA 4RC5B 4IWKA 4LPMA 2BK6A 5C6FA 4W4KB 3PW8C 1L8IA 1DPSA 4Z5SA 2CEIA 4XKTA 5LS9A 5K53A 4MJYA 4RC5A 1GWGA 3SE1A 2FG4A 1JIGA 3O7RA 4LPNA 4ZKHA 1NFVA 4YXJA 2CF7A 3ISFA 3L0MA 3QD8A 4PGIA 1BCFA 2BW1A 3BVIA 4OYNA 2GS4A 3QZ3A 5JDOB 1OTKA 5D8RA 1S2ZA 5E2DA 5CMRA 3PWQC 4TOCA 2F7NA 2YW6A 3T9JA 2WWXB 3E2CA 1NF6A 3NP2X 4IXKA 4CYAA 1IESA 4ZL6A 2CLUA 4DZ0A 3C23A 1RCEA 4LQVA 2ZA7A 1YUZA 3VV9A 4WJG4 4TW3A 4W4LB 3QHCA 2JD60 5JKMA 3IS7A 3FRSA 5JACA 1RYTA 2JD80 5FFAA 3GE4A 3PW1B 1AEWA 1XZ3A 3H7GA 1VEQA 4Z3BA 2IB0A 1TJOA 1LB3A 5J8WA 2Y44A 1JREA 4PG0A 2V2JA 1UMNA 3PVYB 4LQHA 4TOFA 5GU1X 3SH6A 3RE7A 3PZAA 2C41A 3JZAB 1S3QA 3OJ5A 3FSEA 2Z90A 3RAVA 4YXMA 1EUMA 2FHAA 1TKPA 4AM4A 4EVCA 2XJNA 4E6KA 4REUA 5E1UA 2FJCA 2CIHA 5HJFA 3W54A 4AM2A 2OC5A 1MFRA 4CMYA 4DASA 5LG8A 5ERJA 3AJOA 2FKZA 2HTNA 1MOJA 3KX9A 3FVBA 3QHBA 2X170 5J8SA 2VXIA 4U3GA 4II4B 2IU2A 1S30A 2V2SA 4Y08A 4CYBA 2WLUA 3BT5A 4MN9A 4CMYV 4TOEA 3A68A 3R2LA 3PWQA 4II4A 3EGMA 3FRRA 2ZG7X 3F33A 4RC8A 2V2OA 2G38B 4KVSA 1QGHA 2OH3A 2V2LA 2GYQA 3E1PA 5GOUA 5GU3X 2JD70 3Q4QA 3E1JA 1ZUJA 3Q4RA 4RC7B 1JYBA 3KHKA 3KA4A 2V2PA 1Z4AA 3F37A 3TA8A 3E1LA 1O9RA 5D8YA 3GVYA 4ITTA 3JZ9A 2BKCA 3R2HA 4YVZA 4MXPA 3RGDA 1VEIA 1RCDA 1RCGA 4ISMA 5GU0X 4ISPA 3R2SA 3N6OA 4M35A 3WVWA 5JKLG 3F39A 1Z6OA 2C2FA 3M6JA 5JDOA 1RCIA 3LKDA 4ERUA 3F32A 5D8XA 5HQOA 1DVBA 2ZA6A 2BJYA 3C21A 1DATA 2ZURX 1HRSA 4MUDA 2ZA8A 1QYBA 3VNXA 4EVBA 1R03A 1VJXA 3O7SA 5GU2X 3ISEA 4DYXA 4MY7A 3WNWA 3PW1A 1FHAA 2V2IA 3E1OA 2XGWA 1TK6A 4R42A 3E6RA 3KA9A 3PVYA 3GHQA 5LBHA 1YUXA 3R2KA 5LG2A 3RD0A 1F30A 3GGYA 1JGCA 3E1QA 4PG1A 3ES3A 2CN6A 2N02A 3AJQA 3KA6A 5D8PA 3AK8A 3QB9A 1BFRA 1VELA 4TOHA 3BKNA 3A9QA 4DE6A 3ERZA 5JKMG 3Q4OA 4M32A 3PVTB 2WTLA 3KA8A 1F33A 2RBDA 4ZTTA 1Z6OM 3R2MA 5HJHA 2CWLA 2VZBA 5GN8B 2XKQA 3SHXA 4RC6B 3IQ1A 3F35A 5ERKA 3U90A 1L8HA 3BVLA 4CVPA 4ZKWA 4RC6A 3UOIA 2HR5A 2QQYA 5JKLA 3MPSA 1LKOA 2C6RA 2CLBA 4XKSA 4DYUA 3E1NA 4XKUA 4E40A 3Q4NA 1NNQA 1H96A 5CZUA 4TOAA 3F38A 3SIDA 1UVHA 5FEJA 4RC7A 4LQNA 2V8UA 4ITWA 4MKUA 2Z5RA 4PGKA 2XJOA 1JI5A 3KA3A 4ZKXA 4KVQA 5D8SA 2FZFA 3HIUA 5IX6A 1JKVA 3KDQA 1XZ1A 2V2RA 2YW7A 3OGHA 5HU6D 4TOBA 1YV1A 4ZJKA 1N1QA 4LQJA 3BVKA 2C2JA 2CHPA 4A25A 4M33A 4M34A 3F34A 1JI4A 1IERA 2C2UA 2IY4A 3AF9X 4ML5A 5K52A 3KWOA 3PVRB 3GGZA 2WLAA 3IS8A 4TOGA 3C1YA 5FFCA 4DYZA 1KRQA 1BG7A 1TKOA 2Y3QA 4CVTA 1B71A 3R2OA 4ZMCA 3PVRA 2YJJA 1SQ3A 4ETRA 5D8OA 4QUWA 4CY9A 3BVEA 5AXSA 4EVDA 3E1MA 1LKMA 3NOZX 3V3KB 3PWFA 4TO9A 3QVDA 4DYYA
chains in the Genus database with same CATH topology
2V8TA 3D19A 4LYXA 1JTSA 4IWJA 4LPJA 3VVAA 3KXUA 3EZ0A 3FI6A 2V2NA 1VLGA 4XGSA 3UFBA 4KVRA 2PYBA 3AF8X 1ZS3A 5FFBA 3WVUA 2V15A 3EZUA 4DI0A 5FFEA 2V2MA 5D8QA 2YJKA 3F36A 2GYDA 2MGYA 4EVEA 5I4JA 4X0JA 5J9VA 1SOFA 3UOFA 2Z5PA 5CMQA 3AJPA 2ITBA 3AK9A 1JKUA 3PW8A 3RBCA 4AM5A 3PVTA 3UNOA 2AR0A 1NF4A 1RCCA 4YKHA 3C1ZA 4KXRB 4ZL5A 2Z5QA 3DBYA 2ZG9X 4P18A 5GN8A 2CN7A 3HL1A 4CVRA 2FL0A 5J93A 4ZLWA 2FG8A 5FFDA 2UX1A 3R2RA 3AF7X 4LYUA 2OKCA 2G4HA 2W0OA 2ZG8X 2D5KA 2XJMA 1J30A 3E6SA 3WVVA 4CVSA 1O9IA 3BVFA 2Z6MA 2FFXJ 2QF9A 2CHIA 1LKPA 2VXXA 3NP0X 4TODA 4RC5B 4IWKA 4LPMA 2BK6A 5C6FA 4W4KB 3PW8C 1L8IA 1DPSA 4Z5SA 2CEIA 4XKTA 5LS9A 5K53A 4MJYA 4RC5A 1GWGA 3SE1A 2FG4A 1JIGA 3O7RA 4LPNA 4ZKHA 1NFVA 4YXJA 2CF7A 3ISFA 3L0MA 3QD8A 4PGIA 1BCFA 2BW1A 3BVIA 4OYNA 2GS4A 3QZ3A 5JDOB 1OTKA 5D8RA 1S2ZA 5E2DA 5CMRA 3PWQC 4TOCA 2F7NA 2YW6A 3T9JA 2WWXB 3E2CA 1NF6A 3NP2X 4IXKA 4CYAA 1IESA 4ZL6A 2CLUA 4DZ0A 3C23A 1RCEA 4LQVA 2ZA7A 1YUZA 3VV9A 4WJG4 4TW3A 4W4LB 3QHCA 2JD60 5JKMA 3IS7A 3FRSA 5JACA 1RYTA 2JD80 5FFAA 3GE4A 3PW1B 1AEWA 1XZ3A 3H7GA 1VEQA 4Z3BA 2IB0A 1TJOA 1LB3A 5J8WA 2Y44A 1JREA 4PG0A 2V2JA 1UMNA 3PVYB 4LQHA 4TOFA 5GU1X 3SH6A 3RE7A 3PZAA 2C41A 3JZAB 1S3QA 3OJ5A 3FSEA 2Z90A 3RAVA 4YXMA 1EUMA 2FHAA 1TKPA 4AM4A 4EVCA 2XJNA 4E6KA 4REUA 5E1UA 2FJCA 2CIHA 5HJFA 3W54A 4AM2A 2OC5A 1MFRA 4CMYA 4DASA 5LG8A 5ERJA 3AJOA 2FKZA 2HTNA 1MOJA 3KX9A 3FVBA 3QHBA 2X170 5J8SA 2VXIA 4U3GA 4II4B 2IU2A 1S30A 2V2SA 4Y08A 4CYBA 2WLUA 3BT5A 4MN9A 4CMYV 4TOEA 3A68A 3R2LA 3PWQA 4II4A 3EGMA 3FRRA 2ZG7X 3F33A 4RC8A 2V2OA 2G38B 4KVSA 1QGHA 2OH3A 2V2LA 2GYQA 3E1PA 5GOUA 5GU3X 2JD70 3Q4QA 3E1JA 1ZUJA 3Q4RA 4RC7B 1JYBA 3KHKA 3KA4A 2V2PA 1Z4AA 3F37A 3TA8A 3E1LA 1O9RA 5D8YA 3GVYA 4ITTA 3JZ9A 2BKCA 3R2HA 4YVZA 4MXPA 3RGDA 1VEIA 1RCDA 1RCGA 4ISMA 5GU0X 4ISPA 3R2SA 3N6OA 4M35A 3WVWA 5JKLG 3F39A 1Z6OA 2C2FA 3M6JA 5JDOA 1RCIA 3LKDA 4ERUA 3F32A 5D8XA 5HQOA 1DVBA 2ZA6A 2BJYA 3C21A 1DATA 2ZURX 1HRSA 4MUDA 2ZA8A 1QYBA 3VNXA 4EVBA 1R03A 1VJXA 3O7SA 5GU2X 3ISEA 4DYXA 4MY7A 3WNWA 3PW1A 1FHAA 2V2IA 3E1OA 2XGWA 1TK6A 4R42A 3E6RA 3KA9A 3PVYA 3GHQA 5LBHA 1YUXA 3R2KA 5LG2A 3RD0A 1F30A 3GGYA 1JGCA 3E1QA 4PG1A 3ES3A 2CN6A 2N02A 3AJQA 3KA6A 5D8PA 3AK8A 3QB9A 1BFRA 1VELA 4TOHA 3BKNA 3A9QA 4DE6A 3ERZA 5JKMG 3Q4OA 4M32A 3PVTB 2WTLA 3KA8A 1F33A 2RBDA 4ZTTA 1Z6OM 3R2MA 5HJHA 2CWLA 2VZBA 5GN8B 2XKQA 3SHXA 4RC6B 3IQ1A 3F35A 5ERKA 3U90A 1L8HA 3BVLA 4CVPA 4ZKWA 4RC6A 3UOIA 2HR5A 2QQYA 5JKLA 3MPSA 1LKOA 2C6RA 2CLBA 4XKSA 4DYUA 3E1NA 4XKUA 4E40A 3Q4NA 1NNQA 1H96A 5CZUA 4TOAA 3F38A 3SIDA 1UVHA 5FEJA 4RC7A 4LQNA 2V8UA 4ITWA 4MKUA 2Z5RA 4PGKA 2XJOA 1JI5A 3KA3A 4ZKXA 4KVQA 5D8SA 2FZFA 3HIUA 5IX6A 1JKVA 3KDQA 1XZ1A 2V2RA 2YW7A 3OGHA 5HU6D 4TOBA 1YV1A 4ZJKA 1N1QA 4LQJA 3BVKA 2C2JA 2CHPA 4A25A 4M33A 4M34A 3F34A 1JI4A 1IERA 2C2UA 2IY4A 3AF9X 4ML5A 5K52A 3KWOA 3PVRB 3GGZA 2WLAA 3IS8A 4TOGA 3C1YA 5FFCA 4DYZA 1KRQA 1BG7A 1TKOA 2Y3QA 4CVTA 1B71A 3R2OA 4ZMCA 3PVRA 2YJJA 1SQ3A 4ETRA 5D8OA 4QUWA 4CY9A 3BVEA 5AXSA 4EVDA 3E1MA 1LKMA 3NOZX 3V3KB 3PWFA 4TO9A 3QVDA 4DYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LYX A;  1JTS A;  4IWJ A;  4LPJ A;  3KXU A;  3EZ0 A;  3FI6 A;  2V2N A;  1VLG A;  4XGS A;  4KVR A;  2PYB A;  3AF8 X;  1ZS3 A;  5FFB A;  3WVU A;  2V15 A;  3EZU A;  4DI0 A;  5FFE A;  2V2M A;  5D8Q A;  2YJK A;  3F36 A;  2GYD A;  4EVE A;  5I4J A;  5J9V A;  1SOF A;  3UOF A;  2Z5P A;  5CMQ A;  3AJP A;  2ITB A;  3AK9 A;  1JKU A;  3PW8 A;  3RBC A;  4AM5 A;  3PVT A;  3UNO A;  1NF4 A;  1RCC A;  4YKH A;  4ZL5 A;  2Z5Q A;  5GN8 A;  4P18 A;  2ZG9 X;  2CN7 A;  3HL1 A;  4CVR A;  2FL0 A;  5J93 A;  4ZLW A;  2FG8 A;  5FFD A;  2UX1 A;  3R2R A;  3AF7 X;  4LYU A;  2G4H A;  2W0O A;  2ZG8 X;  2D5K A;  2XJM A;  1J30 A;  3E6S A;  3WVV A;  4CVS A;  1O9I A;  3BVF A;  2Z6M A;  2FFX J;  2QF9 A;  2CHI A;  1LKP A;  2VXX A;  3NP0 X;  4TOD A;  4RC5 B;  4IWK A;  4LPM A;  2BK6 A;  5C6F A;  3PW8 C;  1L8I A;  1DPS A;  4Z5S A;  2CEI A;  4XKT A;  5LS9 A;  5K53 A;  4MJY A;  4RC5 A;  1GWG A;  3SE1 A;  2FG4 A;  1JIG A;  3O7R A;  4LPN A;  4ZKH A;  1NFV A;  2CF7 A;  3ISF A;  3QD8 A;  4PGI A;  1BCF A;  2BW1 A;  3BVI A;  4OYN A;  2GS4 A;  3QZ3 A;  1OTK A;  5D8R A;  1S2Z A;  5E2D A;  5CMR A;  3PWQ C;  4TOC A;  2F7N A;  2YW6 A;  3T9J A;  3E2C A;  1NF6 A;  3NP2 X;  4IXK A;  4CYA A;  1IES A;  4ZL6 A;  2CLU A;  4DZ0 A;  1RCE A;  4LQV A;  2ZA7 A;  1YUZ A;  4TW3 A;  3QHC A;  2JD6 0;  5JKM A;  3IS7 A;  5JAC A;  1RYT A;  2JD8 0;  5FFA A;  3GE4 A;  3PW1 B;  1AEW A;  1XZ3 A;  3H7G A;  1VEQ A;  4Z3B A;  2IB0 A;  1TJO A;  1LB3 A;  5J8W A;  1JRE A;  4PG0 A;  2V2J A;  1UMN A;  3PVY B;  4LQH A;  4TOF A;  5GU1 X;  3SH6 A;  3RE7 A;  3PZA A;  2C41 A;  1S3Q A;  3OJ5 A;  3FSE A;  2Z90 A;  3RAV A;  1EUM A;  2FHA A;  1TKP A;  4AM4 A;  4EVC A;  2XJN A;  4E6K A;  4REU A;  5E1U A;  2FJC A;  2CIH A;  5HJF A;  4AM2 A;  2OC5 A;  1MFR A;  4CMY A;  4DAS A;  5LG8 A;  5ERJ A;  3AJO A;  2FKZ A;  2HTN A;  1MOJ A;  3KX9 A;  3FVB A;  3QHB A;  2X17 0;  5J8S A;  2VXI A;  4U3G A;  4II4 B;  2IU2 A;  1S30 A;  2V2S A;  4Y08 A;  4CYB A;  2WLU A;  3BT5 A;  4MN9 A;  4CMY V;  4TOE A;  3A68 A;  3R2L A;  3PWQ A;  4II4 A;  3EGM A;  2ZG7 X;  3F33 A;  4RC8 A;  2V2O A;  4KVS A;  1QGH A;  2OH3 A;  2V2L A;  2GYQ A;  3E1P A;  5GOU A;  5GU3 X;  2JD7 0;  3Q4Q A;  3E1J A;  1ZUJ A;  3Q4R A;  4RC7 B;  1JYB A;  3KA4 A;  2V2P A;  1Z4A A;  3F37 A;  3TA8 A;  3E1L A;  1O9R A;  5D8Y A;  3GVY A;  4ITT A;  2BKC A;  3R2H A;  3RGD A;  1VEI A;  1RCD A;  1RCG A;  4ISM A;  5GU0 X;  4ISP A;  3R2S A;  4M35 A;  3WVW A;  5JKL G;  3F39 A;  1Z6O A;  2C2F A;  1RCI A;  4ERU A;  3F32 A;  5D8X A;  5HQO A;  1DVB A;  2ZA6 A;  2BJY A;  1DAT A;  2ZUR X;  1HRS A;  4MUD A;  2ZA8 A;  1QYB A;  3VNX A;  4EVB A;  1R03 A;  1VJX A;  3O7S A;  5GU2 X;  3ISE A;  4DYX A;  4MY7 A;  3WNW A;  3PW1 A;  1FHA A;  2V2I A;  3E1O A;  2XGW A;  1TK6 A;  4R42 A;  3E6R A;  3KA9 A;  3PVY A;  3GHQ A;  5LBH A;  1YUX A;  3R2K A;  5LG2 A;  3RD0 A;  1F30 A;  1JGC A;  3E1Q A;  4PG1 A;  3ES3 A;  2CN6 A;  3AJQ A;  3KA6 A;  5D8P A;  3AK8 A;  3QB9 A;  1BFR A;  1VEL A;  4TOH A;  3BKN A;  3A9Q A;  4DE6 A;  3ERZ A;  5JKM G;  3Q4O A;  4M32 A;  3PVT B;  2WTL A;  3KA8 A;  1F33 A;  2RBD A;  4ZTT A;  1Z6O M;  3R2M A;  5HJH A;  2VZB A;  5GN8 B;  2XKQ A;  3SHX A;  4RC6 B;  3IQ1 A;  3F35 A;  5ERK A;  3U90 A;  1L8H A;  3BVL A;  4CVP A;  4ZKW A;  4RC6 A;  3UOI A;  2HR5 A;  2QQY A;  5JKL A;  3MPS A;  1LKO A;  2C6R A;  2CLB A;  4XKS A;  4DYU A;  3E1N A;  4XKU A;  3Q4N A;  1NNQ A;  1H96 A;  5CZU A;  4TOA A;  3F38 A;  3SID A;  1UVH A;  5FEJ A;  4RC7 A;  4LQN A;  4ITW A;  4MKU A;  2Z5R A;  4PGK A;  2XJO A;  1JI5 A;  3KA3 A;  4ZKX A;  4KVQ A;  5D8S A;  2FZF A;  3HIU A;  5IX6 A;  1JKV A;  1XZ1 A;  2V2R A;  2YW7 A;  3OGH A;  4TOB A;  1YV1 A;  4ZJK A;  1N1Q A;  4LQJ A;  3BVK A;  2C2J A;  2CHP A;  4A25 A;  4M33 A;  4M34 A;  3F34 A;  1JI4 A;  1IER A;  2C2U A;  2IY4 A;  3AF9 X;  4ML5 A;  5K52 A;  3KWO A;  3PVR B;  2WLA A;  3IS8 A;  4TOG A;  5FFC A;  4DYZ A;  1KRQ A;  1BG7 A;  1TKO A;  2Y3Q A;  4CVT A;  1B71 A;  3R2O A;  4ZMC A;  3PVR A;  2YJJ A;  1SQ3 A;  4ETR A;  5D8O A;  4QUW A;  4CY9 A;  3BVE A;  5AXS A;  4EVD A;  3E1M A;  1LKM A;  3NOZ X;  3PWF A;  4TO9 A;  3QVD A;  4DYY A; 
#chains in the Genus database with same CATH topology
 2V8T A;  3D19 A;  4LYX A;  1JTS A;  4IWJ A;  4LPJ A;  3VVA A;  3KXU A;  3EZ0 A;  3FI6 A;  2V2N A;  1VLG A;  4XGS A;  3UFB A;  4KVR A;  2PYB A;  3AF8 X;  1ZS3 A;  5FFB A;  3WVU A;  2V15 A;  3EZU A;  4DI0 A;  5FFE A;  2V2M A;  5D8Q A;  2YJK A;  3F36 A;  2GYD A;  2MGY A;  4EVE A;  5I4J A;  4X0J A;  5J9V A;  1SOF A;  3UOF A;  2Z5P A;  5CMQ A;  3AJP A;  2ITB A;  3AK9 A;  1JKU A;  3PW8 A;  3RBC A;  4AM5 A;  3PVT A;  3UNO A;  2AR0 A;  1NF4 A;  1RCC A;  4YKH A;  3C1Z A;  4KXR B;  4ZL5 A;  2Z5Q A;  3DBY A;  2ZG9 X;  4P18 A;  5GN8 A;  2CN7 A;  3HL1 A;  4CVR A;  2FL0 A;  5J93 A;  4ZLW A;  2FG8 A;  5FFD A;  2UX1 A;  3R2R A;  3AF7 X;  4LYU A;  2OKC A;  2G4H A;  2W0O A;  2ZG8 X;  2D5K A;  2XJM A;  1J30 A;  3E6S A;  3WVV A;  4CVS A;  1O9I A;  3BVF A;  2Z6M A;  2FFX J;  2QF9 A;  2CHI A;  1LKP A;  2VXX A;  3NP0 X;  4TOD A;  4RC5 B;  4IWK A;  4LPM A;  2BK6 A;  5C6F A;  4W4K B;  3PW8 C;  1L8I A;  1DPS A;  4Z5S A;  2CEI A;  4XKT A;  5LS9 A;  5K53 A;  4MJY A;  4RC5 A;  1GWG A;  3SE1 A;  2FG4 A;  1JIG A;  3O7R A;  4LPN A;  4ZKH A;  1NFV A;  4YXJ A;  2CF7 A;  3ISF A;  3L0M A;  3QD8 A;  4PGI A;  1BCF A;  2BW1 A;  3BVI A;  4OYN A;  2GS4 A;  3QZ3 A;  5JDO B;  1OTK A;  5D8R A;  1S2Z A;  5E2D A;  5CMR A;  3PWQ C;  4TOC A;  2F7N A;  2YW6 A;  3T9J A;  2WWX B;  3E2C A;  1NF6 A;  3NP2 X;  4IXK A;  4CYA A;  1IES A;  4ZL6 A;  2CLU A;  4DZ0 A;  3C23 A;  1RCE A;  4LQV A;  2ZA7 A;  1YUZ A;  3VV9 A;  4WJG 4;  4TW3 A;  4W4L B;  3QHC A;  2JD6 0;  5JKM A;  3IS7 A;  3FRS A;  5JAC A;  1RYT A;  2JD8 0;  5FFA A;  3GE4 A;  3PW1 B;  1AEW A;  1XZ3 A;  3H7G A;  1VEQ A;  4Z3B A;  2IB0 A;  1TJO A;  1LB3 A;  5J8W A;  2Y44 A;  1JRE A;  4PG0 A;  2V2J A;  1UMN A;  3PVY B;  4LQH A;  4TOF A;  5GU1 X;  3SH6 A;  3RE7 A;  3PZA A;  2C41 A;  3JZA B;  1S3Q A;  3OJ5 A;  3FSE A;  2Z90 A;  3RAV A;  4YXM A;  1EUM A;  2FHA A;  1TKP A;  4AM4 A;  4EVC A;  2XJN A;  4E6K A;  4REU A;  5E1U A;  2FJC A;  2CIH A;  5HJF A;  3W54 A;  4AM2 A;  2OC5 A;  1MFR A;  4CMY A;  4DAS A;  5LG8 A;  5ERJ A;  3AJO A;  2FKZ A;  2HTN A;  1MOJ A;  3KX9 A;  3FVB A;  3QHB A;  2X17 0;  5J8S A;  2VXI A;  4U3G A;  4II4 B;  2IU2 A;  1S30 A;  2V2S A;  4Y08 A;  4CYB A;  2WLU A;  3BT5 A;  4MN9 A;  4CMY V;  4TOE A;  3A68 A;  3R2L A;  3PWQ A;  4II4 A;  3EGM A;  3FRR A;  2ZG7 X;  3F33 A;  4RC8 A;  2V2O A;  2G38 B;  4KVS A;  1QGH A;  2OH3 A;  2V2L A;  2GYQ A;  3E1P A;  5GOU A;  5GU3 X;  2JD7 0;  3Q4Q A;  3E1J A;  1ZUJ A;  3Q4R A;  4RC7 B;  1JYB A;  3KHK A;  3KA4 A;  2V2P A;  1Z4A A;  3F37 A;  3TA8 A;  3E1L A;  1O9R A;  5D8Y A;  3GVY A;  4ITT A;  3JZ9 A;  2BKC A;  3R2H A;  4YVZ A;  4MXP A;  3RGD A;  1VEI A;  1RCD A;  1RCG A;  4ISM A;  5GU0 X;  4ISP A;  3R2S A;  3N6O A;  4M35 A;  3WVW A;  5JKL G;  3F39 A;  1Z6O A;  2C2F A;  3M6J A;  5JDO A;  1RCI A;  3LKD A;  4ERU A;  3F32 A;  5D8X A;  5HQO A;  1DVB A;  2ZA6 A;  2BJY A;  3C21 A;  1DAT A;  2ZUR X;  1HRS A;  4MUD A;  2ZA8 A;  1QYB A;  3VNX A;  4EVB A;  1R03 A;  1VJX A;  3O7S A;  5GU2 X;  3ISE A;  4DYX A;  4MY7 A;  3WNW A;  3PW1 A;  1FHA A;  2V2I A;  3E1O A;  2XGW A;  1TK6 A;  4R42 A;  3E6R A;  3KA9 A;  3PVY A;  3GHQ A;  5LBH A;  1YUX A;  3R2K A;  5LG2 A;  3RD0 A;  1F30 A;  3GGY A;  1JGC A;  3E1Q A;  4PG1 A;  3ES3 A;  2CN6 A;  2N02 A;  3AJQ A;  3KA6 A;  5D8P A;  3AK8 A;  3QB9 A;  1BFR A;  1VEL A;  4TOH A;  3BKN A;  3A9Q A;  4DE6 A;  3ERZ A;  5JKM G;  3Q4O A;  4M32 A;  3PVT B;  2WTL A;  3KA8 A;  1F33 A;  2RBD A;  4ZTT A;  1Z6O M;  3R2M A;  5HJH A;  2CWL A;  2VZB A;  5GN8 B;  2XKQ A;  3SHX A;  4RC6 B;  3IQ1 A;  3F35 A;  5ERK A;  3U90 A;  1L8H A;  3BVL A;  4CVP A;  4ZKW A;  4RC6 A;  3UOI A;  2HR5 A;  2QQY A;  5JKL A;  3MPS A;  1LKO A;  2C6R A;  2CLB A;  4XKS A;  4DYU A;  3E1N A;  4XKU A;  4E40 A;  3Q4N A;  1NNQ A;  1H96 A;  5CZU A;  4TOA A;  3F38 A;  3SID A;  1UVH A;  5FEJ A;  4RC7 A;  4LQN A;  2V8U A;  4ITW A;  4MKU A;  2Z5R A;  4PGK A;  2XJO A;  1JI5 A;  3KA3 A;  4ZKX A;  4KVQ A;  5D8S A;  2FZF A;  3HIU A;  5IX6 A;  1JKV A;  3KDQ A;  1XZ1 A;  2V2R A;  2YW7 A;  3OGH A;  5HU6 D;  4TOB A;  1YV1 A;  4ZJK A;  1N1Q A;  4LQJ A;  3BVK A;  2C2J A;  2CHP A;  4A25 A;  4M33 A;  4M34 A;  3F34 A;  1JI4 A;  1IER A;  2C2U A;  2IY4 A;  3AF9 X;  4ML5 A;  5K52 A;  3KWO A;  3PVR B;  3GGZ A;  2WLA A;  3IS8 A;  4TOG A;  3C1Y A;  5FFC A;  4DYZ A;  1KRQ A;  1BG7 A;  1TKO A;  2Y3Q A;  4CVT A;  1B71 A;  3R2O A;  4ZMC A;  3PVR A;  2YJJ A;  1SQ3 A;  4ETR A;  5D8O A;  4QUW A;  4CY9 A;  3BVE A;  5AXS A;  4EVD A;  3E1M A;  1LKM A;  3NOZ X;  3V3K B;  3PWF A;  4TO9 A;  3QVD A;  4DYY A; 
#chains in the Genus database with same CATH homology
 2V8T A;  3D19 A;  4LYX A;  1JTS A;  4IWJ A;  4LPJ A;  3VVA A;  3KXU A;  3EZ0 A;  3FI6 A;  2V2N A;  1VLG A;  4XGS A;  3UFB A;  4KVR A;  2PYB A;  3AF8 X;  1ZS3 A;  5FFB A;  3WVU A;  2V15 A;  3EZU A;  4DI0 A;  5FFE A;  2V2M A;  5D8Q A;  2YJK A;  3F36 A;  2GYD A;  2MGY A;  4EVE A;  5I4J A;  4X0J A;  5J9V A;  1SOF A;  3UOF A;  2Z5P A;  5CMQ A;  3AJP A;  2ITB A;  3AK9 A;  1JKU A;  3PW8 A;  3RBC A;  4AM5 A;  3PVT A;  3UNO A;  2AR0 A;  1NF4 A;  1RCC A;  4YKH A;  3C1Z A;  4KXR B;  4ZL5 A;  2Z5Q A;  3DBY A;  2ZG9 X;  4P18 A;  5GN8 A;  2CN7 A;  3HL1 A;  4CVR A;  2FL0 A;  5J93 A;  4ZLW A;  2FG8 A;  5FFD A;  2UX1 A;  3R2R A;  3AF7 X;  4LYU A;  2OKC A;  2G4H A;  2W0O A;  2ZG8 X;  2D5K A;  2XJM A;  1J30 A;  3E6S A;  3WVV A;  4CVS A;  1O9I A;  3BVF A;  2Z6M A;  2FFX J;  2QF9 A;  2CHI A;  1LKP A;  2VXX A;  3NP0 X;  4TOD A;  4RC5 B;  4IWK A;  4LPM A;  2BK6 A;  5C6F A;  4W4K B;  3PW8 C;  1L8I A;  1DPS A;  4Z5S A;  2CEI A;  4XKT A;  5LS9 A;  5K53 A;  4MJY A;  4RC5 A;  1GWG A;  3SE1 A;  2FG4 A;  1JIG A;  3O7R A;  4LPN A;  4ZKH A;  1NFV A;  4YXJ A;  2CF7 A;  3ISF A;  3L0M A;  3QD8 A;  4PGI A;  1BCF A;  2BW1 A;  3BVI A;  4OYN A;  2GS4 A;  3QZ3 A;  5JDO B;  1OTK A;  5D8R A;  1S2Z A;  5E2D A;  5CMR A;  3PWQ C;  4TOC A;  2F7N A;  2YW6 A;  3T9J A;  2WWX B;  3E2C A;  1NF6 A;  3NP2 X;  4IXK A;  4CYA A;  1IES A;  4ZL6 A;  2CLU A;  4DZ0 A;  3C23 A;  1RCE A;  4LQV A;  2ZA7 A;  1YUZ A;  3VV9 A;  4WJG 4;  4TW3 A;  4W4L B;  3QHC A;  2JD6 0;  5JKM A;  3IS7 A;  3FRS A;  5JAC A;  1RYT A;  2JD8 0;  5FFA A;  3GE4 A;  3PW1 B;  1AEW A;  1XZ3 A;  3H7G A;  1VEQ A;  4Z3B A;  2IB0 A;  1TJO A;  1LB3 A;  5J8W A;  2Y44 A;  1JRE A;  4PG0 A;  2V2J A;  1UMN A;  3PVY B;  4LQH A;  4TOF A;  5GU1 X;  3SH6 A;  3RE7 A;  3PZA A;  2C41 A;  3JZA B;  1S3Q A;  3OJ5 A;  3FSE A;  2Z90 A;  3RAV A;  4YXM A;  1EUM A;  2FHA A;  1TKP A;  4AM4 A;  4EVC A;  2XJN A;  4E6K A;  4REU A;  5E1U A;  2FJC A;  2CIH A;  5HJF A;  3W54 A;  4AM2 A;  2OC5 A;  1MFR A;  4CMY A;  4DAS A;  5LG8 A;  5ERJ A;  3AJO A;  2FKZ A;  2HTN A;  1MOJ A;  3KX9 A;  3FVB A;  3QHB A;  2X17 0;  5J8S A;  2VXI A;  4U3G A;  4II4 B;  2IU2 A;  1S30 A;  2V2S A;  4Y08 A;  4CYB A;  2WLU A;  3BT5 A;  4MN9 A;  4CMY V;  4TOE A;  3A68 A;  3R2L A;  3PWQ A;  4II4 A;  3EGM A;  3FRR A;  2ZG7 X;  3F33 A;  4RC8 A;  2V2O A;  2G38 B;  4KVS A;  1QGH A;  2OH3 A;  2V2L A;  2GYQ A;  3E1P A;  5GOU A;  5GU3 X;  2JD7 0;  3Q4Q A;  3E1J A;  1ZUJ A;  3Q4R A;  4RC7 B;  1JYB A;  3KHK A;  3KA4 A;  2V2P A;  1Z4A A;  3F37 A;  3TA8 A;  3E1L A;  1O9R A;  5D8Y A;  3GVY A;  4ITT A;  3JZ9 A;  2BKC A;  3R2H A;  4YVZ A;  4MXP A;  3RGD A;  1VEI A;  1RCD A;  1RCG A;  4ISM A;  5GU0 X;  4ISP A;  3R2S A;  3N6O A;  4M35 A;  3WVW A;  5JKL G;  3F39 A;  1Z6O A;  2C2F A;  3M6J A;  5JDO A;  1RCI A;  3LKD A;  4ERU A;  3F32 A;  5D8X A;  5HQO A;  1DVB A;  2ZA6 A;  2BJY A;  3C21 A;  1DAT A;  2ZUR X;  1HRS A;  4MUD A;  2ZA8 A;  1QYB A;  3VNX A;  4EVB A;  1R03 A;  1VJX A;  3O7S A;  5GU2 X;  3ISE A;  4DYX A;  4MY7 A;  3WNW A;  3PW1 A;  1FHA A;  2V2I A;  3E1O A;  2XGW A;  1TK6 A;  4R42 A;  3E6R A;  3KA9 A;  3PVY A;  3GHQ A;  5LBH A;  1YUX A;  3R2K A;  5LG2 A;  3RD0 A;  1F30 A;  3GGY A;  1JGC A;  3E1Q A;  4PG1 A;  3ES3 A;  2CN6 A;  2N02 A;  3AJQ A;  3KA6 A;  5D8P A;  3AK8 A;  3QB9 A;  1BFR A;  1VEL A;  4TOH A;  3BKN A;  3A9Q A;  4DE6 A;  3ERZ A;  5JKM G;  3Q4O A;  4M32 A;  3PVT B;  2WTL A;  3KA8 A;  1F33 A;  2RBD A;  4ZTT A;  1Z6O M;  3R2M A;  5HJH A;  2CWL A;  2VZB A;  5GN8 B;  2XKQ A;  3SHX A;  4RC6 B;  3IQ1 A;  3F35 A;  5ERK A;  3U90 A;  1L8H A;  3BVL A;  4CVP A;  4ZKW A;  4RC6 A;  3UOI A;  2HR5 A;  2QQY A;  5JKL A;  3MPS A;  1LKO A;  2C6R A;  2CLB A;  4XKS A;  4DYU A;  3E1N A;  4XKU A;  4E40 A;  3Q4N A;  1NNQ A;  1H96 A;  5CZU A;  4TOA A;  3F38 A;  3SID A;  1UVH A;  5FEJ A;  4RC7 A;  4LQN A;  2V8U A;  4ITW A;  4MKU A;  2Z5R A;  4PGK A;  2XJO A;  1JI5 A;  3KA3 A;  4ZKX A;  4KVQ A;  5D8S A;  2FZF A;  3HIU A;  5IX6 A;  1JKV A;  3KDQ A;  1XZ1 A;  2V2R A;  2YW7 A;  3OGH A;  5HU6 D;  4TOB A;  1YV1 A;  4ZJK A;  1N1Q A;  4LQJ A;  3BVK A;  2C2J A;  2CHP A;  4A25 A;  4M33 A;  4M34 A;  3F34 A;  1JI4 A;  1IER A;  2C2U A;  2IY4 A;  3AF9 X;  4ML5 A;  5K52 A;  3KWO A;  3PVR B;  3GGZ A;  2WLA A;  3IS8 A;  4TOG A;  3C1Y A;  5FFC A;  4DYZ A;  1KRQ A;  1BG7 A;  1TKO A;  2Y3Q A;  4CVT A;  1B71 A;  3R2O A;  4ZMC A;  3PVR A;  2YJJ A;  1SQ3 A;  4ETR A;  5D8O A;  4QUW A;  4CY9 A;  3BVE A;  5AXS A;  4EVD A;  3E1M A;  1LKM A;  3NOZ X;  3V3K B;  3PWF A;  4TO9 A;  3QVD A;  4DYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...