3QVDA

Exposure of rubrerythrin from pyrococcus furiosus to peroxide, fifteen second time point.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 62
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3qvdA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3qvdA02
5CZUA 3R2LA 4IWKA 5JKLG 1JGCA 1DATA 3PWQC 4LPJA 4ZKHA 4CVRA 3KYVA 4TODA 2IB0A 3BVIA 4ZLWA 7RXNA 5C6FA 1F33A 2Z5QA 3AK9A 3IS7A 1SMWA 1TK6A 2ZG9X 2JD60 4U3GA 5CMQA 3PVTB 4ZTTA 1Z6OM 2ZG7X 3RD0A 1SMMA 3SS2A 1TJOA 8RXNA 5E2DA 4CVTA 4EVCA 1L8HA 4RC5B 3SH6A 1JTSA 4LQVA 1VJXA 3T9JA 1CADA 2ZA6A 1R0IA 4RC6B 4MKUA 2D5KA 4ZL5A 2ZURX 4P18A 4RXNA 1SQ3A 5D8YA 3Q4RA 2RBDA 2Z5PA 3ISFA 1JKUA 2WLUA 3AJPA 3A68A 2PYBA 4ISPA 1DX8A 1MOJA 4E6KA 2BKCA 1TKPA 5JACA 5LG8A 4XKTA 5J8SA 1S2ZA 5HJHA 2M4YA 1FHAA 4ETRA 1XZ3A 4KVSA 4AR5A 3F37A 3PWFA 4DYXA 3KA4A 5AXSA 4TOFA 5GOUA 6RXNA 2V2JA 4CVSA 5IY0A 2ZG8X 2FJCA 1RCGA 1B13A 2GMGA 1IROA 4AM2A 4PGIA 5RXNA 3EGMA 3QHBA 3OJ5A 4DE6A 1YV1A 2VXXA 5D8QA 1SOFA 5LS9A 3IS8A 2V2MA 4DZ0A 3VNXA 2FZFA 2V3BB 1VCXA 2VXIA 1TKOA 3KYXA 1R03A 4CYAA 4M32A 4YWMA 1OTKA 3GHQA 1L8IA 3U90A 4TO9A 4AR4A 4KVRA 2WLAA 1Z6OA 1C09A 4LYXA 3F34A 4XKSA 5AI2A 2CN6A 4M34A 3Q4NA 2FHAA 2CLUA 2OH3A 3BKNA 3KA6A 1YK4A 2CN7A 1LKMA 3WNWA 5GU1X 1NF4A 3UNOA 3GVYA 4M33A 1B2OA 1H7VA 4RC6A 4ISMA 3SE1A 4CY9A 2C2FA 4KVQA 4AM5A 2QL0A 2VZBA 1O9RA 3FVBA 1RCEA 1JKVA 3PW1B 2GS4A 3WVUA 2XJNA 3KYUA 1BCFA 3BVFA 3ES3A 3F32A 1S30A 5D8RA 3A44A 2CF7A 3FI6A 4Z5SA 3BVKA 2BK6A 1NFVA 5FFDA 3AF8X 4DYUA 1VEIA 2W0OA 3R2KA 5FFCA 3KXUA 5D8XA 2V2RA 2C6RA 4TOAA 4A25A 1E8JA 3UOFA 4YKHA 3EZUA 1BQ8A 4ZKXA 3R2HA 5HQOA 5ERJA 4TOCA 1N1QA 1LKOA 1BG7A 1R0FA 3F36A 1AEWA 2XJOA 1BFRA 1RYTA 5FEJA 3KWOA 2V2IA 1QYBA 3E1LA 4TOBA 2CLBA 2C2JA 1B71A 5GU3X 3PVYA 5ERKA 4II4B 2V15A 5D8SA 4EVDA 3KA9A 4ZMCA 4PGKA 4AR3A 4MN9A 2KKDA 5K52A 2LCQA 2C41A 2BW1A 4TW3A 2WTLA 1ZS3A 3KYWA 3E1JA 1SMUA 2ZA7A 3KA3A 3PVRB 5D8OA 1H96A 2IU2A 4MY7A 1F30A 4K9FA 3SIDA 1J30A 1BFYA 3IQ1A 3RAVA 2Z6MA 3O7SA 3BT5A 3EZ0A 1Z4AA 3AF7X 2FKZA 3R2SA 4RC7A 3RZTA 3E1OA 3PW1A 4CMYV 4POFA 2ITBA 3E1PA 3RZ6A 1RDVA 3AF9X 4POGA 2V2SA 4RC8A 3PVYB 1VELA 2MS3A 3O7RA 3UOIA 1QGHA 4ME3A 1ZUJA 3E6RA 3NOZX 5CMRA 3BVLA 1BQ9A 1R0JA 3AJOA 2V2LA 4YWLA 3PW8C 4ML5A 2XGWA 2VL6A 2CEIA 3QZ3A 2KN9A 4Z3BA 5FFAA 1ZRPA 4CVPA 4R42A 1GWGA 1LB3A 2CHIA 2PVEA 2YW7A 4CYBA 4TOEA 4LPNA 3SHXA 3HL1A 4TOHA 2GYDA 3E1NA 4II4A 2Z5RA 2ZA8A 3NP0X 4IXKA 2FFXJ 2QQYA 1UMNA 1EUMA 4RC7B 1IRNA 4OYNA 3PW8A 4LYUA 2FG4A 4IWJA 4EVEA 2PVXA 3H7GA 4MJYA 4QUWA 1MFRA 4LPMA 5LBHA 3QD8A 1S3QA 2OC5A 1RDGA 1DPSA 1O9IA 3RGDA 3BVEA 2FG8A 1LKPA 3PVRA 3HIUA 2X170 5AI3A 1RCDA 3F35A 3KYYA 2UX1A 1S24A 4MUDA 4ERUA 2Z90A 3Q4OA 3KA8A 2HR5A 4PG0A 3E2CA 5K53A 3WVVA 1QCVA 4CMYA 4PG1A 4DASA 1JYBA 3OGHA 1R0GA 3ISEA 2C2UA 1B2JA 4AM4A 2G4HA 1VLGA 1YUXA 4LQJA 3QB9A 1JIGA 1RCIA 5D8PA 5FFEA 5JKLA 3PWQA 2CIHA 3ERZA 2YW6A 1JREA 4EVBA 3RYGA 4XKUA 4LQHA 4M35A 5GN8B 2YJKA 3WVWA 3R2MA 5GU2X 1R0HA 4AR6A 4ZJKA 1T9PA 2Y3QA 3AJQA 3F39A 5JKMG 3PZAA 2BJYA 1NF6A 4ZKWA 1IU5A 3R2OA 5J93A 3QVDA 1IU6A 5FFBA 5J9VA 1RWDA 2V2OA 2GYQA 3A9QA 1RCCA 4ITWA 4Y08A 1RB9A 2XJMA 5J8WA 3Q4QA 4ZL6A 3E1QA 1XZ1A 5I4JA 5GU0X 4DYYA 2F7NA 1HRSA 4ITTA 1T9QA 2IY4A 5JKMA 1NNQA 2K2DA 3RBCA 3F33A 2V2NA 4DI0A 2JD70 5E1UA 1T9OA 1YUZA 4REUA 5LG2A 2QF9A 2XKQA 3E6SA 2PYAA 4XGSA 1YK5A 4TOGA 3FSEA 1UVHA 5IX6A 1VEQA 3PVTA 2CHPA 3KX9A 1BE7A 2FL0A 2JD80 3GE4A 5HJFA 3AK8A 3NP2X 3RE7A 2RDVA 1FHHA 1IESA 3F38A 1LTLA 3MPSA 1IERA 1JI5A 3E1MA 2HTNA 4RC5A 2YJJA 1JI4A 2V2PA 2DSXA 4TPUA 5GN8A 1DVBA 4LQNA 1FHMA 1CAAA 1BRFA 1KRQA 3QHCA 4DYZA 3TA8A 3R2RA
chains in the Genus database with same CATH superfamily
5CZUA 3R2LA 3C21A 4XXBB 4IWKA 2AUSB 5JKLG 1JGCA 1DATA 3PWQC 4LPJA 4ZKHA 2Y0SP 4BY7L 4CVRA 3KYVA 4TODA 2IB0A 1PFYA 3BVIA 4ZLWA 7RXNA 5C6FA 1F33A 3LWPB 2Z5QA 3AK9A 3IS7A 1SMWA 1TK6A 3GGYA 2ZG9X 4A3CL 5JDOA 2JD60 2ZIXA 4U3GA 5CMQA 3PVTB 2M6PA 3LNLA 4ZTTA 1Z6OM 2ZG7X 3RD0A 1SMMA 3M4OL 3SS2A 1TJOA 1VZGA 8RXNA 2B5ID 5E2DA 4CVTA 1NXGA 3I4NL 4EVCA 1L8HA 4RC5B 3SH6A 1JTSA 1I6HL 4LQVA 1VJXA 3T9JA 1CADA 2ZA6A 1R0IA 3MSUA 4RC6B 4MKUA 5M5XL 2D5KA 1TWFL 3KHKA 4ZL5A 5EINC 4A3DL 2ZURX 2C6AA 4P18A 4RXNA 3JZAB 1SQ3A 5D8YA 3Q4RA 2RBDA 2Z5PA 3ISFA 2NVXL 4JADA 2JA6L 1JKUA 2WLUA 3AJPA 3H0GL 3A68A 2PYBA 4ISPA 3NFPI 1DX8A 4JAEA 1TWHL 1MOJA 4E6KA 2BKCA 1TKPA 3S2HL 5AN9H 2XJQA 5JACA 4C3HL 5LG8A 4XKTA 5J8SA 3GGZA 1S2ZA 5HJHA 2M4YA 1FHAA 4ETRA 1XZ3A 4KVSA 4AR5A 3F37A 3VVAA 3PWFA 4DYXA 3KA4A 5AXSA 4TOFA 5GOUA 3S2DL 6RXNA 2V2JA 4CVSA 5IY0A 2ZG8X 4ZN1B 2CR8A 2FJCA 3HOYL 5JVG1 1RCGA 1B13A 2GMGA 2JA8L 1IROA 4AM2A 4PGIA 5H1Sc 5RXNA 3EGMA 2V8TA 3QHBA 3OJ5A 4DE6A 3KDQA 1YV1A 2VXXA 5D8QA 1SOFA 5LS9A 3IS8A 2V2MA 4DZ0A 3VNXA 3HOUL 3PO2L 2PMZP 2FZFA 2V3BB 4Y7NL 5C4XL 1VCXA 3PKJA 2WWXB 1I50L 2B63L 2VXIA 1TKOA 2R92L 3KYXA 1R03A 4CYAA 3ZG6A 4M32A 2WB1P 4YWMA 1OTKA 4AI0A 3GHQA 1L8IA 3U90A 4TO9A 4AR4A 4KVRA 5GAHc 2WLAA 1Z6OA 1C09A 4LYXA 3F34A 4XKSA 5AI2A 5MF6A 2CN6A 4M34A 3Q4NA 2FHAA 2CLUA 2OH3A 3BKNA 3KA6A 1YK4A 2CN7A 3S17L 4JAFA 4A3KL 4C3IL 1LKMA 3WNWA 5GU1X 1NF4A 3UNOA 3GVYA 4M33A 1B2OA 1H7VA 4RC6A 4UY81 4Y52L 4ISMA 3SE1A 4CY9A 2C2FA 4A3LL 3FRSA 1PZXA 4KVQA 2A68D 4AM5A 2QL0A 2VZBA 2APOB 1O9RA 3FVBA 1RCEA 2A6ED 3VV9A 2XJTA 1JKVA 3PW1B 2GS4A 4W4LB 2XJNA 3WVUA 3KYUA 1BCFA 2E2HL 3BVFA 3ES3A 3F32A 1S30A 2G38B 5D8RA 3A44A 2CF7A 3FI6A 4Z5SA 3BVKA 2XJUA 2BK6A 1NFVA 5FFDA 4XGHA 5DM61 3AF8X 4DYUA 3C1YA 4JAGA 1VEIA 4WFN1 2W0OA 3R2KA 5M5WL 4YVZA 4WJG4 5FFCA 5EIOC 5GAEc 3KXUA 5D8XA 2V2RA 2C6RA 5DM71 2JI1A 3B08B 2AQCA 4BBSL 4TOAA 4A25A 2NVYL 1E8JA 3UFBA 1PFWA 3LKDA 3UOFA 4YKHA 3EZUA 2OKCA 1BQ8A 4ZKXA 3R2HA 5HQOA 5M5YL 5ERJA 4TOCA 1N1QA 1LKOA 1BG7A 1R0FA 3F36A 1AEWA 2XJOA 1BFRA 3FKIL 1RYTA 5IP7L 1QQTA 5FEJA 3KWOA 2V2IA 3RZOL 3S15L 1QYBA 3E1LA 4TOBA 2CLBA 2NVQL 2C2JA 1B71A 5GU3X 3PVYA 1PFVA 5ERKA 4II4B 2V0EA 2V15A 2H12A 5D8SA 4EVDA 3KA9A 4ZMCA 4PGKA 4B8CD 3GTLL 3K35A 5C44L 2C6BA 3P2AA 4A3JL 4AR3A 5IYCL 3S14L 4MN9A 2KKDA 3D19A 5K52A 2LCQA 2C41A 2BW1A 4TW3A 1VZHA 1VZIA 2WTLA 4KXRB 1ZS3A 3KYWA 5K2ME 3E1JA 1SMUA 4AYBP 4V196 2ZA7A 3KA3A 3PVRB 2AYJA 5D8OA 1H96A 2IU2A 4MY7A 4YXMA 1F30A 2XJVA 3SIDA 4K9FA 1J30A 1Z92B 5MGNA 3IQ1A 2JI3A 2M6OA 1BFYA 3RAVA 4C3JL 3LWQB 3HKZP 2Z6MA 3O7SA 2MGYA 3CQZL 3BT5A 4A3GL 3EZ0A 1Z4AA 3AF7X 1OWCA 4AI3A 2FKZA 3R2SA 4RC7A 1TWGL 2NVTL 3MQKB 3RZTA 3E1OA 3PW1A 4CMYV 1TWAL 4POFA 2ITBA 3E1PA 2CWLA 3RZ6A 1RDVA 2AR0A 3AF9X 1WJVA 4POGA 2V2SA 4RC8A 3K7AL 3PVYB 2CKCA 1VELA 3LWVB 2MS3A 4C2M1 3O7RA 4G6BA 3UOIA 5MLC3 2WAQP 1QGHA 2JI2A 2PPTA 4ME3A 1ZUJA 3E6RA 2E2JL 3NOZX 5CMRA 4AHWA 3BVLA 1BQ9A 1NXEA 2CKAA 1R0JA 3AJOA 2V2LA 4YWLA 2N02A 3PW8C 3FRRA 5C3EL 4ML5A 2XGWA 2VL6A 2CEIA 3HAXC 2HVYC 3QZ3A 2KN9A 4Z3BA 5FFAA 1ZRPA 3WWLA 4CVPA 4E6YA 2ERSA 4R42A 4BY1L 1GWGA 1LB3A 2CHIA 3W54A 2PVEA 2YW7A 4CYBA 4TOEA 3J7Z1 3H99A 4LPNA 3SHXA 4A3FL 3HL1A 4TOHA 4QIWP 2GYDA 3PL5A 3E1NA 3N6OA 4II4A 2Z5RA 3H9CA 2ZA8A 3NP0X 4IXKA 2FFXJ 2JA7L 2QQYA 1F4LA 1UMNA 1EUMA 4RC7B 1IRNA 3PKIA 4OYNA 2E2IL 3PW8A 4LYUA 2FG4A 4IWJA 4EVEA 2PVXA 3H9BA 3QQCE 3H7GA 4MJYA 4BBRL 3HJWB 4QUWA 1MFRA 4BXXL 4AI1A 2Z3RB 4LPMA 5LBHA 3QD8A 1S3QA 2OC5A 1WCML 3HOVL 1RDGA 1DPSA 1O9IA 3M3YL 3RGDA 2V8UA 3BVEA 2FG8A 1LKPA 3H97A 3PVRA 2A6HD 3HIUA 3L0MA 2JA5L 2X170 5AI3A 1TWCL 1RCDA 3C1ZA 4AI2A 1RYQA 3F35A 3KYYA 1Y1VL 3H3VM 3S1QL 2UX1A 1S24A 3LWOB 4MUDA 1K83L 1PFUA 4ERUA 3I4ML 2Z90A 3RZDL 3Q4OA 5C4JL 2J9UB 3KA8A 2HR5A 4PG0A 3E2CA 5K53A 5JVH1 3WVVA 1QCVA 2VUML 4CMYA 4PG1A 4DASA 1JYBA 4AHYA 3OGHA 1R0GA 5GADc 4ZN3B 3GTGL 4A3BL 3ISEA 3VPBE 2C2UA 3GTOL 3WWNB 1B2JA 4AM4A 2G4HA 1VLGA 3DBYA 1YUXA 4LQJA 3QB9A 1JIGA 1RCIA 5D8PA 5FFEA 5JKLA 3PWQA 3PIO1 3LPEB 2M4VA 3GTML 3HJYB 2CIHA 4E40A 4MXPA 4X6AL 3ERZA 2YW6A 1JREA 4EVBA 1IW7D 2Y44A 4LHLA 5HU6D 3RYGA 3JZ9A 4XKUA 4LQHA 4M35A 5GN8B 4AHZA 5FJ8L 2YU9L 2YJKA 1SFOL 3WVWA 3JR7A 4A93L 4AHXA 3R2MA 5GU2X 1R0HA 3B0AB 4ZJKA 1T9PA 2Y3QA 3P8BA 4GS7D 3AJQA 3F39A 4AR6A 5JKMG 4X0JA 3PZAA 2BJYA 2XJSA 1NF6A 4ZKWA 4A3ML 1IU5A 3R2OA 3IU3I 5J93A 2EY4E 3QVDA 1IU6A 5FFBA 5J9VA 1RWDA 3PIP1 2V2OA 2GYQA 3A9QA 1RCCA 4ITWA 3LWRB 4Y08A 1RB9A 5GAGc 2XJMA 5JDOB 5J8WA 2BE5D 2V0FA 5IYBL 3Q4QA 4ZL6A 3E1QA 5IYDL 1XZ1A 5I4JA 5GU0X 4DYYA 3S16L 3S1ML 2F7NA 5MFPA 1HRSA 4ITTA 1T9QA 3J7Y1 2IY4A 5JKMA 4LHNA 1NNQA 2K2DA 3C23A 3GTQL 2R93L 3RBCA 2ERJA 3F33A 2V2NA 4A3EL 4DI0A 3GTJL 2JD70 5E1UA 1T9OA 1YUZA 4REUA 2NYDA 5IP9L 2A69D 5LG2A 2QF9A 1I3QL 2XKQA 3E6SA 2PYAA 4XGSA 1R9TL 1ODHA 1YK5A 2O5JD 3S1RL 5FLML 4TOGA 2XJPA 3FSEA 3V3KB 2RFKB 1UVHA 5IX6A 1VEQA 3PVTA 2CHPA 3KX9A 1BE7A 2FL0A 2JD80 3GE4A 5HJFA 3HOWL 3M6JA 3AK8A 3NP2X 3RE7A 2RDVA 1FHHA 1IESA 3F38A 3GTPL 1LTLA 3MPSA 4TVMA 1IERA 2L0ZA 2PSMC 1JI5A 3E1MA 2HTNA 4RC5A 3HOZL 2YJJA 1JI4A 4A3IL 2V2PA 2DSXA 5MFZA 5M3FL 3PO3L 3GTKL 4U671 4YXJA 1Y1WL 3HOXL 4TPUA 2R7ZL 3S1NL 5GN8A 2XJRA 1P7PA 1OWBA 1DVBA 4LQNA 3FDJA 1FHMA 1CAAA 5M3ML 1BRFA 4W4KB 1KRQA 2Z3QB 3QHCA 4DYZA 3TA8A 3R2RA
chains in the Genus database with same CATH topology
5CZUA 3R2LA 3C21A 4XXBB 4IWKA 5JKLG 1JGCA 1DATA 3PWQC 4LPJA 4ZKHA 4CVRA 3KYVA 4TODA 2IB0A 3BVIA 4ZLWA 7RXNA 5C6FA 1F33A 2Z5QA 3AK9A 3IS7A 1SMWA 1TK6A 3GGYA 2ZG9X 5JDOA 2JD60 2ZIXA 4U3GA 5CMQA 3PVTB 2M6PA 3LNLA 4ZTTA 1Z6OM 2ZG7X 3RD0A 1SMMA 3SS2A 1TJOA 1VZGA 8RXNA 2B5ID 5E2DA 4CVTA 1NXGA 4EVCA 1L8HA 4RC5B 3SH6A 1JTSA 4LQVA 1VJXA 3T9JA 1CADA 2ZA6A 1R0IA 3MSUA 4RC6B 4MKUA 2D5KA 3KHKA 4ZL5A 5EINC 2ZURX 2C6AA 4P18A 4RXNA 3JZAB 1SQ3A 5D8YA 3Q4RA 2RBDA 2Z5PA 3ISFA 4JADA 1JKUA 2WLUA 3AJPA 3A68A 2PYBA 4ISPA 3NFPI 1DX8A 4JAEA 1MOJA 4E6KA 2BKCA 1TKPA 5AN9H 2XJQA 5JACA 5LG8A 4XKTA 5J8SA 3GGZA 1S2ZA 5HJHA 2M4YA 1FHAA 4ETRA 1XZ3A 4KVSA 4AR5A 3F37A 3VVAA 3PWFA 4DYXA 3KA4A 5AXSA 4TOFA 5GOUA 6RXNA 2V2JA 4CVSA 5IY0A 2ZG8X 4ZN1B 2CR8A 2FJCA 5JVG1 1RCGA 1B13A 2GMGA 1IROA 4AM2A 4PGIA 5H1Sc 5RXNA 3EGMA 2V8TA 3QHBA 3OJ5A 4DE6A 3KDQA 1YV1A 2VXXA 5D8QA 1SOFA 5LS9A 3IS8A 2V2MA 4DZ0A 3VNXA 2FZFA 2V3BB 1VCXA 3PKJA 2WWXB 2VXIA 1TKOA 3KYXA 1R03A 4CYAA 3ZG6A 4M32A 4YWMA 1OTKA 4AI0A 3GHQA 1L8IA 3U90A 4TO9A 4AR4A 4KVRA 5GAHc 2WLAA 1Z6OA 1C09A 4LYXA 3F34A 4XKSA 5AI2A 5MF6A 2CN6A 4M34A 3Q4NA 2FHAA 2CLUA 2OH3A 3BKNA 3KA6A 1YK4A 2CN7A 4JAFA 1LKMA 3WNWA 5GU1X 1NF4A 3UNOA 3GVYA 4M33A 1B2OA 1H7VA 4RC6A 4UY81 4ISMA 3SE1A 4CY9A 2C2FA 3FRSA 4KVQA 2A68D 4AM5A 2QL0A 2VZBA 2A6ED 1O9RA 3FVBA 1RCEA 2XJTA 3VV9A 1JKVA 3PW1B 2GS4A 4W4LB 2XJNA 3WVUA 3KYUA 1BCFA 3BVFA 3ES3A 3F32A 1S30A 2G38B 5D8RA 3A44A 2CF7A 3FI6A 4Z5SA 3BVKA 2XJUA 2BK6A 1NFVA 5FFDA 4XGHA 5DM61 3AF8X 4DYUA 3C1YA 4JAGA 1VEIA 4WFN1 2W0OA 3R2KA 4YVZA 4WJG4 5FFCA 5EIOC 5GAEc 3KXUA 5D8XA 2V2RA 2C6RA 5DM71 2JI1A 3B08B 4TOAA 4A25A 1E8JA 3UFBA 3LKDA 3UOFA 4YKHA 3EZUA 2OKCA 1BQ8A 4ZKXA 3R2HA 5HQOA 5ERJA 4TOCA 1N1QA 1LKOA 1BG7A 1R0FA 3F36A 1AEWA 2XJOA 1BFRA 1RYTA 5FEJA 3KWOA 2V2IA 1QYBA 3E1LA 4TOBA 2CLBA 2C2JA 1B71A 5GU3X 3PVYA 5ERKA 4II4B 2V0EA 2V15A 2H12A 5D8SA 4EVDA 3KA9A 4ZMCA 4PGKA 4B8CD 3K35A 2C6BA 3P2AA 4AR3A 4MN9A 2KKDA 3D19A 5K52A 2LCQA 2C41A 2BW1A 4TW3A 1VZHA 1VZIA 2WTLA 4KXRB 1ZS3A 3KYWA 5K2ME 3E1JA 1SMUA 4V196 2ZA7A 3KA3A 3PVRB 2AYJA 5D8OA 1H96A 2IU2A 4MY7A 4YXMA 1F30A 2XJVA 3SIDA 4K9FA 1J30A 1Z92B 5MGNA 3IQ1A 2JI3A 2M6OA 1BFYA 3RAVA 2Z6MA 3O7SA 2MGYA 3BT5A 3EZ0A 1Z4AA 3AF7X 1OWCA 4AI3A 2FKZA 3R2SA 4RC7A 3RZTA 3E1OA 3PW1A 4CMYV 4POFA 2ITBA 3E1PA 2CWLA 3RZ6A 1RDVA 2AR0A 3AF9X 1WJVA 4POGA 2V2SA 4RC8A 3PVYB 2CKCA 1VELA 2MS3A 3O7RA 4G6BA 3UOIA 5MLC3 1QGHA 2JI2A 2PPTA 4ME3A 1ZUJA 3E6RA 3NOZX 5CMRA 4AHWA 3BVLA 1BQ9A 1NXEA 2CKAA 1R0JA 3AJOA 2V2LA 4YWLA 2N02A 3PW8C 3FRRA 4ML5A 2XGWA 2VL6A 2CEIA 3QZ3A 2KN9A 4Z3BA 5FFAA 1ZRPA 3WWLA 4CVPA 4E6YA 2ERSA 4R42A 1GWGA 1LB3A 2CHIA 3W54A 2PVEA 2YW7A 4CYBA 4TOEA 3J7Z1 4LPNA 3SHXA 3HL1A 4TOHA 2GYDA 3E1NA 3N6OA 4II4A 2Z5RA 2ZA8A 3NP0X 4IXKA 2FFXJ 2QQYA 1UMNA 1EUMA 4RC7B 1IRNA 3PKIA 4OYNA 3PW8A 4LYUA 2FG4A 4IWJA 4EVEA 2PVXA 3QQCE 3H7GA 4MJYA 4QUWA 1MFRA 4AI1A 2Z3RB 4LPMA 5LBHA 3QD8A 1S3QA 2OC5A 1RDGA 1DPSA 1O9IA 3RGDA 2V8UA 3BVEA 2FG8A 1LKPA 3PVRA 2A6HD 3HIUA 3L0MA 2X170 5AI3A 1RCDA 3C1ZA 4AI2A 1RYQA 3F35A 3KYYA 2UX1A 1S24A 4MUDA 4ERUA 2Z90A 3Q4OA 2J9UB 3KA8A 2HR5A 4PG0A 3E2CA 5K53A 5JVH1 3WVVA 1QCVA 4CMYA 4PG1A 4DASA 1JYBA 4AHYA 3OGHA 1R0GA 5GADc 4ZN3B 3ISEA 3VPBE 2C2UA 3WWNB 1B2JA 4AM4A 2G4HA 1VLGA 3DBYA 1YUXA 4LQJA 3QB9A 1JIGA 1RCIA 5D8PA 5FFEA 5JKLA 3PWQA 3PIO1 3LPEB 2M4VA 2CIHA 4E40A 4MXPA 3ERZA 2YW6A 1JREA 4EVBA 1IW7D 2Y44A 4LHLA 5HU6D 3RYGA 3JZ9A 4XKUA 4LQHA 4M35A 5GN8B 4AHZA 2YJKA 3WVWA 4AHXA 3R2MA 5GU2X 1R0HA 3B0AB 4ZJKA 1T9PA 2Y3QA 3P8BA 4GS7D 3AJQA 3F39A 4AR6A 5JKMG 4X0JA 3PZAA 2BJYA 2XJSA 1NF6A 4ZKWA 1IU5A 3R2OA 3IU3I 5J93A 3QVDA 1IU6A 5FFBA 5J9VA 1RWDA 3PIP1 2V2OA 2GYQA 3A9QA 1RCCA 4ITWA 4Y08A 1RB9A 5GAGc 2XJMA 5JDOB 5J8WA 2BE5D 2V0FA 3Q4QA 4ZL6A 3E1QA 1XZ1A 5I4JA 5GU0X 4DYYA 2F7NA 5MFPA 1HRSA 4ITTA 1T9QA 3J7Y1 2IY4A 5JKMA 4LHNA 1NNQA 2K2DA 3C23A 3RBCA 2ERJA 3F33A 2V2NA 4DI0A 2JD70 5E1UA 1T9OA 1YUZA 4REUA 2NYDA 2A69D 5LG2A 2QF9A 2XKQA 3E6SA 2PYAA 4XGSA 1ODHA 1YK5A 2O5JD 4TOGA 2XJPA 3FSEA 3V3KB 1UVHA 5IX6A 1VEQA 3PVTA 2CHPA 3KX9A 1BE7A 2FL0A 2JD80 3GE4A 5HJFA 3M6JA 3AK8A 3NP2X 3RE7A 2RDVA 1FHHA 1IESA 3F38A 1LTLA 3MPSA 4TVMA 1IERA 2L0ZA 2PSMC 1JI5A 3E1MA 2HTNA 4RC5A 2YJJA 1JI4A 2V2PA 2DSXA 5MFZA 4U671 4YXJA 4TPUA 5GN8A 2XJRA 1OWBA 1DVBA 4LQNA 1FHMA 1CAAA 1BRFA 4W4KB 1KRQA 2Z3QB 3QHCA 4DYZA 3TA8A 3R2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CZU A;  3R2L A;  4IWK A;  5JKL G;  1JGC A;  1DAT A;  3PWQ C;  4LPJ A;  4ZKH A;  4CVR A;  3KYV A;  4TOD A;  2IB0 A;  3BVI A;  4ZLW A;  7RXN A;  5C6F A;  1F33 A;  2Z5Q A;  3AK9 A;  3IS7 A;  1SMW A;  1TK6 A;  2ZG9 X;  2JD6 0;  4U3G A;  5CMQ A;  3PVT B;  4ZTT A;  1Z6O M;  2ZG7 X;  3RD0 A;  1SMM A;  3SS2 A;  1TJO A;  8RXN A;  5E2D A;  4CVT A;  4EVC A;  1L8H A;  4RC5 B;  3SH6 A;  1JTS A;  4LQV A;  1VJX A;  3T9J A;  1CAD A;  2ZA6 A;  1R0I A;  4RC6 B;  4MKU A;  2D5K A;  4ZL5 A;  2ZUR X;  4P18 A;  4RXN A;  1SQ3 A;  5D8Y A;  3Q4R A;  2RBD A;  2Z5P A;  3ISF A;  1JKU A;  2WLU A;  3AJP A;  3A68 A;  2PYB A;  4ISP A;  1DX8 A;  1MOJ A;  4E6K A;  2BKC A;  1TKP A;  5JAC A;  5LG8 A;  4XKT A;  5J8S A;  1S2Z A;  5HJH A;  2M4Y A;  1FHA A;  4ETR A;  1XZ3 A;  4KVS A;  4AR5 A;  3F37 A;  3PWF A;  4DYX A;  3KA4 A;  5AXS A;  4TOF A;  5GOU A;  6RXN A;  2V2J A;  4CVS A;  5IY0 A;  2ZG8 X;  2FJC A;  1RCG A;  1B13 A;  2GMG A;  1IRO A;  4AM2 A;  4PGI A;  5RXN A;  3EGM A;  3QHB A;  3OJ5 A;  4DE6 A;  1YV1 A;  2VXX A;  5D8Q A;  1SOF A;  5LS9 A;  3IS8 A;  2V2M A;  4DZ0 A;  3VNX A;  2FZF A;  2V3B B;  1VCX A;  2VXI A;  1TKO A;  3KYX A;  1R03 A;  4CYA A;  4M32 A;  4YWM A;  1OTK A;  3GHQ A;  1L8I A;  3U90 A;  4TO9 A;  4AR4 A;  4KVR A;  2WLA A;  1Z6O A;  1C09 A;  4LYX A;  3F34 A;  4XKS A;  5AI2 A;  2CN6 A;  4M34 A;  3Q4N A;  2FHA A;  2CLU A;  2OH3 A;  3BKN A;  3KA6 A;  1YK4 A;  2CN7 A;  1LKM A;  3WNW A;  5GU1 X;  1NF4 A;  3UNO A;  3GVY A;  4M33 A;  1B2O A;  1H7V A;  4RC6 A;  4ISM A;  3SE1 A;  4CY9 A;  2C2F A;  4KVQ A;  4AM5 A;  2QL0 A;  2VZB A;  1O9R A;  3FVB A;  1RCE A;  1JKV A;  3PW1 B;  2GS4 A;  3WVU A;  2XJN A;  3KYU A;  1BCF A;  3BVF A;  3ES3 A;  3F32 A;  1S30 A;  5D8R A;  3A44 A;  2CF7 A;  3FI6 A;  4Z5S A;  3BVK A;  2BK6 A;  1NFV A;  5FFD A;  3AF8 X;  4DYU A;  1VEI A;  2W0O A;  3R2K A;  5FFC A;  3KXU A;  5D8X A;  2V2R A;  2C6R A;  4TOA A;  4A25 A;  1E8J A;  3UOF A;  4YKH A;  3EZU A;  1BQ8 A;  4ZKX A;  3R2H A;  5HQO A;  5ERJ A;  4TOC A;  1N1Q A;  1LKO A;  1BG7 A;  1R0F A;  3F36 A;  1AEW A;  2XJO A;  1BFR A;  1RYT A;  5FEJ A;  3KWO A;  2V2I A;  1QYB A;  3E1L A;  4TOB A;  2CLB A;  2C2J A;  1B71 A;  5GU3 X;  3PVY A;  5ERK A;  4II4 B;  2V15 A;  5D8S A;  4EVD A;  3KA9 A;  4ZMC A;  4PGK A;  4AR3 A;  4MN9 A;  2KKD A;  5K52 A;  2LCQ A;  2C41 A;  2BW1 A;  4TW3 A;  2WTL A;  1ZS3 A;  3KYW A;  3E1J A;  1SMU A;  2ZA7 A;  3KA3 A;  3PVR B;  5D8O A;  1H96 A;  2IU2 A;  4MY7 A;  1F30 A;  4K9F A;  3SID A;  1J30 A;  1BFY A;  3IQ1 A;  3RAV A;  2Z6M A;  3O7S A;  3BT5 A;  3EZ0 A;  1Z4A A;  3AF7 X;  2FKZ A;  3R2S A;  4RC7 A;  3RZT A;  3E1O A;  3PW1 A;  4CMY V;  4POF A;  2ITB A;  3E1P A;  3RZ6 A;  1RDV A;  3AF9 X;  4POG A;  2V2S A;  4RC8 A;  3PVY B;  1VEL A;  2MS3 A;  3O7R A;  3UOI A;  1QGH A;  4ME3 A;  1ZUJ A;  3E6R A;  3NOZ X;  5CMR A;  3BVL A;  1BQ9 A;  1R0J A;  3AJO A;  2V2L A;  4YWL A;  3PW8 C;  4ML5 A;  2XGW A;  2VL6 A;  2CEI A;  3QZ3 A;  2KN9 A;  4Z3B A;  5FFA A;  1ZRP A;  4CVP A;  4R42 A;  1GWG A;  1LB3 A;  2CHI A;  2PVE A;  2YW7 A;  4CYB A;  4TOE A;  4LPN A;  3SHX A;  3HL1 A;  4TOH A;  2GYD A;  3E1N A;  4II4 A;  2Z5R A;  2ZA8 A;  3NP0 X;  4IXK A;  2FFX J;  2QQY A;  1UMN A;  1EUM A;  4RC7 B;  1IRN A;  4OYN A;  3PW8 A;  4LYU A;  2FG4 A;  4IWJ A;  4EVE A;  2PVX A;  3H7G A;  4MJY A;  4QUW A;  1MFR A;  4LPM A;  5LBH A;  3QD8 A;  1S3Q A;  2OC5 A;  1RDG A;  1DPS A;  1O9I A;  3RGD A;  3BVE A;  2FG8 A;  1LKP A;  3PVR A;  3HIU A;  2X17 0;  5AI3 A;  1RCD A;  3F35 A;  3KYY A;  2UX1 A;  1S24 A;  4MUD A;  4ERU A;  2Z90 A;  3Q4O A;  3KA8 A;  2HR5 A;  4PG0 A;  3E2C A;  5K53 A;  3WVV A;  1QCV A;  4CMY A;  4PG1 A;  4DAS A;  1JYB A;  3OGH A;  1R0G A;  3ISE A;  2C2U A;  1B2J A;  4AM4 A;  2G4H A;  1VLG A;  1YUX A;  4LQJ A;  3QB9 A;  1JIG A;  1RCI A;  5D8P A;  5FFE A;  5JKL A;  3PWQ A;  2CIH A;  3ERZ A;  2YW6 A;  1JRE A;  4EVB A;  3RYG A;  4XKU A;  4LQH A;  4M35 A;  5GN8 B;  2YJK A;  3WVW A;  3R2M A;  5GU2 X;  1R0H A;  4AR6 A;  4ZJK A;  1T9P A;  2Y3Q A;  3AJQ A;  3F39 A;  5JKM G;  3PZA A;  2BJY A;  1NF6 A;  4ZKW A;  1IU5 A;  3R2O A;  5J93 A;  3QVD A;  1IU6 A;  5FFB A;  5J9V A;  1RWD A;  2V2O A;  2GYQ A;  3A9Q A;  1RCC A;  4ITW A;  4Y08 A;  1RB9 A;  2XJM A;  5J8W A;  3Q4Q A;  4ZL6 A;  3E1Q A;  1XZ1 A;  5I4J A;  5GU0 X;  4DYY A;  2F7N A;  1HRS A;  4ITT A;  1T9Q A;  2IY4 A;  5JKM A;  1NNQ A;  2K2D A;  3RBC A;  3F33 A;  2V2N A;  4DI0 A;  2JD7 0;  5E1U A;  1T9O A;  1YUZ A;  4REU A;  5LG2 A;  2QF9 A;  2XKQ A;  3E6S A;  2PYA A;  4XGS A;  1YK5 A;  4TOG A;  3FSE A;  1UVH A;  5IX6 A;  1VEQ A;  3PVT A;  2CHP A;  3KX9 A;  1BE7 A;  2FL0 A;  2JD8 0;  3GE4 A;  5HJF A;  3AK8 A;  3NP2 X;  3RE7 A;  2RDV A;  1FHH A;  1IES A;  3F38 A;  1LTL A;  3MPS A;  1IER A;  1JI5 A;  3E1M A;  2HTN A;  4RC5 A;  2YJJ A;  1JI4 A;  2V2P A;  2DSX A;  4TPU A;  5GN8 A;  1DVB A;  4LQN A;  1FHM A;  1CAA A;  1BRF A;  1KRQ A;  3QHC A;  4DYZ A;  3TA8 A;  3R2R A; 
#chains in the Genus database with same CATH topology
 5CZU A;  3R2L A;  3C21 A;  4XXB B;  4IWK A;  2AUS B;  5JKL G;  1JGC A;  1DAT A;  3PWQ C;  4LPJ A;  4ZKH A;  2Y0S P;  4BY7 L;  4CVR A;  3KYV A;  4TOD A;  2IB0 A;  1PFY A;  3BVI A;  4ZLW A;  7RXN A;  5C6F A;  1F33 A;  3LWP B;  2Z5Q A;  3AK9 A;  3IS7 A;  1SMW A;  1TK6 A;  3GGY A;  2ZG9 X;  4A3C L;  5JDO A;  2JD6 0;  2ZIX A;  4U3G A;  5CMQ A;  3PVT B;  2M6P A;  3LNL A;  4ZTT A;  1Z6O M;  2ZG7 X;  3RD0 A;  1SMM A;  3M4O L;  3SS2 A;  1TJO A;  1VZG A;  8RXN A;  2B5I D;  5E2D A;  4CVT A;  1NXG A;  3I4N L;  4EVC A;  1L8H A;  4RC5 B;  3SH6 A;  1JTS A;  1I6H L;  4LQV A;  1VJX A;  3T9J A;  1CAD A;  2ZA6 A;  1R0I A;  3MSU A;  4RC6 B;  4MKU A;  5M5X L;  2D5K A;  1TWF L;  3KHK A;  4ZL5 A;  5EIN C;  4A3D L;  2ZUR X;  2C6A A;  4P18 A;  4RXN A;  3JZA B;  1SQ3 A;  5D8Y A;  3Q4R A;  2RBD A;  2Z5P A;  3ISF A;  2NVX L;  4JAD A;  2JA6 L;  1JKU A;  2WLU A;  3AJP A;  3H0G L;  3A68 A;  2PYB A;  4ISP A;  3NFP I;  1DX8 A;  4JAE A;  1TWH L;  1MOJ A;  4E6K A;  2BKC A;  1TKP A;  3S2H L;  5AN9 H;  2XJQ A;  5JAC A;  4C3H L;  5LG8 A;  4XKT A;  5J8S A;  3GGZ A;  1S2Z A;  5HJH A;  2M4Y A;  1FHA A;  4ETR A;  1XZ3 A;  4KVS A;  4AR5 A;  3F37 A;  3VVA A;  3PWF A;  4DYX A;  3KA4 A;  5AXS A;  4TOF A;  5GOU A;  3S2D L;  6RXN A;  2V2J A;  4CVS A;  5IY0 A;  2ZG8 X;  4ZN1 B;  2CR8 A;  2FJC A;  3HOY L;  5JVG 1;  1RCG A;  1B13 A;  2GMG A;  2JA8 L;  1IRO A;  4AM2 A;  4PGI A;  5H1S c;  5RXN A;  3EGM A;  2V8T A;  3QHB A;  3OJ5 A;  4DE6 A;  3KDQ A;  1YV1 A;  2VXX A;  5D8Q A;  1SOF A;  5LS9 A;  3IS8 A;  2V2M A;  4DZ0 A;  3VNX A;  3HOU L;  3PO2 L;  2PMZ P;  2FZF A;  2V3B B;  4Y7N L;  5C4X L;  1VCX A;  3PKJ A;  2WWX B;  1I50 L;  2B63 L;  2VXI A;  1TKO A;  2R92 L;  3KYX A;  1R03 A;  4CYA A;  3ZG6 A;  4M32 A;  2WB1 P;  4YWM A;  1OTK A;  4AI0 A;  3GHQ A;  1L8I A;  3U90 A;  4TO9 A;  4AR4 A;  4KVR A;  5GAH c;  2WLA A;  1Z6O A;  1C09 A;  4LYX A;  3F34 A;  4XKS A;  5AI2 A;  5MF6 A;  2CN6 A;  4M34 A;  3Q4N A;  2FHA A;  2CLU A;  2OH3 A;  3BKN A;  3KA6 A;  1YK4 A;  2CN7 A;  3S17 L;  4JAF A;  4A3K L;  4C3I L;  1LKM A;  3WNW A;  5GU1 X;  1NF4 A;  3UNO A;  3GVY A;  4M33 A;  1B2O A;  1H7V A;  4RC6 A;  4UY8 1;  4Y52 L;  4ISM A;  3SE1 A;  4CY9 A;  2C2F A;  4A3L L;  3FRS A;  1PZX A;  4KVQ A;  2A68 D;  4AM5 A;  2QL0 A;  2VZB A;  2APO B;  1O9R A;  3FVB A;  1RCE A;  2A6E D;  3VV9 A;  2XJT A;  1JKV A;  3PW1 B;  2GS4 A;  4W4L B;  2XJN A;  3WVU A;  3KYU A;  1BCF A;  2E2H L;  3BVF A;  3ES3 A;  3F32 A;  1S30 A;  2G38 B;  5D8R A;  3A44 A;  2CF7 A;  3FI6 A;  4Z5S A;  3BVK A;  2XJU A;  2BK6 A;  1NFV A;  5FFD A;  4XGH A;  5DM6 1;  3AF8 X;  4DYU A;  3C1Y A;  4JAG A;  1VEI A;  4WFN 1;  2W0O A;  3R2K A;  5M5W L;  4YVZ A;  4WJG 4;  5FFC A;  5EIO C;  5GAE c;  3KXU A;  5D8X A;  2V2R A;  2C6R A;  5DM7 1;  2JI1 A;  3B08 B;  2AQC A;  4BBS L;  4TOA A;  4A25 A;  2NVY L;  1E8J A;  3UFB A;  1PFW A;  3LKD A;  3UOF A;  4YKH A;  3EZU A;  2OKC A;  1BQ8 A;  4ZKX A;  3R2H A;  5HQO A;  5M5Y L;  5ERJ A;  4TOC A;  1N1Q A;  1LKO A;  1BG7 A;  1R0F A;  3F36 A;  1AEW A;  2XJO A;  1BFR A;  3FKI L;  1RYT A;  5IP7 L;  1QQT A;  5FEJ A;  3KWO A;  2V2I A;  3RZO L;  3S15 L;  1QYB A;  3E1L A;  4TOB A;  2CLB A;  2NVQ L;  2C2J A;  1B71 A;  5GU3 X;  3PVY A;  1PFV A;  5ERK A;  4II4 B;  2V0E A;  2V15 A;  2H12 A;  5D8S A;  4EVD A;  3KA9 A;  4ZMC A;  4PGK A;  4B8C D;  3GTL L;  3K35 A;  5C44 L;  2C6B A;  3P2A A;  4A3J L;  4AR3 A;  5IYC L;  3S14 L;  4MN9 A;  2KKD A;  3D19 A;  5K52 A;  2LCQ A;  2C41 A;  2BW1 A;  4TW3 A;  1VZH A;  1VZI A;  2WTL A;  4KXR B;  1ZS3 A;  3KYW A;  5K2M E;  3E1J A;  1SMU A;  4AYB P;  4V19 6;  2ZA7 A;  3KA3 A;  3PVR B;  2AYJ A;  5D8O A;  1H96 A;  2IU2 A;  4MY7 A;  4YXM A;  1F30 A;  2XJV A;  3SID A;  4K9F A;  1J30 A;  1Z92 B;  5MGN A;  3IQ1 A;  2JI3 A;  2M6O A;  1BFY A;  3RAV A;  4C3J L;  3LWQ B;  3HKZ P;  2Z6M A;  3O7S A;  2MGY A;  3CQZ L;  3BT5 A;  4A3G L;  3EZ0 A;  1Z4A A;  3AF7 X;  1OWC A;  4AI3 A;  2FKZ A;  3R2S A;  4RC7 A;  1TWG L;  2NVT L;  3MQK B;  3RZT A;  3E1O A;  3PW1 A;  4CMY V;  1TWA L;  4POF A;  2ITB A;  3E1P A;  2CWL A;  3RZ6 A;  1RDV A;  2AR0 A;  3AF9 X;  1WJV A;  4POG A;  2V2S A;  4RC8 A;  3K7A L;  3PVY B;  2CKC A;  1VEL A;  3LWV B;  2MS3 A;  4C2M 1;  3O7R A;  4G6B A;  3UOI A;  5MLC 3;  2WAQ P;  1QGH A;  2JI2 A;  2PPT A;  4ME3 A;  1ZUJ A;  3E6R A;  2E2J L;  3NOZ X;  5CMR A;  4AHW A;  3BVL A;  1BQ9 A;  1NXE A;  2CKA A;  1R0J A;  3AJO A;  2V2L A;  4YWL A;  2N02 A;  3PW8 C;  3FRR A;  5C3E L;  4ML5 A;  2XGW A;  2VL6 A;  2CEI A;  3HAX C;  2HVY C;  3QZ3 A;  2KN9 A;  4Z3B A;  5FFA A;  1ZRP A;  3WWL A;  4CVP A;  4E6Y A;  2ERS A;  4R42 A;  4BY1 L;  1GWG A;  1LB3 A;  2CHI A;  3W54 A;  2PVE A;  2YW7 A;  4CYB A;  4TOE A;  3J7Z 1;  3H99 A;  4LPN A;  3SHX A;  4A3F L;  3HL1 A;  4TOH A;  4QIW P;  2GYD A;  3PL5 A;  3E1N A;  3N6O A;  4II4 A;  2Z5R A;  3H9C A;  2ZA8 A;  3NP0 X;  4IXK A;  2FFX J;  2JA7 L;  2QQY A;  1F4L A;  1UMN A;  1EUM A;  4RC7 B;  1IRN A;  3PKI A;  4OYN A;  2E2I L;  3PW8 A;  4LYU A;  2FG4 A;  4IWJ A;  4EVE A;  2PVX A;  3H9B A;  3QQC E;  3H7G A;  4MJY A;  4BBR L;  3HJW B;  4QUW A;  1MFR A;  4BXX L;  4AI1 A;  2Z3R B;  4LPM A;  5LBH A;  3QD8 A;  1S3Q A;  2OC5 A;  1WCM L;  3HOV L;  1RDG A;  1DPS A;  1O9I A;  3M3Y L;  3RGD A;  2V8U A;  3BVE A;  2FG8 A;  1LKP A;  3H97 A;  3PVR A;  2A6H D;  3HIU A;  3L0M A;  2JA5 L;  2X17 0;  5AI3 A;  1TWC L;  1RCD A;  3C1Z A;  4AI2 A;  1RYQ A;  3F35 A;  3KYY A;  1Y1V L;  3H3V M;  3S1Q L;  2UX1 A;  1S24 A;  3LWO B;  4MUD A;  1K83 L;  1PFU A;  4ERU A;  3I4M L;  2Z90 A;  3RZD L;  3Q4O A;  5C4J L;  2J9U B;  3KA8 A;  2HR5 A;  4PG0 A;  3E2C A;  5K53 A;  5JVH 1;  3WVV A;  1QCV A;  2VUM L;  4CMY A;  4PG1 A;  4DAS A;  1JYB A;  4AHY A;  3OGH A;  1R0G A;  5GAD c;  4ZN3 B;  3GTG L;  4A3B L;  3ISE A;  3VPB E;  2C2U A;  3GTO L;  3WWN B;  1B2J A;  4AM4 A;  2G4H A;  1VLG A;  3DBY A;  1YUX A;  4LQJ A;  3QB9 A;  1JIG A;  1RCI A;  5D8P A;  5FFE A;  5JKL A;  3PWQ A;  3PIO 1;  3LPE B;  2M4V A;  3GTM L;  3HJY B;  2CIH A;  4E40 A;  4MXP A;  4X6A L;  3ERZ A;  2YW6 A;  1JRE A;  4EVB A;  1IW7 D;  2Y44 A;  4LHL A;  5HU6 D;  3RYG A;  3JZ9 A;  4XKU A;  4LQH A;  4M35 A;  5GN8 B;  4AHZ A;  5FJ8 L;  2YU9 L;  2YJK A;  1SFO L;  3WVW A;  3JR7 A;  4A93 L;  4AHX A;  3R2M A;  5GU2 X;  1R0H A;  3B0A B;  4ZJK A;  1T9P A;  2Y3Q A;  3P8B A;  4GS7 D;  3AJQ A;  3F39 A;  4AR6 A;  5JKM G;  4X0J A;  3PZA A;  2BJY A;  2XJS A;  1NF6 A;  4ZKW A;  4A3M L;  1IU5 A;  3R2O A;  3IU3 I;  5J93 A;  2EY4 E;  3QVD A;  1IU6 A;  5FFB A;  5J9V A;  1RWD A;  3PIP 1;  2V2O A;  2GYQ A;  3A9Q A;  1RCC A;  4ITW A;  3LWR B;  4Y08 A;  1RB9 A;  5GAG c;  2XJM A;  5JDO B;  5J8W A;  2BE5 D;  2V0F A;  5IYB L;  3Q4Q A;  4ZL6 A;  3E1Q A;  5IYD L;  1XZ1 A;  5I4J A;  5GU0 X;  4DYY A;  3S16 L;  3S1M L;  2F7N A;  5MFP A;  1HRS A;  4ITT A;  1T9Q A;  3J7Y 1;  2IY4 A;  5JKM A;  4LHN A;  1NNQ A;  2K2D A;  3C23 A;  3GTQ L;  2R93 L;  3RBC A;  2ERJ A;  3F33 A;  2V2N A;  4A3E L;  4DI0 A;  3GTJ L;  2JD7 0;  5E1U A;  1T9O A;  1YUZ A;  4REU A;  2NYD A;  5IP9 L;  2A69 D;  5LG2 A;  2QF9 A;  1I3Q L;  2XKQ A;  3E6S A;  2PYA A;  4XGS A;  1R9T L;  1ODH A;  1YK5 A;  2O5J D;  3S1R L;  5FLM L;  4TOG A;  2XJP A;  3FSE A;  3V3K B;  2RFK B;  1UVH A;  5IX6 A;  1VEQ A;  3PVT A;  2CHP A;  3KX9 A;  1BE7 A;  2FL0 A;  2JD8 0;  3GE4 A;  5HJF A;  3HOW L;  3M6J A;  3AK8 A;  3NP2 X;  3RE7 A;  2RDV A;  1FHH A;  1IES A;  3F38 A;  3GTP L;  1LTL A;  3MPS A;  4TVM A;  1IER A;  2L0Z A;  2PSM C;  1JI5 A;  3E1M A;  2HTN A;  4RC5 A;  3HOZ L;  2YJJ A;  1JI4 A;  4A3I L;  2V2P A;  2DSX A;  5MFZ A;  5M3F L;  3PO3 L;  3GTK L;  4U67 1;  4YXJ A;  1Y1W L;  3HOX L;  4TPU A;  2R7Z L;  3S1N L;  5GN8 A;  2XJR A;  1P7P A;  1OWB A;  1DVB A;  4LQN A;  3FDJ A;  1FHM A;  1CAA A;  5M3M L;  1BRF A;  4W4K B;  1KRQ A;  2Z3Q B;  3QHC A;  4DYZ A;  3TA8 A;  3R2R A; 
#chains in the Genus database with same CATH homology
 5CZU A;  3R2L A;  3C21 A;  4XXB B;  4IWK A;  5JKL G;  1JGC A;  1DAT A;  3PWQ C;  4LPJ A;  4ZKH A;  4CVR A;  3KYV A;  4TOD A;  2IB0 A;  3BVI A;  4ZLW A;  7RXN A;  5C6F A;  1F33 A;  2Z5Q A;  3AK9 A;  3IS7 A;  1SMW A;  1TK6 A;  3GGY A;  2ZG9 X;  5JDO A;  2JD6 0;  2ZIX A;  4U3G A;  5CMQ A;  3PVT B;  2M6P A;  3LNL A;  4ZTT A;  1Z6O M;  2ZG7 X;  3RD0 A;  1SMM A;  3SS2 A;  1TJO A;  1VZG A;  8RXN A;  2B5I D;  5E2D A;  4CVT A;  1NXG A;  4EVC A;  1L8H A;  4RC5 B;  3SH6 A;  1JTS A;  4LQV A;  1VJX A;  3T9J A;  1CAD A;  2ZA6 A;  1R0I A;  3MSU A;  4RC6 B;  4MKU A;  2D5K A;  3KHK A;  4ZL5 A;  5EIN C;  2ZUR X;  2C6A A;  4P18 A;  4RXN A;  3JZA B;  1SQ3 A;  5D8Y A;  3Q4R A;  2RBD A;  2Z5P A;  3ISF A;  4JAD A;  1JKU A;  2WLU A;  3AJP A;  3A68 A;  2PYB A;  4ISP A;  3NFP I;  1DX8 A;  4JAE A;  1MOJ A;  4E6K A;  2BKC A;  1TKP A;  5AN9 H;  2XJQ A;  5JAC A;  5LG8 A;  4XKT A;  5J8S A;  3GGZ A;  1S2Z A;  5HJH A;  2M4Y A;  1FHA A;  4ETR A;  1XZ3 A;  4KVS A;  4AR5 A;  3F37 A;  3VVA A;  3PWF A;  4DYX A;  3KA4 A;  5AXS A;  4TOF A;  5GOU A;  6RXN A;  2V2J A;  4CVS A;  5IY0 A;  2ZG8 X;  4ZN1 B;  2CR8 A;  2FJC A;  5JVG 1;  1RCG A;  1B13 A;  2GMG A;  1IRO A;  4AM2 A;  4PGI A;  5H1S c;  5RXN A;  3EGM A;  2V8T A;  3QHB A;  3OJ5 A;  4DE6 A;  3KDQ A;  1YV1 A;  2VXX A;  5D8Q A;  1SOF A;  5LS9 A;  3IS8 A;  2V2M A;  4DZ0 A;  3VNX A;  2FZF A;  2V3B B;  1VCX A;  3PKJ A;  2WWX B;  2VXI A;  1TKO A;  3KYX A;  1R03 A;  4CYA A;  3ZG6 A;  4M32 A;  4YWM A;  1OTK A;  4AI0 A;  3GHQ A;  1L8I A;  3U90 A;  4TO9 A;  4AR4 A;  4KVR A;  5GAH c;  2WLA A;  1Z6O A;  1C09 A;  4LYX A;  3F34 A;  4XKS A;  5AI2 A;  5MF6 A;  2CN6 A;  4M34 A;  3Q4N A;  2FHA A;  2CLU A;  2OH3 A;  3BKN A;  3KA6 A;  1YK4 A;  2CN7 A;  4JAF A;  1LKM A;  3WNW A;  5GU1 X;  1NF4 A;  3UNO A;  3GVY A;  4M33 A;  1B2O A;  1H7V A;  4RC6 A;  4UY8 1;  4ISM A;  3SE1 A;  4CY9 A;  2C2F A;  3FRS A;  4KVQ A;  2A68 D;  4AM5 A;  2QL0 A;  2VZB A;  2A6E D;  1O9R A;  3FVB A;  1RCE A;  2XJT A;  3VV9 A;  1JKV A;  3PW1 B;  2GS4 A;  4W4L B;  2XJN A;  3WVU A;  3KYU A;  1BCF A;  3BVF A;  3ES3 A;  3F32 A;  1S30 A;  2G38 B;  5D8R A;  3A44 A;  2CF7 A;  3FI6 A;  4Z5S A;  3BVK A;  2XJU A;  2BK6 A;  1NFV A;  5FFD A;  4XGH A;  5DM6 1;  3AF8 X;  4DYU A;  3C1Y A;  4JAG A;  1VEI A;  4WFN 1;  2W0O A;  3R2K A;  4YVZ A;  4WJG 4;  5FFC A;  5EIO C;  5GAE c;  3KXU A;  5D8X A;  2V2R A;  2C6R A;  5DM7 1;  2JI1 A;  3B08 B;  4TOA A;  4A25 A;  1E8J A;  3UFB A;  3LKD A;  3UOF A;  4YKH A;  3EZU A;  2OKC A;  1BQ8 A;  4ZKX A;  3R2H A;  5HQO A;  5ERJ A;  4TOC A;  1N1Q A;  1LKO A;  1BG7 A;  1R0F A;  3F36 A;  1AEW A;  2XJO A;  1BFR A;  1RYT A;  5FEJ A;  3KWO A;  2V2I A;  1QYB A;  3E1L A;  4TOB A;  2CLB A;  2C2J A;  1B71 A;  5GU3 X;  3PVY A;  5ERK A;  4II4 B;  2V0E A;  2V15 A;  2H12 A;  5D8S A;  4EVD A;  3KA9 A;  4ZMC A;  4PGK A;  4B8C D;  3K35 A;  2C6B A;  3P2A A;  4AR3 A;  4MN9 A;  2KKD A;  3D19 A;  5K52 A;  2LCQ A;  2C41 A;  2BW1 A;  4TW3 A;  1VZH A;  1VZI A;  2WTL A;  4KXR B;  1ZS3 A;  3KYW A;  5K2M E;  3E1J A;  1SMU A;  4V19 6;  2ZA7 A;  3KA3 A;  3PVR B;  2AYJ A;  5D8O A;  1H96 A;  2IU2 A;  4MY7 A;  4YXM A;  1F30 A;  2XJV A;  3SID A;  4K9F A;  1J30 A;  1Z92 B;  5MGN A;  3IQ1 A;  2JI3 A;  2M6O A;  1BFY A;  3RAV A;  2Z6M A;  3O7S A;  2MGY A;  3BT5 A;  3EZ0 A;  1Z4A A;  3AF7 X;  1OWC A;  4AI3 A;  2FKZ A;  3R2S A;  4RC7 A;  3RZT A;  3E1O A;  3PW1 A;  4CMY V;  4POF A;  2ITB A;  3E1P A;  2CWL A;  3RZ6 A;  1RDV A;  2AR0 A;  3AF9 X;  1WJV A;  4POG A;  2V2S A;  4RC8 A;  3PVY B;  2CKC A;  1VEL A;  2MS3 A;  3O7R A;  4G6B A;  3UOI A;  5MLC 3;  1QGH A;  2JI2 A;  2PPT A;  4ME3 A;  1ZUJ A;  3E6R A;  3NOZ X;  5CMR A;  4AHW A;  3BVL A;  1BQ9 A;  1NXE A;  2CKA A;  1R0J A;  3AJO A;  2V2L A;  4YWL A;  2N02 A;  3PW8 C;  3FRR A;  4ML5 A;  2XGW A;  2VL6 A;  2CEI A;  3QZ3 A;  2KN9 A;  4Z3B A;  5FFA A;  1ZRP A;  3WWL A;  4CVP A;  4E6Y A;  2ERS A;  4R42 A;  1GWG A;  1LB3 A;  2CHI A;  3W54 A;  2PVE A;  2YW7 A;  4CYB A;  4TOE A;  3J7Z 1;  4LPN A;  3SHX A;  3HL1 A;  4TOH A;  2GYD A;  3E1N A;  3N6O A;  4II4 A;  2Z5R A;  2ZA8 A;  3NP0 X;  4IXK A;  2FFX J;  2QQY A;  1UMN A;  1EUM A;  4RC7 B;  1IRN A;  3PKI A;  4OYN A;  3PW8 A;  4LYU A;  2FG4 A;  4IWJ A;  4EVE A;  2PVX A;  3QQC E;  3H7G A;  4MJY A;  4QUW A;  1MFR A;  4AI1 A;  2Z3R B;  4LPM A;  5LBH A;  3QD8 A;  1S3Q A;  2OC5 A;  1RDG A;  1DPS A;  1O9I A;  3RGD A;  2V8U A;  3BVE A;  2FG8 A;  1LKP A;  3PVR A;  2A6H D;  3HIU A;  3L0M A;  2X17 0;  5AI3 A;  1RCD A;  3C1Z A;  4AI2 A;  1RYQ A;  3F35 A;  3KYY A;  2UX1 A;  1S24 A;  4MUD A;  4ERU A;  2Z90 A;  3Q4O A;  2J9U B;  3KA8 A;  2HR5 A;  4PG0 A;  3E2C A;  5K53 A;  5JVH 1;  3WVV A;  1QCV A;  4CMY A;  4PG1 A;  4DAS A;  1JYB A;  4AHY A;  3OGH A;  1R0G A;  5GAD c;  4ZN3 B;  3ISE A;  3VPB E;  2C2U A;  3WWN B;  1B2J A;  4AM4 A;  2G4H A;  1VLG A;  3DBY A;  1YUX A;  4LQJ A;  3QB9 A;  1JIG A;  1RCI A;  5D8P A;  5FFE A;  5JKL A;  3PWQ A;  3PIO 1;  3LPE B;  2M4V A;  2CIH A;  4E40 A;  4MXP A;  3ERZ A;  2YW6 A;  1JRE A;  4EVB A;  1IW7 D;  2Y44 A;  4LHL A;  5HU6 D;  3RYG A;  3JZ9 A;  4XKU A;  4LQH A;  4M35 A;  5GN8 B;  4AHZ A;  2YJK A;  3WVW A;  4AHX A;  3R2M A;  5GU2 X;  1R0H A;  3B0A B;  4ZJK A;  1T9P A;  2Y3Q A;  3P8B A;  4GS7 D;  3AJQ A;  3F39 A;  4AR6 A;  5JKM G;  4X0J A;  3PZA A;  2BJY A;  2XJS A;  1NF6 A;  4ZKW A;  1IU5 A;  3R2O A;  3IU3 I;  5J93 A;  3QVD A;  1IU6 A;  5FFB A;  5J9V A;  1RWD A;  3PIP 1;  2V2O A;  2GYQ A;  3A9Q A;  1RCC A;  4ITW A;  4Y08 A;  1RB9 A;  5GAG c;  2XJM A;  5JDO B;  5J8W A;  2BE5 D;  2V0F A;  3Q4Q A;  4ZL6 A;  3E1Q A;  1XZ1 A;  5I4J A;  5GU0 X;  4DYY A;  2F7N A;  5MFP A;  1HRS A;  4ITT A;  1T9Q A;  3J7Y 1;  2IY4 A;  5JKM A;  4LHN A;  1NNQ A;  2K2D A;  3C23 A;  3RBC A;  2ERJ A;  3F33 A;  2V2N A;  4DI0 A;  2JD7 0;  5E1U A;  1T9O A;  1YUZ A;  4REU A;  2NYD A;  2A69 D;  5LG2 A;  2QF9 A;  2XKQ A;  3E6S A;  2PYA A;  4XGS A;  1ODH A;  1YK5 A;  2O5J D;  4TOG A;  2XJP A;  3FSE A;  3V3K B;  1UVH A;  5IX6 A;  1VEQ A;  3PVT A;  2CHP A;  3KX9 A;  1BE7 A;  2FL0 A;  2JD8 0;  3GE4 A;  5HJF A;  3M6J A;  3AK8 A;  3NP2 X;  3RE7 A;  2RDV A;  1FHH A;  1IES A;  3F38 A;  1LTL A;  3MPS A;  4TVM A;  1IER A;  2L0Z A;  2PSM C;  1JI5 A;  3E1M A;  2HTN A;  4RC5 A;  2YJJ A;  1JI4 A;  2V2P A;  2DSX A;  5MFZ A;  4U67 1;  4YXJ A;  4TPU A;  5GN8 A;  2XJR A;  1OWB A;  1DVB A;  4LQN A;  1FHM A;  1CAA A;  1BRF A;  4W4K B;  1KRQ A;  2Z3Q B;  3QHC A;  4DYZ A;  3TA8 A;  3R2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...