3QVDA

Exposure of rubrerythrin from pyrococcus furiosus to peroxide, fifteen second time point.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
b'VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 62
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3qvdA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3qvdA02
1TKOA 1ZRPA 4PGKA 4LYUA 1DPSA 1SMMA 2JD60 3AK9A 2Z5QA 3PW8C 2FZFA 3FI6A 3A44A 4P18A 1BFRA 1Z6OM 4LPJA 2RDVA 3RBCA 3ERZA 1Z4AA 2XJOA 3E1PA 5CMQA 4ZLWA 5GN8A 3R2HA 1IU6A 1E8JA 2CN7A 3FVBA 1LB3A 3PWFA 4AR5A 4YKHA 3Q4QA 3AJOA 1R0GA 4QUWA 1O9IA 1RCCA 4YWLA 3Q4NA 1XZ1A 3PVTB 3PVYA 3AJPA 3RZ6A 2W0OA 3EGMA 2Z5RA 3R2OA 4XGSA 1T9PA 2F7NA 1YUZA 2UX1A 3RGDA 1H7VA 3O7SA 1IRNA 4ETRA 3PVTA 3PWQA 5E1UA 4POFA 4Z5SA 4LPMA 4TOGA 3KA9A 2YW6A 2JD70 4MKUA 1LKPA 1RDVA 2V2NA 3TA8A 1BRFA 2GYDA 2CEIA 2V2JA 2HTNA 4DASA 1OTKA 1QGHA 1RDGA 5HQOA 1DVBA 5GU2X 4ISMA 1R0FA 2V2MA 4YWMA 3PZAA 3GHQA 3AF7X 5J9VA 3FSEA 1TJOA 4ZKXA 2XJNA 5I4JA 3F33A 2X170 4KVQA 5FEJA 1DX8A 1L8HA 3U90A 3KYWA 3KWOA 1UMNA 4DYZA 2CHIA 4RC6A 3KYVA 1RCEA 4TOEA 5LG2A 2WTLA 3KYXA 2CLBA 3EZUA 6RXNA 4TOFA 3NP0X 4TOCA 3NP2X 4LYXA 5J8WA 2G4HA 2FFXJ 3SIDA 1N1QA 2QQYA 2V3BB 4CYAA 1TKPA 2KKDA 2PVXA 4TOHA 2RBDA 4AM5A 5JKLG 2BKCA 2HR5A 2JD80 5CZUA 3R2SA 5FFDA 2ZURX 1T9OA 2Z90A 1BFYA 1NFVA 2K2DA 4LQJA 2V2IA 1JI5A 4IWKA 1VEIA 4CYBA 4E6KA 2C41A 5GN8B 3F32A 3T9JA 4KVRA 2GS4A 5J93A 2XJMA 4XKUA 1JIGA 4TOAA 5JKLA 4TPUA 3F38A 3RE7A 1SOFA 3SHXA 1RB9A 5D8QA 3PWQC 5IX6A 5IY0A 1IU5A 3F39A 2ZA6A 1JKVA 2V15A 5HJFA 3SS2A 3PVYB 1UVHA 1FHAA 1RYTA 2CHPA 3QVDA 3RD0A 3KA4A 4M35A 4AM2A 4ZKHA 2VXIA 3E1LA 3PW1B 1JI4A 2FJCA 1EUMA 2CF7A 2V2RA 5J8SA 1IESA 5HJHA 3AF9X 2PVEA 4OYNA 4ITTA 4IXKA 5AI2A 3Q4OA 3SE1A 4Z3BA 3PW1A 3RYGA 4CMYV 2CLUA 4LPNA 1JREA 4POGA 3A68A 4M33A 1XZ3A 3AJQA 3E6RA 4ZMCA 3F34A 5FFBA 3R2RA 2XGWA 5FFAA 8RXNA 1GWGA 2C6RA 5D8OA 3O7RA 5FFCA 2V2PA 4ZKWA 1YK5A 1YK4A 4ZL5A 1L8IA 4DYYA 1BE7A 1ZS3A 4RC6B 2M4YA 2BJYA 5GOUA 1RCIA 4MY7A 1RCDA 4RC5B 3QZ3A 4DZ0A 4ML5A 4DI0A 2FHAA 1AEWA 3KYYA 2ZG9X 5E2DA 4EVDA 4IWJA 3RZTA 5LS9A 4ZL6A 3R2MA 1R0JA 4ERUA 4EVCA 2CIHA 3EZ0A 2BW1A 4RC5A 5RXNA 4DYUA 2C2UA 1S30A 2V2SA 3BVKA 3WNWA 2Z6MA 3R2LA 3ISEA 1RCGA 1KRQA 1VEQA 3KA6A 2OC5A 4ZTTA 5ERJA 3NOZX 2DSXA 1R03A 5JKMG 1MFRA 1S3QA 3QD8A 7RXNA 4PGIA 2D5KA 3E1NA 3UNOA 4XKTA 3IS8A 3BT5A 1JYBA 4AM4A 3E1QA 1C09A 2YW7A 1S2ZA 2YJJA 4CVTA 2IB0A 1H96A 1ZUJA 3AK8A 3BVFA 1TK6A 5FFEA 2OH3A 2FG4A 3KA8A 3UOFA 4RC7A 1NF4A 5JKMA 4CVSA 2WLUA 5K53A 2IU2A 2CN6A 1BCFA 1SMWA 2LCQA 1JTSA 5D8XA 5LG8A 5AXSA 5GU1X 2GYQA 4AR4A 4LQVA 1IROA 4DE6A 2VZBA 5CMRA 4ZJKA 2FL0A 3KA3A 1CAAA 2MS3A 5AI3A 1VLGA 3WVWA 4CY9A 5ERKA 4KVSA 2ITBA 4PG0A 2ZA7A 4II4B 3WVUA 3E2CA 2PYBA 2Y3QA 5LBHA 1DATA 1FHMA 3OJ5A 3PVRA 1YUXA 2IY4A 2QL0A 1NF6A 4II4A 1IERA 1SQ3A 3BVLA 4AR3A 1B71A 3Q4RA 5JACA 1R0HA 3R2KA 5D8RA 3IS7A 3BKNA 2KN9A 3KYUA 1QYBA 3MPSA 1BQ8A 2PYAA 4U3GA 3E1OA 3VNXA 4CVPA 4CMYA 3RAVA 4DYXA 1RWDA 3HIUA 5K52A 2ZA8A 5D8YA 1F30A 3ISFA 4REUA 3PW8A 3QHBA 1VELA 5GU0X 1LKMA 4TOBA 3ES3A 5D8SA 2Z5PA 2ZG7X 2V2LA 3OGHA 1T9QA 3AF8X 3BVIA 5GU3X 4TODA 2GMGA 3E1MA 1CADA 2C2FA 2YJKA 4M32A 2C2JA 2VXXA 3KXUA 2BK6A 4MN9A 4AR6A 3HL1A 3H7GA 2FG8A 4LQHA 1R0IA 1JKUA 2ZG8X 1LKOA 1SMUA 3A9QA 1O9RA 3BVEA 3IQ1A 4TO9A 4Y08A 4XKSA 1J30A 1LTLA 4A25A 4TW3A 2XKQA 1B13A 4EVBA 1JGCA 3F36A 3F35A 1FHHA 1B2JA 4RC7B 4MUDA 3E1JA 1NNQA 1YV1A 3SH6A 2VL6A 3QB9A 1VJXA 1BG7A 1B2OA 2QF9A 3GE4A 1VCXA 1S24A 4MJYA 3E6SA 4R42A 1BQ9A 4ITWA 5D8PA 1MOJA 4LQNA 4ME3A 3F37A 1Z6OA 4RC8A 2V2OA 3WVVA 3UOIA 5C6FA 3GVYA 1HRSA 4K9FA 4EVEA 1F33A 2WLAA 4ISPA 4PG1A 4RXNA 2FKZA 1QCVA 3KX9A 4CVRA 3QHCA 4M34A 3PVRB
chains in the Genus database with same CATH superfamily
1TKOA 1ZRPA 4PGKA 3HOVL 4LYUA 1DPSA 5AN9H 1SMMA 2JD60 3AK9A 5DM71 3L0MA 2Z5QA 3HJWB 4A3ML 3GTML 2PPTA 5C44L 4AI0A 5FJ8L 3PW8C 2FZFA 3FI6A 3M6JA 1P7PA 2PSMC 3A44A 4P18A 1BFRA 1Z6OM 4LPJA 2RDVA 3RBCA 2M4VA 3ERZA 1Z4AA 2XJOA 3E1PA 5CMQA 2AYJA 3HAXC 4ZLWA 5GN8A 2JA6L 3R2HA 5C4JL 5K2ME 1IU6A 4QIWP 1E8JA 2CN7A 3FVBA 1LB3A 5JVG1 3PWFA 4AR5A 4YKHA 3Q4QA 3AJOA 2PMZP 1R0GA 4JAEA 4QUWA 4G6BA 4AHYA 3HOWL 1O9IA 1RCCA 2V0FA 4YWLA 3Q4NA 1XZ1A 3PVTB 3PVYA 1VZHA 3AJPA 2H12A 4U671 3RZ6A 4A3JL 2W0OA 1PZXA 3HKZP 3EGMA 4A93L 5C4XL 2JI2A 2Z5RA 3R2OA 4XGSA 1T9PA 3RZOL 2F7NA 1YUZA 2UX1A 3RGDA 1H7VA 4AHZA 3O7SA 3PO2L 1IRNA 4ETRA 3PVTA 3PWQA 3JR7A 5E1UA 4A3GL 4POFA 4Z5SA 4LPMA 4TOGA 3KA9A 2YW6A 2JD70 2B63L 4MKUA 4A3IL 2JA8L 1LKPA 1RDVA 2V2NA 3TA8A 1BRFA 2GYDA 2CEIA 2V2JA 2HTNA 4W4KB 4DASA 1OTKA 1QGHA 2ERSA 1RDGA 5HQOA 1DVBA 5GU2X 1OWCA 3LWRB 4ISMA 1R0FA 3HOXL 1F4LA 2V2MA 4YWMA 3PZAA 3FRSA 3GHQA 2C6AA 3AF7X 5J9VA 3FSEA 1TJOA 4ZKXA 1SFOL 2XJNA 5I4JA 3VVAA 3F33A 2X170 4KVQA 2JA7L 5FEJA 5EIOC 1DX8A 3WWNB 1ODHA 1L8HA 3U90A 3KYWA 3V3KB 3KWOA 1UMNA 4DYZA 2CHIA 4RC6A 3KYVA 1RCEA 4TOEA 5LG2A 2WTLA 3KYXA 2CLBA 4A3EL 4WFN1 2M6OA 3EZUA 6RXNA 2A69D 3GTQL 4TOFA 2BE5D 3NP0X 4TOCA 3NP2X 4LYXA 5J8WA 2G4HA 2FFXJ 3SIDA 4E40A 3HOZL 1N1QA 2QQYA 2V3BB 2XJVA 4CYAA 3C1YA 1TKPA 2KKDA 2PVXA 5M3FL 4TOHA 5H1Sc 3HOYL 2RBDA 3S1QL 4AM5A 3S2DL 5JKLG 2BKCA 2V8UA 5M5WL 2HR5A 3HOUL 5GAEc 2JD80 2ERJA 5CZUA 3K7AL 3R2SA 5FFDA 2ZURX 1T9OA 3GTJL 2Z90A 3M4OL 1BFYA 1NFVA 2K2DA 4LQJA 2V2IA 1JI5A 4IWKA 1VEIA 4CYBA 4BBSL 4E6KA 2C41A 3FRRA 5GN8B 3F32A 3T9JA 4KVRA 2GS4A 5J93A 2XJMA 4XKUA 1JIGA 4TOAA 5JKLA 4TPUA 1IW7D 3F38A 3RE7A 1SOFA 1PFWA 4JAFA 5EINC 3SHXA 1RB9A 5D8QA 3PWQC 5IX6A 1QQTA 1Y1VL 2XJPA 5IY0A 1IU5A 4ZN3B 3F39A 2A6HD 3H97A 2JI1A 2XJUA 5GAGc 2ZA6A 4AHXA 1JKVA 2V15A 3DBYA 5HJFA 3SS2A 3GGYA 3PVYB 1UVHA 1FHAA 1RYTA 2JA5L 3GTLL 2CHPA 3HJYB 3QVDA 3RD0A 2R92L 3KA4A 4M35A 4AM2A 4ZKHA 3FKIL 3WWLA 3S14L 2VXIA 2E2HL 3E1LA 3PW1B 4C2M1 3P8BA 3GTOL 1JI4A 2FJCA 1EUMA 2CF7A 2V2RA 5J8SA 1IESA 5HJHA 3AF9X 2PVEA 3IU3I 4OYNA 1WCML 4ITTA 4IXKA 2HVYC 5AI2A 1I6HL 3Q4OA 4AYBP 3SE1A 4Z3BA 3PW1A 3RYGA 4CMYV 2XJSA 5HU6D 2CLUA 2N02A 4LPNA 1JREA 4POGA 5DM61 3A68A 4M33A 2CR8A 1XZ3A 3AJQA 3E6RA 4ZMCA 3F34A 3W54A 2NVYL 2A6ED 5FFBA 4LHLA 3R2RA 5IP7L 2XGWA 5FFAA 8RXNA 1GWGA 2E2IL 2C6RA 3FDJA 2CWLA 3H0GL 4LHNA 5D8OA 3O7RA 5FFCA 4C3JL 3S16L 2V2PA 4ZKWA 1YK5A 2RFKB 2XJQA 2WWXB 2M6PA 4XXBB 2E2JL 4X0JA 1YK4A 1I50L 4ZL5A 1L8IA 4DYYA 1BE7A 4AI1A 2YU9L 1ZS3A 4RC6B 2M4YA 2BJYA 3C1ZA 5GOUA 1RCIA 4MY7A 2C6BA 1RCDA 2OKCA 1OWBA 4RC5B 3QZ3A 3GTGL 4DZ0A 2CKCA 4ML5A 4DI0A 2FHAA 1AEWA 3KYYA 3S17L 2R7ZL 3N6OA 2ZG9X 3LPEB 5E2DA 4EVDA 3B0AB 4IWJA 3I4NL 4A3KL 3RZTA 3P2AA 4XGHA 5LS9A 4ZL6A 3R2MA 1R0JA 4ERUA 4EVCA 2CIHA 3EZ0A 2BW1A 3S1NL 4RC5A 5RXNA 4DYUA 2C2UA 1S30A 2V8TA 3S1ML 2V2SA 3BVKA 3WNWA 1PFVA 1WJVA 2Z6MA 3PL5A 3S1RL 2NVQL 3LNLA 3R2LA 3ISEA 5GADc 1RCGA 1KRQA 1NXEA 1VEQA 3KA6A 2OC5A 4ZTTA 5ERJA 3NOZX 2DSXA 1R03A 5JKMG 1MFRA 1S3QA 1K83L 3QD8A 7RXNA 3LWVB 4Y7NL 4A3BL 4PGIA 2D5KA 3E1NA 3UNOA 4XKTA 1PFYA 3PIP1 3MQKB 2Z3RB 3IS8A 3BT5A 1JYBA 2JI3A 4AM4A 3H99A 3E1QA 1C09A 5M5YL 2YW7A 2WAQP 1S2ZA 3GGZA 2YJJA 4CVTA 2IB0A 3LWOB 1H96A 1ZUJA 2XJRA 3AK8A 3BVFA 1TK6A 5FFEA 2OH3A 2FG4A 3KA8A 3UOFA 4RC7A 1NF4A 4C3HL 4KXRB 5JKMA 4CVSA 2WLUA 5K53A 2IU2A 2NYDA 2CN6A 5MFPA 1BCFA 1SMWA 2LCQA 1JTSA 5D8XA 5LG8A 4MXPA 3PIO1 1PFUA 5AXSA 5GU1X 3PO3L 2GYQA 4BBRL 2NVTL 3H9BA 4AR4A 4LQVA 3UFBA 1IROA 5MFZA 4DE6A 2VUML 4A3CL 2Z3QB 2VZBA 5CMRA 4ZJKA 3ZG6A 2FL0A 3C21A 3KA3A 1CAAA 2MS3A 5AI3A 3GTKL 1VLGA 3WVWA 5IYBL 4CY9A 5ERKA 4KVSA 3LWQB 2ITBA 4TVMA 2J9UB 4PG0A 1RYQA 2ZA7A 4ZN1B 3LKDA 4II4B 3MSUA 1Z92B 3WVUA 3E2CA 2PYBA 2B5ID 2Y3QA 3D19A 3S2HL 5LBHA 1DATA 3PKIA 1FHMA 2R93L 3OJ5A 3PVRA 4UY81 3M3YL 1YUXA 2IY4A 2QL0A 3KHKA 4BXXL 4AI2A 1NF6A 4II4A 1TWGL 1IERA 1SQ3A 3BVLA 4AR3A 4Y52L 1B71A 2ZIXA 3Q4RA 5JACA 1R0HA 3R2KA 5D8RA 3IS7A 3BKNA 2KN9A 3KYUA 1QYBA 2XJTA 4C3IL 3QQCE 3MPSA 5C3EL 1BQ8A 4X6AL 2PYAA 4U3GA 3E1OA 3VNXA 4CVPA 4CMYA 3RAVA 4DYXA 1RWDA 4JAGA 3HIUA 2L0ZA 1TWHL 2O5JD 5K52A 3VV9A 4A3LL 3RZDL 2ZA8A 4YXJA 5MGNA 3GTPL 5D8YA 1F30A 3ISFA 4REUA 3PW8A 3QHBA 2APOB 3K35A 1VELA 4WJG4 5GU0X 4GS7D 3JZ9A 1VZIA 1LKMA 5M3ML 2NVXL 5IYCL 4TOBA 1Y1WL 4AI3A 2Y44A 3ES3A 5D8SA 2Z5PA 2ZG7X 2V2LA 3OGHA 1T9QA 3AF8X 3BVIA 5GU3X 1I3QL 4TODA 3VPBE 2GMGA 3E1MA 1CADA 3KDQA 4BY1L 4AHWA 2C2FA 2YJKA 4M32A 2C2JA 2VXXA 3KXUA 1TWAL 1TWCL 2BK6A 4MN9A 4E6YA 4AR6A 2MGYA 3HL1A 3H7GA 3C23A 2FG8A 4LQHA 1R0IA 3H3VM 1JKUA 5GAHc 3PKJA 2ZG8X 1LKOA 2AR0A 1SMUA 3A9QA 2V0EA 5FLML 1O9RA 3BVEA 2AQCA 3S15L 1VZGA 2G38B 3IQ1A 4TO9A 4A3FL 4Y08A 4XKSA 1J30A 2Y0SP 4YVZA 1LTLA 4A25A 4TW3A 2XKQA 1B13A 2EY4E 5MF6A 4EVBA 1JGCA 3CQZL 2CKAA 4W4LB 3F36A 3F35A 1FHHA 1B2JA 4RC7B 1NXGA 4JADA 4MUDA 3E1JA 4BY7L 4YXMA 1NNQA 1YV1A 3SH6A 4B8CD 2VL6A 4V196 2WB1P 3QB9A 1VJXA 3JZAB 5MLC3 4A3DL 1BG7A 1B2OA 2A68D 2QF9A 3GE4A 1VCXA 1S24A 4MJYA 3E6SA 4R42A 1BQ9A 3H9CA 5IP9L 4ITWA 5D8PA 1MOJA 4LQNA 1TWFL 4ME3A 5JDOB 3F37A 1Z6OA 4RC8A 3B08B 2V2OA 3WVVA 3UOIA 5C6FA 1R9TL 3GVYA 1HRSA 4K9FA 4EVEA 5JVH1 1F33A 2WLAA 4ISPA 4PG1A 4RXNA 2FKZA 1QCVA 3J7Z1 3I4ML 5M5XL 3KX9A 3J7Y1 3LWPB 4CVRA 3QHCA 5JDOA 2AUSB 4M34A 3PVRB 3NFPI 5IYDL
chains in the Genus database with same CATH topology
1TKOA 1ZRPA 4PGKA 4LYUA 1DPSA 5AN9H 1SMMA 2JD60 3AK9A 5DM71 3L0MA 2Z5QA 2PPTA 4AI0A 3PW8C 2FZFA 3FI6A 3M6JA 2PSMC 3A44A 4P18A 1BFRA 1Z6OM 4LPJA 2RDVA 3RBCA 2M4VA 3ERZA 1Z4AA 2XJOA 3E1PA 5CMQA 2AYJA 4ZLWA 5GN8A 3R2HA 5K2ME 1IU6A 1E8JA 2CN7A 3FVBA 1LB3A 5JVG1 3PWFA 4AR5A 4YKHA 3Q4QA 3AJOA 1R0GA 4JAEA 4QUWA 4G6BA 4AHYA 1O9IA 1RCCA 2V0FA 4YWLA 3Q4NA 1XZ1A 3PVTB 3PVYA 1VZHA 3AJPA 2H12A 4U671 3RZ6A 2W0OA 3EGMA 2JI2A 2Z5RA 3R2OA 4XGSA 1T9PA 2F7NA 1YUZA 2UX1A 3RGDA 1H7VA 4AHZA 3O7SA 1IRNA 4ETRA 3PVTA 3PWQA 5E1UA 4POFA 4Z5SA 4LPMA 4TOGA 3KA9A 2YW6A 2JD70 4MKUA 1LKPA 1RDVA 2V2NA 3TA8A 1BRFA 2GYDA 2CEIA 2V2JA 2HTNA 4W4KB 4DASA 1OTKA 1QGHA 2ERSA 1RDGA 5HQOA 1DVBA 5GU2X 1OWCA 4ISMA 1R0FA 2V2MA 4YWMA 3PZAA 3FRSA 3GHQA 2C6AA 3AF7X 5J9VA 3FSEA 1TJOA 4ZKXA 2XJNA 5I4JA 3VVAA 3F33A 2X170 4KVQA 5FEJA 5EIOC 1DX8A 3WWNB 1ODHA 1L8HA 3U90A 3KYWA 3V3KB 3KWOA 1UMNA 4DYZA 2CHIA 4RC6A 3KYVA 1RCEA 4TOEA 5LG2A 2WTLA 3KYXA 2CLBA 4WFN1 2M6OA 3EZUA 6RXNA 2A69D 4TOFA 2BE5D 3NP0X 4TOCA 3NP2X 4LYXA 5J8WA 2G4HA 2FFXJ 3SIDA 4E40A 1N1QA 2QQYA 2V3BB 2XJVA 4CYAA 3C1YA 1TKPA 2KKDA 2PVXA 4TOHA 5H1Sc 2RBDA 4AM5A 5JKLG 2BKCA 2V8UA 2HR5A 5GAEc 2JD80 2ERJA 5CZUA 3R2SA 5FFDA 2ZURX 1T9OA 2Z90A 1BFYA 1NFVA 2K2DA 4LQJA 2V2IA 1JI5A 4IWKA 1VEIA 4CYBA 4E6KA 2C41A 3FRRA 5GN8B 3F32A 3T9JA 4KVRA 2GS4A 5J93A 2XJMA 4XKUA 1JIGA 4TOAA 5JKLA 4TPUA 1IW7D 3F38A 3RE7A 1SOFA 4JAFA 5EINC 3SHXA 1RB9A 5D8QA 3PWQC 5IX6A 2XJPA 5IY0A 1IU5A 4ZN3B 3F39A 2A6HD 2JI1A 2XJUA 5GAGc 2ZA6A 4AHXA 1JKVA 2V15A 3DBYA 5HJFA 3SS2A 3GGYA 3PVYB 1UVHA 1FHAA 1RYTA 2CHPA 3QVDA 3RD0A 3KA4A 4M35A 4AM2A 4ZKHA 3WWLA 2VXIA 3E1LA 3PW1B 3P8BA 1JI4A 2FJCA 1EUMA 2CF7A 2V2RA 5J8SA 1IESA 5HJHA 3AF9X 2PVEA 3IU3I 4OYNA 4ITTA 4IXKA 5AI2A 3Q4OA 3SE1A 4Z3BA 3PW1A 3RYGA 4CMYV 2XJSA 5HU6D 2CLUA 2N02A 4LPNA 1JREA 4POGA 5DM61 3A68A 4M33A 2CR8A 1XZ3A 3AJQA 3E6RA 4ZMCA 3F34A 3W54A 2A6ED 5FFBA 4LHLA 3R2RA 2XGWA 5FFAA 8RXNA 1GWGA 2C6RA 2CWLA 4LHNA 5D8OA 3O7RA 5FFCA 2V2PA 4ZKWA 1YK5A 2XJQA 2WWXB 2M6PA 4XXBB 4X0JA 1YK4A 4ZL5A 1L8IA 4DYYA 1BE7A 4AI1A 1ZS3A 4RC6B 2M4YA 2BJYA 3C1ZA 5GOUA 1RCIA 4MY7A 2C6BA 1RCDA 2OKCA 1OWBA 4RC5B 3QZ3A 4DZ0A 2CKCA 4ML5A 4DI0A 2FHAA 1AEWA 3KYYA 3N6OA 2ZG9X 3LPEB 5E2DA 4EVDA 3B0AB 4IWJA 3RZTA 3P2AA 4XGHA 5LS9A 4ZL6A 3R2MA 1R0JA 4ERUA 4EVCA 2CIHA 3EZ0A 2BW1A 4RC5A 5RXNA 4DYUA 2C2UA 1S30A 2V8TA 2V2SA 3BVKA 3WNWA 1WJVA 2Z6MA 3LNLA 3R2LA 3ISEA 5GADc 1RCGA 1KRQA 1NXEA 1VEQA 3KA6A 2OC5A 4ZTTA 5ERJA 3NOZX 2DSXA 1R03A 5JKMG 1MFRA 1S3QA 3QD8A 7RXNA 4PGIA 2D5KA 3E1NA 3UNOA 4XKTA 3PIP1 2Z3RB 3IS8A 3BT5A 1JYBA 2JI3A 4AM4A 3E1QA 1C09A 2YW7A 1S2ZA 3GGZA 2YJJA 4CVTA 2IB0A 1H96A 1ZUJA 2XJRA 3AK8A 3BVFA 1TK6A 5FFEA 2OH3A 2FG4A 3KA8A 3UOFA 4RC7A 1NF4A 4KXRB 5JKMA 4CVSA 2WLUA 5K53A 2IU2A 2NYDA 2CN6A 5MFPA 1BCFA 1SMWA 2LCQA 1JTSA 5D8XA 5LG8A 4MXPA 3PIO1 5AXSA 5GU1X 2GYQA 4AR4A 4LQVA 3UFBA 1IROA 5MFZA 4DE6A 2Z3QB 2VZBA 5CMRA 4ZJKA 3ZG6A 2FL0A 3C21A 3KA3A 1CAAA 2MS3A 5AI3A 1VLGA 3WVWA 4CY9A 5ERKA 4KVSA 2ITBA 4TVMA 2J9UB 4PG0A 1RYQA 2ZA7A 4ZN1B 3LKDA 4II4B 3MSUA 1Z92B 3WVUA 3E2CA 2PYBA 2B5ID 2Y3QA 3D19A 5LBHA 1DATA 3PKIA 1FHMA 3OJ5A 3PVRA 4UY81 1YUXA 2IY4A 2QL0A 3KHKA 4AI2A 1NF6A 4II4A 1IERA 1SQ3A 3BVLA 4AR3A 1B71A 2ZIXA 3Q4RA 5JACA 1R0HA 3R2KA 5D8RA 3IS7A 3BKNA 2KN9A 3KYUA 1QYBA 2XJTA 3QQCE 3MPSA 1BQ8A 2PYAA 4U3GA 3E1OA 3VNXA 4CVPA 4CMYA 3RAVA 4DYXA 1RWDA 4JAGA 3HIUA 2L0ZA 2O5JD 5K52A 3VV9A 2ZA8A 4YXJA 5MGNA 5D8YA 1F30A 3ISFA 4REUA 3PW8A 3QHBA 3K35A 1VELA 4WJG4 5GU0X 4GS7D 3JZ9A 1VZIA 1LKMA 4TOBA 4AI3A 2Y44A 3ES3A 5D8SA 2Z5PA 2ZG7X 2V2LA 3OGHA 1T9QA 3AF8X 3BVIA 5GU3X 4TODA 3VPBE 2GMGA 3E1MA 1CADA 3KDQA 4AHWA 2C2FA 2YJKA 4M32A 2C2JA 2VXXA 3KXUA 2BK6A 4MN9A 4E6YA 4AR6A 2MGYA 3HL1A 3H7GA 3C23A 2FG8A 4LQHA 1R0IA 1JKUA 5GAHc 3PKJA 2ZG8X 1LKOA 2AR0A 1SMUA 3A9QA 2V0EA 1O9RA 3BVEA 1VZGA 2G38B 3IQ1A 4TO9A 4Y08A 4XKSA 1J30A 4YVZA 1LTLA 4A25A 4TW3A 2XKQA 1B13A 5MF6A 4EVBA 1JGCA 2CKAA 4W4LB 3F36A 3F35A 1FHHA 1B2JA 4RC7B 1NXGA 4JADA 4MUDA 3E1JA 4YXMA 1NNQA 1YV1A 3SH6A 4B8CD 2VL6A 4V196 3QB9A 1VJXA 3JZAB 5MLC3 1BG7A 1B2OA 2A68D 2QF9A 3GE4A 1VCXA 1S24A 4MJYA 3E6SA 4R42A 1BQ9A 4ITWA 5D8PA 1MOJA 4LQNA 4ME3A 5JDOB 3F37A 1Z6OA 4RC8A 3B08B 2V2OA 3WVVA 3UOIA 5C6FA 3GVYA 1HRSA 4K9FA 4EVEA 5JVH1 1F33A 2WLAA 4ISPA 4PG1A 4RXNA 2FKZA 1QCVA 3J7Z1 3KX9A 3J7Y1 4CVRA 3QHCA 5JDOA 4M34A 3PVRB 3NFPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKO A;  1ZRP A;  4PGK A;  4LYU A;  1DPS A;  1SMM A;  2JD6 0;  3AK9 A;  2Z5Q A;  3PW8 C;  2FZF A;  3FI6 A;  3A44 A;  4P18 A;  1BFR A;  1Z6O M;  4LPJ A;  2RDV A;  3RBC A;  3ERZ A;  1Z4A A;  2XJO A;  3E1P A;  5CMQ A;  4ZLW A;  5GN8 A;  3R2H A;  1IU6 A;  1E8J A;  2CN7 A;  3FVB A;  1LB3 A;  3PWF A;  4AR5 A;  4YKH A;  3Q4Q A;  3AJO A;  1R0G A;  4QUW A;  1O9I A;  1RCC A;  4YWL A;  3Q4N A;  1XZ1 A;  3PVT B;  3PVY A;  3AJP A;  3RZ6 A;  2W0O A;  3EGM A;  2Z5R A;  3R2O A;  4XGS A;  1T9P A;  2F7N A;  1YUZ A;  2UX1 A;  3RGD A;  1H7V A;  3O7S A;  1IRN A;  4ETR A;  3PVT A;  3PWQ A;  5E1U A;  4POF A;  4Z5S A;  4LPM A;  4TOG A;  3KA9 A;  2YW6 A;  2JD7 0;  4MKU A;  1LKP A;  1RDV A;  2V2N A;  3TA8 A;  1BRF A;  2GYD A;  2CEI A;  2V2J A;  2HTN A;  4DAS A;  1OTK A;  1QGH A;  1RDG A;  5HQO A;  1DVB A;  5GU2 X;  4ISM A;  1R0F A;  2V2M A;  4YWM A;  3PZA A;  3GHQ A;  3AF7 X;  5J9V A;  3FSE A;  1TJO A;  4ZKX A;  2XJN A;  5I4J A;  3F33 A;  2X17 0;  4KVQ A;  5FEJ A;  1DX8 A;  1L8H A;  3U90 A;  3KYW A;  3KWO A;  1UMN A;  4DYZ A;  2CHI A;  4RC6 A;  3KYV A;  1RCE A;  4TOE A;  5LG2 A;  2WTL A;  3KYX A;  2CLB A;  3EZU A;  6RXN A;  4TOF A;  3NP0 X;  4TOC A;  3NP2 X;  4LYX A;  5J8W A;  2G4H A;  2FFX J;  3SID A;  1N1Q A;  2QQY A;  2V3B B;  4CYA A;  1TKP A;  2KKD A;  2PVX A;  4TOH A;  2RBD A;  4AM5 A;  5JKL G;  2BKC A;  2HR5 A;  2JD8 0;  5CZU A;  3R2S A;  5FFD A;  2ZUR X;  1T9O A;  2Z90 A;  1BFY A;  1NFV A;  2K2D A;  4LQJ A;  2V2I A;  1JI5 A;  4IWK A;  1VEI A;  4CYB A;  4E6K A;  2C41 A;  5GN8 B;  3F32 A;  3T9J A;  4KVR A;  2GS4 A;  5J93 A;  2XJM A;  4XKU A;  1JIG A;  4TOA A;  5JKL A;  4TPU A;  3F38 A;  3RE7 A;  1SOF A;  3SHX A;  1RB9 A;  5D8Q A;  3PWQ C;  5IX6 A;  5IY0 A;  1IU5 A;  3F39 A;  2ZA6 A;  1JKV A;  2V15 A;  5HJF A;  3SS2 A;  3PVY B;  1UVH A;  1FHA A;  1RYT A;  2CHP A;  3QVD A;  3RD0 A;  3KA4 A;  4M35 A;  4AM2 A;  4ZKH A;  2VXI A;  3E1L A;  3PW1 B;  1JI4 A;  2FJC A;  1EUM A;  2CF7 A;  2V2R A;  5J8S A;  1IES A;  5HJH A;  3AF9 X;  2PVE A;  4OYN A;  4ITT A;  4IXK A;  5AI2 A;  3Q4O A;  3SE1 A;  4Z3B A;  3PW1 A;  3RYG A;  4CMY V;  2CLU A;  4LPN A;  1JRE A;  4POG A;  3A68 A;  4M33 A;  1XZ3 A;  3AJQ A;  3E6R A;  4ZMC A;  3F34 A;  5FFB A;  3R2R A;  2XGW A;  5FFA A;  8RXN A;  1GWG A;  2C6R A;  5D8O A;  3O7R A;  5FFC A;  2V2P A;  4ZKW A;  1YK5 A;  1YK4 A;  4ZL5 A;  1L8I A;  4DYY A;  1BE7 A;  1ZS3 A;  4RC6 B;  2M4Y A;  2BJY A;  5GOU A;  1RCI A;  4MY7 A;  1RCD A;  4RC5 B;  3QZ3 A;  4DZ0 A;  4ML5 A;  4DI0 A;  2FHA A;  1AEW A;  3KYY A;  2ZG9 X;  5E2D A;  4EVD A;  4IWJ A;  3RZT A;  5LS9 A;  4ZL6 A;  3R2M A;  1R0J A;  4ERU A;  4EVC A;  2CIH A;  3EZ0 A;  2BW1 A;  4RC5 A;  5RXN A;  4DYU A;  2C2U A;  1S30 A;  2V2S A;  3BVK A;  3WNW A;  2Z6M A;  3R2L A;  3ISE A;  1RCG A;  1KRQ A;  1VEQ A;  3KA6 A;  2OC5 A;  4ZTT A;  5ERJ A;  3NOZ X;  2DSX A;  1R03 A;  5JKM G;  1MFR A;  1S3Q A;  3QD8 A;  7RXN A;  4PGI A;  2D5K A;  3E1N A;  3UNO A;  4XKT A;  3IS8 A;  3BT5 A;  1JYB A;  4AM4 A;  3E1Q A;  1C09 A;  2YW7 A;  1S2Z A;  2YJJ A;  4CVT A;  2IB0 A;  1H96 A;  1ZUJ A;  3AK8 A;  3BVF A;  1TK6 A;  5FFE A;  2OH3 A;  2FG4 A;  3KA8 A;  3UOF A;  4RC7 A;  1NF4 A;  5JKM A;  4CVS A;  2WLU A;  5K53 A;  2IU2 A;  2CN6 A;  1BCF A;  1SMW A;  2LCQ A;  1JTS A;  5D8X A;  5LG8 A;  5AXS A;  5GU1 X;  2GYQ A;  4AR4 A;  4LQV A;  1IRO A;  4DE6 A;  2VZB A;  5CMR A;  4ZJK A;  2FL0 A;  3KA3 A;  1CAA A;  2MS3 A;  5AI3 A;  1VLG A;  3WVW A;  4CY9 A;  5ERK A;  4KVS A;  2ITB A;  4PG0 A;  2ZA7 A;  4II4 B;  3WVU A;  3E2C A;  2PYB A;  2Y3Q A;  5LBH A;  1DAT A;  1FHM A;  3OJ5 A;  3PVR A;  1YUX A;  2IY4 A;  2QL0 A;  1NF6 A;  4II4 A;  1IER A;  1SQ3 A;  3BVL A;  4AR3 A;  1B71 A;  3Q4R A;  5JAC A;  1R0H A;  3R2K A;  5D8R A;  3IS7 A;  3BKN A;  2KN9 A;  3KYU A;  1QYB A;  3MPS A;  1BQ8 A;  2PYA A;  4U3G A;  3E1O A;  3VNX A;  4CVP A;  4CMY A;  3RAV A;  4DYX A;  1RWD A;  3HIU A;  5K52 A;  2ZA8 A;  5D8Y A;  1F30 A;  3ISF A;  4REU A;  3PW8 A;  3QHB A;  1VEL A;  5GU0 X;  1LKM A;  4TOB A;  3ES3 A;  5D8S A;  2Z5P A;  2ZG7 X;  2V2L A;  3OGH A;  1T9Q A;  3AF8 X;  3BVI A;  5GU3 X;  4TOD A;  2GMG A;  3E1M A;  1CAD A;  2C2F A;  2YJK A;  4M32 A;  2C2J A;  2VXX A;  3KXU A;  2BK6 A;  4MN9 A;  4AR6 A;  3HL1 A;  3H7G A;  2FG8 A;  4LQH A;  1R0I A;  1JKU A;  2ZG8 X;  1LKO A;  1SMU A;  3A9Q A;  1O9R A;  3BVE A;  3IQ1 A;  4TO9 A;  4Y08 A;  4XKS A;  1J30 A;  1LTL A;  4A25 A;  4TW3 A;  2XKQ A;  1B13 A;  4EVB A;  1JGC A;  3F36 A;  3F35 A;  1FHH A;  1B2J A;  4RC7 B;  4MUD A;  3E1J A;  1NNQ A;  1YV1 A;  3SH6 A;  2VL6 A;  3QB9 A;  1VJX A;  1BG7 A;  1B2O A;  2QF9 A;  3GE4 A;  1VCX A;  1S24 A;  4MJY A;  3E6S A;  4R42 A;  1BQ9 A;  4ITW A;  5D8P A;  1MOJ A;  4LQN A;  4ME3 A;  3F37 A;  1Z6O A;  4RC8 A;  2V2O A;  3WVV A;  3UOI A;  5C6F A;  3GVY A;  1HRS A;  4K9F A;  4EVE A;  1F33 A;  2WLA A;  4ISP A;  4PG1 A;  4RXN A;  2FKZ A;  1QCV A;  3KX9 A;  4CVR A;  3QHC A;  4M34 A;  3PVR B; 
#chains in the Genus database with same CATH topology
 1TKO A;  1ZRP A;  4PGK A;  3HOV L;  4LYU A;  1DPS A;  5AN9 H;  1SMM A;  2JD6 0;  3AK9 A;  5DM7 1;  3L0M A;  2Z5Q A;  3HJW B;  4A3M L;  3GTM L;  2PPT A;  5C44 L;  4AI0 A;  5FJ8 L;  3PW8 C;  2FZF A;  3FI6 A;  3M6J A;  1P7P A;  2PSM C;  3A44 A;  4P18 A;  1BFR A;  1Z6O M;  4LPJ A;  2RDV A;  3RBC A;  2M4V A;  3ERZ A;  1Z4A A;  2XJO A;  3E1P A;  5CMQ A;  2AYJ A;  3HAX C;  4ZLW A;  5GN8 A;  2JA6 L;  3R2H A;  5C4J L;  5K2M E;  1IU6 A;  4QIW P;  1E8J A;  2CN7 A;  3FVB A;  1LB3 A;  5JVG 1;  3PWF A;  4AR5 A;  4YKH A;  3Q4Q A;  3AJO A;  2PMZ P;  1R0G A;  4JAE A;  4QUW A;  4G6B A;  4AHY A;  3HOW L;  1O9I A;  1RCC A;  2V0F A;  4YWL A;  3Q4N A;  1XZ1 A;  3PVT B;  3PVY A;  1VZH A;  3AJP A;  2H12 A;  4U67 1;  3RZ6 A;  4A3J L;  2W0O A;  1PZX A;  3HKZ P;  3EGM A;  4A93 L;  5C4X L;  2JI2 A;  2Z5R A;  3R2O A;  4XGS A;  1T9P A;  3RZO L;  2F7N A;  1YUZ A;  2UX1 A;  3RGD A;  1H7V A;  4AHZ A;  3O7S A;  3PO2 L;  1IRN A;  4ETR A;  3PVT A;  3PWQ A;  3JR7 A;  5E1U A;  4A3G L;  4POF A;  4Z5S A;  4LPM A;  4TOG A;  3KA9 A;  2YW6 A;  2JD7 0;  2B63 L;  4MKU A;  4A3I L;  2JA8 L;  1LKP A;  1RDV A;  2V2N A;  3TA8 A;  1BRF A;  2GYD A;  2CEI A;  2V2J A;  2HTN A;  4W4K B;  4DAS A;  1OTK A;  1QGH A;  2ERS A;  1RDG A;  5HQO A;  1DVB A;  5GU2 X;  1OWC A;  3LWR B;  4ISM A;  1R0F A;  3HOX L;  1F4L A;  2V2M A;  4YWM A;  3PZA A;  3FRS A;  3GHQ A;  2C6A A;  3AF7 X;  5J9V A;  3FSE A;  1TJO A;  4ZKX A;  1SFO L;  2XJN A;  5I4J A;  3VVA A;  3F33 A;  2X17 0;  4KVQ A;  2JA7 L;  5FEJ A;  5EIO C;  1DX8 A;  3WWN B;  1ODH A;  1L8H A;  3U90 A;  3KYW A;  3V3K B;  3KWO A;  1UMN A;  4DYZ A;  2CHI A;  4RC6 A;  3KYV A;  1RCE A;  4TOE A;  5LG2 A;  2WTL A;  3KYX A;  2CLB A;  4A3E L;  4WFN 1;  2M6O A;  3EZU A;  6RXN A;  2A69 D;  3GTQ L;  4TOF A;  2BE5 D;  3NP0 X;  4TOC A;  3NP2 X;  4LYX A;  5J8W A;  2G4H A;  2FFX J;  3SID A;  4E40 A;  3HOZ L;  1N1Q A;  2QQY A;  2V3B B;  2XJV A;  4CYA A;  3C1Y A;  1TKP A;  2KKD A;  2PVX A;  5M3F L;  4TOH A;  5H1S c;  3HOY L;  2RBD A;  3S1Q L;  4AM5 A;  3S2D L;  5JKL G;  2BKC A;  2V8U A;  5M5W L;  2HR5 A;  3HOU L;  5GAE c;  2JD8 0;  2ERJ A;  5CZU A;  3K7A L;  3R2S A;  5FFD A;  2ZUR X;  1T9O A;  3GTJ L;  2Z90 A;  3M4O L;  1BFY A;  1NFV A;  2K2D A;  4LQJ A;  2V2I A;  1JI5 A;  4IWK A;  1VEI A;  4CYB A;  4BBS L;  4E6K A;  2C41 A;  3FRR A;  5GN8 B;  3F32 A;  3T9J A;  4KVR A;  2GS4 A;  5J93 A;  2XJM A;  4XKU A;  1JIG A;  4TOA A;  5JKL A;  4TPU A;  1IW7 D;  3F38 A;  3RE7 A;  1SOF A;  1PFW A;  4JAF A;  5EIN C;  3SHX A;  1RB9 A;  5D8Q A;  3PWQ C;  5IX6 A;  1QQT A;  1Y1V L;  2XJP A;  5IY0 A;  1IU5 A;  4ZN3 B;  3F39 A;  2A6H D;  3H97 A;  2JI1 A;  2XJU A;  5GAG c;  2ZA6 A;  4AHX A;  1JKV A;  2V15 A;  3DBY A;  5HJF A;  3SS2 A;  3GGY A;  3PVY B;  1UVH A;  1FHA A;  1RYT A;  2JA5 L;  3GTL L;  2CHP A;  3HJY B;  3QVD A;  3RD0 A;  2R92 L;  3KA4 A;  4M35 A;  4AM2 A;  4ZKH A;  3FKI L;  3WWL A;  3S14 L;  2VXI A;  2E2H L;  3E1L A;  3PW1 B;  4C2M 1;  3P8B A;  3GTO L;  1JI4 A;  2FJC A;  1EUM A;  2CF7 A;  2V2R A;  5J8S A;  1IES A;  5HJH A;  3AF9 X;  2PVE A;  3IU3 I;  4OYN A;  1WCM L;  4ITT A;  4IXK A;  2HVY C;  5AI2 A;  1I6H L;  3Q4O A;  4AYB P;  3SE1 A;  4Z3B A;  3PW1 A;  3RYG A;  4CMY V;  2XJS A;  5HU6 D;  2CLU A;  2N02 A;  4LPN A;  1JRE A;  4POG A;  5DM6 1;  3A68 A;  4M33 A;  2CR8 A;  1XZ3 A;  3AJQ A;  3E6R A;  4ZMC A;  3F34 A;  3W54 A;  2NVY L;  2A6E D;  5FFB A;  4LHL A;  3R2R A;  5IP7 L;  2XGW A;  5FFA A;  8RXN A;  1GWG A;  2E2I L;  2C6R A;  3FDJ A;  2CWL A;  3H0G L;  4LHN A;  5D8O A;  3O7R A;  5FFC A;  4C3J L;  3S16 L;  2V2P A;  4ZKW A;  1YK5 A;  2RFK B;  2XJQ A;  2WWX B;  2M6P A;  4XXB B;  2E2J L;  4X0J A;  1YK4 A;  1I50 L;  4ZL5 A;  1L8I A;  4DYY A;  1BE7 A;  4AI1 A;  2YU9 L;  1ZS3 A;  4RC6 B;  2M4Y A;  2BJY A;  3C1Z A;  5GOU A;  1RCI A;  4MY7 A;  2C6B A;  1RCD A;  2OKC A;  1OWB A;  4RC5 B;  3QZ3 A;  3GTG L;  4DZ0 A;  2CKC A;  4ML5 A;  4DI0 A;  2FHA A;  1AEW A;  3KYY A;  3S17 L;  2R7Z L;  3N6O A;  2ZG9 X;  3LPE B;  5E2D A;  4EVD A;  3B0A B;  4IWJ A;  3I4N L;  4A3K L;  3RZT A;  3P2A A;  4XGH A;  5LS9 A;  4ZL6 A;  3R2M A;  1R0J A;  4ERU A;  4EVC A;  2CIH A;  3EZ0 A;  2BW1 A;  3S1N L;  4RC5 A;  5RXN A;  4DYU A;  2C2U A;  1S30 A;  2V8T A;  3S1M L;  2V2S A;  3BVK A;  3WNW A;  1PFV A;  1WJV A;  2Z6M A;  3PL5 A;  3S1R L;  2NVQ L;  3LNL A;  3R2L A;  3ISE A;  5GAD c;  1RCG A;  1KRQ A;  1NXE A;  1VEQ A;  3KA6 A;  2OC5 A;  4ZTT A;  5ERJ A;  3NOZ X;  2DSX A;  1R03 A;  5JKM G;  1MFR A;  1S3Q A;  1K83 L;  3QD8 A;  7RXN A;  3LWV B;  4Y7N L;  4A3B L;  4PGI A;  2D5K A;  3E1N A;  3UNO A;  4XKT A;  1PFY A;  3PIP 1;  3MQK B;  2Z3R B;  3IS8 A;  3BT5 A;  1JYB A;  2JI3 A;  4AM4 A;  3H99 A;  3E1Q A;  1C09 A;  5M5Y L;  2YW7 A;  2WAQ P;  1S2Z A;  3GGZ A;  2YJJ A;  4CVT A;  2IB0 A;  3LWO B;  1H96 A;  1ZUJ A;  2XJR A;  3AK8 A;  3BVF A;  1TK6 A;  5FFE A;  2OH3 A;  2FG4 A;  3KA8 A;  3UOF A;  4RC7 A;  1NF4 A;  4C3H L;  4KXR B;  5JKM A;  4CVS A;  2WLU A;  5K53 A;  2IU2 A;  2NYD A;  2CN6 A;  5MFP A;  1BCF A;  1SMW A;  2LCQ A;  1JTS A;  5D8X A;  5LG8 A;  4MXP A;  3PIO 1;  1PFU A;  5AXS A;  5GU1 X;  3PO3 L;  2GYQ A;  4BBR L;  2NVT L;  3H9B A;  4AR4 A;  4LQV A;  3UFB A;  1IRO A;  5MFZ A;  4DE6 A;  2VUM L;  4A3C L;  2Z3Q B;  2VZB A;  5CMR A;  4ZJK A;  3ZG6 A;  2FL0 A;  3C21 A;  3KA3 A;  1CAA A;  2MS3 A;  5AI3 A;  3GTK L;  1VLG A;  3WVW A;  5IYB L;  4CY9 A;  5ERK A;  4KVS A;  3LWQ B;  2ITB A;  4TVM A;  2J9U B;  4PG0 A;  1RYQ A;  2ZA7 A;  4ZN1 B;  3LKD A;  4II4 B;  3MSU A;  1Z92 B;  3WVU A;  3E2C A;  2PYB A;  2B5I D;  2Y3Q A;  3D19 A;  3S2H L;  5LBH A;  1DAT A;  3PKI A;  1FHM A;  2R93 L;  3OJ5 A;  3PVR A;  4UY8 1;  3M3Y L;  1YUX A;  2IY4 A;  2QL0 A;  3KHK A;  4BXX L;  4AI2 A;  1NF6 A;  4II4 A;  1TWG L;  1IER A;  1SQ3 A;  3BVL A;  4AR3 A;  4Y52 L;  1B71 A;  2ZIX A;  3Q4R A;  5JAC A;  1R0H A;  3R2K A;  5D8R A;  3IS7 A;  3BKN A;  2KN9 A;  3KYU A;  1QYB A;  2XJT A;  4C3I L;  3QQC E;  3MPS A;  5C3E L;  1BQ8 A;  4X6A L;  2PYA A;  4U3G A;  3E1O A;  3VNX A;  4CVP A;  4CMY A;  3RAV A;  4DYX A;  1RWD A;  4JAG A;  3HIU A;  2L0Z A;  1TWH L;  2O5J D;  5K52 A;  3VV9 A;  4A3L L;  3RZD L;  2ZA8 A;  4YXJ A;  5MGN A;  3GTP L;  5D8Y A;  1F30 A;  3ISF A;  4REU A;  3PW8 A;  3QHB A;  2APO B;  3K35 A;  1VEL A;  4WJG 4;  5GU0 X;  4GS7 D;  3JZ9 A;  1VZI A;  1LKM A;  5M3M L;  2NVX L;  5IYC L;  4TOB A;  1Y1W L;  4AI3 A;  2Y44 A;  3ES3 A;  5D8S A;  2Z5P A;  2ZG7 X;  2V2L A;  3OGH A;  1T9Q A;  3AF8 X;  3BVI A;  5GU3 X;  1I3Q L;  4TOD A;  3VPB E;  2GMG A;  3E1M A;  1CAD A;  3KDQ A;  4BY1 L;  4AHW A;  2C2F A;  2YJK A;  4M32 A;  2C2J A;  2VXX A;  3KXU A;  1TWA L;  1TWC L;  2BK6 A;  4MN9 A;  4E6Y A;  4AR6 A;  2MGY A;  3HL1 A;  3H7G A;  3C23 A;  2FG8 A;  4LQH A;  1R0I A;  3H3V M;  1JKU A;  5GAH c;  3PKJ A;  2ZG8 X;  1LKO A;  2AR0 A;  1SMU A;  3A9Q A;  2V0E A;  5FLM L;  1O9R A;  3BVE A;  2AQC A;  3S15 L;  1VZG A;  2G38 B;  3IQ1 A;  4TO9 A;  4A3F L;  4Y08 A;  4XKS A;  1J30 A;  2Y0S P;  4YVZ A;  1LTL A;  4A25 A;  4TW3 A;  2XKQ A;  1B13 A;  2EY4 E;  5MF6 A;  4EVB A;  1JGC A;  3CQZ L;  2CKA A;  4W4L B;  3F36 A;  3F35 A;  1FHH A;  1B2J A;  4RC7 B;  1NXG A;  4JAD A;  4MUD A;  3E1J A;  4BY7 L;  4YXM A;  1NNQ A;  1YV1 A;  3SH6 A;  4B8C D;  2VL6 A;  4V19 6;  2WB1 P;  3QB9 A;  1VJX A;  3JZA B;  5MLC 3;  4A3D L;  1BG7 A;  1B2O A;  2A68 D;  2QF9 A;  3GE4 A;  1VCX A;  1S24 A;  4MJY A;  3E6S A;  4R42 A;  1BQ9 A;  3H9C A;  5IP9 L;  4ITW A;  5D8P A;  1MOJ A;  4LQN A;  1TWF L;  4ME3 A;  5JDO B;  3F37 A;  1Z6O A;  4RC8 A;  3B08 B;  2V2O A;  3WVV A;  3UOI A;  5C6F A;  1R9T L;  3GVY A;  1HRS A;  4K9F A;  4EVE A;  5JVH 1;  1F33 A;  2WLA A;  4ISP A;  4PG1 A;  4RXN A;  2FKZ A;  1QCV A;  3J7Z 1;  3I4M L;  5M5X L;  3KX9 A;  3J7Y 1;  3LWP B;  4CVR A;  3QHC A;  5JDO A;  2AUS B;  4M34 A;  3PVR B;  3NFP I;  5IYD L; 
#chains in the Genus database with same CATH homology
 1TKO A;  1ZRP A;  4PGK A;  4LYU A;  1DPS A;  5AN9 H;  1SMM A;  2JD6 0;  3AK9 A;  5DM7 1;  3L0M A;  2Z5Q A;  2PPT A;  4AI0 A;  3PW8 C;  2FZF A;  3FI6 A;  3M6J A;  2PSM C;  3A44 A;  4P18 A;  1BFR A;  1Z6O M;  4LPJ A;  2RDV A;  3RBC A;  2M4V A;  3ERZ A;  1Z4A A;  2XJO A;  3E1P A;  5CMQ A;  2AYJ A;  4ZLW A;  5GN8 A;  3R2H A;  5K2M E;  1IU6 A;  1E8J A;  2CN7 A;  3FVB A;  1LB3 A;  5JVG 1;  3PWF A;  4AR5 A;  4YKH A;  3Q4Q A;  3AJO A;  1R0G A;  4JAE A;  4QUW A;  4G6B A;  4AHY A;  1O9I A;  1RCC A;  2V0F A;  4YWL A;  3Q4N A;  1XZ1 A;  3PVT B;  3PVY A;  1VZH A;  3AJP A;  2H12 A;  4U67 1;  3RZ6 A;  2W0O A;  3EGM A;  2JI2 A;  2Z5R A;  3R2O A;  4XGS A;  1T9P A;  2F7N A;  1YUZ A;  2UX1 A;  3RGD A;  1H7V A;  4AHZ A;  3O7S A;  1IRN A;  4ETR A;  3PVT A;  3PWQ A;  5E1U A;  4POF A;  4Z5S A;  4LPM A;  4TOG A;  3KA9 A;  2YW6 A;  2JD7 0;  4MKU A;  1LKP A;  1RDV A;  2V2N A;  3TA8 A;  1BRF A;  2GYD A;  2CEI A;  2V2J A;  2HTN A;  4W4K B;  4DAS A;  1OTK A;  1QGH A;  2ERS A;  1RDG A;  5HQO A;  1DVB A;  5GU2 X;  1OWC A;  4ISM A;  1R0F A;  2V2M A;  4YWM A;  3PZA A;  3FRS A;  3GHQ A;  2C6A A;  3AF7 X;  5J9V A;  3FSE A;  1TJO A;  4ZKX A;  2XJN A;  5I4J A;  3VVA A;  3F33 A;  2X17 0;  4KVQ A;  5FEJ A;  5EIO C;  1DX8 A;  3WWN B;  1ODH A;  1L8H A;  3U90 A;  3KYW A;  3V3K B;  3KWO A;  1UMN A;  4DYZ A;  2CHI A;  4RC6 A;  3KYV A;  1RCE A;  4TOE A;  5LG2 A;  2WTL A;  3KYX A;  2CLB A;  4WFN 1;  2M6O A;  3EZU A;  6RXN A;  2A69 D;  4TOF A;  2BE5 D;  3NP0 X;  4TOC A;  3NP2 X;  4LYX A;  5J8W A;  2G4H A;  2FFX J;  3SID A;  4E40 A;  1N1Q A;  2QQY A;  2V3B B;  2XJV A;  4CYA A;  3C1Y A;  1TKP A;  2KKD A;  2PVX A;  4TOH A;  5H1S c;  2RBD A;  4AM5 A;  5JKL G;  2BKC A;  2V8U A;  2HR5 A;  5GAE c;  2JD8 0;  2ERJ A;  5CZU A;  3R2S A;  5FFD A;  2ZUR X;  1T9O A;  2Z90 A;  1BFY A;  1NFV A;  2K2D A;  4LQJ A;  2V2I A;  1JI5 A;  4IWK A;  1VEI A;  4CYB A;  4E6K A;  2C41 A;  3FRR A;  5GN8 B;  3F32 A;  3T9J A;  4KVR A;  2GS4 A;  5J93 A;  2XJM A;  4XKU A;  1JIG A;  4TOA A;  5JKL A;  4TPU A;  1IW7 D;  3F38 A;  3RE7 A;  1SOF A;  4JAF A;  5EIN C;  3SHX A;  1RB9 A;  5D8Q A;  3PWQ C;  5IX6 A;  2XJP A;  5IY0 A;  1IU5 A;  4ZN3 B;  3F39 A;  2A6H D;  2JI1 A;  2XJU A;  5GAG c;  2ZA6 A;  4AHX A;  1JKV A;  2V15 A;  3DBY A;  5HJF A;  3SS2 A;  3GGY A;  3PVY B;  1UVH A;  1FHA A;  1RYT A;  2CHP A;  3QVD A;  3RD0 A;  3KA4 A;  4M35 A;  4AM2 A;  4ZKH A;  3WWL A;  2VXI A;  3E1L A;  3PW1 B;  3P8B A;  1JI4 A;  2FJC A;  1EUM A;  2CF7 A;  2V2R A;  5J8S A;  1IES A;  5HJH A;  3AF9 X;  2PVE A;  3IU3 I;  4OYN A;  4ITT A;  4IXK A;  5AI2 A;  3Q4O A;  3SE1 A;  4Z3B A;  3PW1 A;  3RYG A;  4CMY V;  2XJS A;  5HU6 D;  2CLU A;  2N02 A;  4LPN A;  1JRE A;  4POG A;  5DM6 1;  3A68 A;  4M33 A;  2CR8 A;  1XZ3 A;  3AJQ A;  3E6R A;  4ZMC A;  3F34 A;  3W54 A;  2A6E D;  5FFB A;  4LHL A;  3R2R A;  2XGW A;  5FFA A;  8RXN A;  1GWG A;  2C6R A;  2CWL A;  4LHN A;  5D8O A;  3O7R A;  5FFC A;  2V2P A;  4ZKW A;  1YK5 A;  2XJQ A;  2WWX B;  2M6P A;  4XXB B;  4X0J A;  1YK4 A;  4ZL5 A;  1L8I A;  4DYY A;  1BE7 A;  4AI1 A;  1ZS3 A;  4RC6 B;  2M4Y A;  2BJY A;  3C1Z A;  5GOU A;  1RCI A;  4MY7 A;  2C6B A;  1RCD A;  2OKC A;  1OWB A;  4RC5 B;  3QZ3 A;  4DZ0 A;  2CKC A;  4ML5 A;  4DI0 A;  2FHA A;  1AEW A;  3KYY A;  3N6O A;  2ZG9 X;  3LPE B;  5E2D A;  4EVD A;  3B0A B;  4IWJ A;  3RZT A;  3P2A A;  4XGH A;  5LS9 A;  4ZL6 A;  3R2M A;  1R0J A;  4ERU A;  4EVC A;  2CIH A;  3EZ0 A;  2BW1 A;  4RC5 A;  5RXN A;  4DYU A;  2C2U A;  1S30 A;  2V8T A;  2V2S A;  3BVK A;  3WNW A;  1WJV A;  2Z6M A;  3LNL A;  3R2L A;  3ISE A;  5GAD c;  1RCG A;  1KRQ A;  1NXE A;  1VEQ A;  3KA6 A;  2OC5 A;  4ZTT A;  5ERJ A;  3NOZ X;  2DSX A;  1R03 A;  5JKM G;  1MFR A;  1S3Q A;  3QD8 A;  7RXN A;  4PGI A;  2D5K A;  3E1N A;  3UNO A;  4XKT A;  3PIP 1;  2Z3R B;  3IS8 A;  3BT5 A;  1JYB A;  2JI3 A;  4AM4 A;  3E1Q A;  1C09 A;  2YW7 A;  1S2Z A;  3GGZ A;  2YJJ A;  4CVT A;  2IB0 A;  1H96 A;  1ZUJ A;  2XJR A;  3AK8 A;  3BVF A;  1TK6 A;  5FFE A;  2OH3 A;  2FG4 A;  3KA8 A;  3UOF A;  4RC7 A;  1NF4 A;  4KXR B;  5JKM A;  4CVS A;  2WLU A;  5K53 A;  2IU2 A;  2NYD A;  2CN6 A;  5MFP A;  1BCF A;  1SMW A;  2LCQ A;  1JTS A;  5D8X A;  5LG8 A;  4MXP A;  3PIO 1;  5AXS A;  5GU1 X;  2GYQ A;  4AR4 A;  4LQV A;  3UFB A;  1IRO A;  5MFZ A;  4DE6 A;  2Z3Q B;  2VZB A;  5CMR A;  4ZJK A;  3ZG6 A;  2FL0 A;  3C21 A;  3KA3 A;  1CAA A;  2MS3 A;  5AI3 A;  1VLG A;  3WVW A;  4CY9 A;  5ERK A;  4KVS A;  2ITB A;  4TVM A;  2J9U B;  4PG0 A;  1RYQ A;  2ZA7 A;  4ZN1 B;  3LKD A;  4II4 B;  3MSU A;  1Z92 B;  3WVU A;  3E2C A;  2PYB A;  2B5I D;  2Y3Q A;  3D19 A;  5LBH A;  1DAT A;  3PKI A;  1FHM A;  3OJ5 A;  3PVR A;  4UY8 1;  1YUX A;  2IY4 A;  2QL0 A;  3KHK A;  4AI2 A;  1NF6 A;  4II4 A;  1IER A;  1SQ3 A;  3BVL A;  4AR3 A;  1B71 A;  2ZIX A;  3Q4R A;  5JAC A;  1R0H A;  3R2K A;  5D8R A;  3IS7 A;  3BKN A;  2KN9 A;  3KYU A;  1QYB A;  2XJT A;  3QQC E;  3MPS A;  1BQ8 A;  2PYA A;  4U3G A;  3E1O A;  3VNX A;  4CVP A;  4CMY A;  3RAV A;  4DYX A;  1RWD A;  4JAG A;  3HIU A;  2L0Z A;  2O5J D;  5K52 A;  3VV9 A;  2ZA8 A;  4YXJ A;  5MGN A;  5D8Y A;  1F30 A;  3ISF A;  4REU A;  3PW8 A;  3QHB A;  3K35 A;  1VEL A;  4WJG 4;  5GU0 X;  4GS7 D;  3JZ9 A;  1VZI A;  1LKM A;  4TOB A;  4AI3 A;  2Y44 A;  3ES3 A;  5D8S A;  2Z5P A;  2ZG7 X;  2V2L A;  3OGH A;  1T9Q A;  3AF8 X;  3BVI A;  5GU3 X;  4TOD A;  3VPB E;  2GMG A;  3E1M A;  1CAD A;  3KDQ A;  4AHW A;  2C2F A;  2YJK A;  4M32 A;  2C2J A;  2VXX A;  3KXU A;  2BK6 A;  4MN9 A;  4E6Y A;  4AR6 A;  2MGY A;  3HL1 A;  3H7G A;  3C23 A;  2FG8 A;  4LQH A;  1R0I A;  1JKU A;  5GAH c;  3PKJ A;  2ZG8 X;  1LKO A;  2AR0 A;  1SMU A;  3A9Q A;  2V0E A;  1O9R A;  3BVE A;  1VZG A;  2G38 B;  3IQ1 A;  4TO9 A;  4Y08 A;  4XKS A;  1J30 A;  4YVZ A;  1LTL A;  4A25 A;  4TW3 A;  2XKQ A;  1B13 A;  5MF6 A;  4EVB A;  1JGC A;  2CKA A;  4W4L B;  3F36 A;  3F35 A;  1FHH A;  1B2J A;  4RC7 B;  1NXG A;  4JAD A;  4MUD A;  3E1J A;  4YXM A;  1NNQ A;  1YV1 A;  3SH6 A;  4B8C D;  2VL6 A;  4V19 6;  3QB9 A;  1VJX A;  3JZA B;  5MLC 3;  1BG7 A;  1B2O A;  2A68 D;  2QF9 A;  3GE4 A;  1VCX A;  1S24 A;  4MJY A;  3E6S A;  4R42 A;  1BQ9 A;  4ITW A;  5D8P A;  1MOJ A;  4LQN A;  4ME3 A;  5JDO B;  3F37 A;  1Z6O A;  4RC8 A;  3B08 B;  2V2O A;  3WVV A;  3UOI A;  5C6F A;  3GVY A;  1HRS A;  4K9F A;  4EVE A;  5JVH 1;  1F33 A;  2WLA A;  4ISP A;  4PG1 A;  4RXN A;  2FKZ A;  1QCV A;  3J7Z 1;  3KX9 A;  3J7Y 1;  4CVR A;  3QHC A;  5JDO A;  4M34 A;  3PVR B;  3NFP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...