3QVDA

Exposure of rubrerythrin from pyrococcus furiosus to peroxide, fifteen second time point.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
VVKRTMTKKFLEEAFAGESMAHMRYLIFAEKAEQEGFPNIAKLFRAIAYAEFVHAKNHFIALGKLGKTPENLQMGIEGETFEVEEMYPVYNKAAEFQGEKEAVRTTHYALEAEKIHAELYRKAKEKAEKGEDIEIKKVYICPICGYTAVDEAPEYCPVCGAPKEKFVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Rubrerythrin
publication title A cryo-crystallographic time course for peroxide reduction by rubrerythrin from Pyrococcus furiosus.
pubmed doi rcsb
total genus 62
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3qvdA01
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3qvdA02
3QHBA 4LPMA 1RCIA 3U90A 4P18A 2CHPA 2Z5QA 4REUA 1B2OA 1JKVA 2CN6A 3O7RA 3F35A 2X170 3KA9A 4RC8A 5D8SA 1ZRPA 2XJNA 3FSEA 3Q4OA 2C2FA 2YJJA 4XKUA 3WVUA 4TOBA 1SMMA 1R0GA 5FFBA 3NP2X 4M35A 2Y3QA 5HJFA 5E1UA 1B13A 4IWKA 4ITWA 4DASA 3BVKA 3QVDA 2V2LA 3OJ5A 2FZFA 3RD0A 1VJXA 2GYQA 5JKLG 3QHCA 1FHMA 1BFYA 2KKDA 1SOFA 4CMYV 2QL0A 4TOGA 2BKCA 2VL6A 5FFDA 3F36A 3BVLA 5LG8A 5FFAA 4AR3A 3A9QA 1TKPA 3IS8A 5RXNA 1LTLA 4PG0A 5HJHA 3PVYB 3R2HA 3KYWA 4CVSA 3A68A 3Q4RA 2MS3A 3QZ3A 5GN8A 1VLGA 3EGMA 1LB3A 3UNOA 7RXNA 2C6RA 1BQ8A 4ITTA 2QF9A 2ZA6A 1ZUJA 3R2KA 3PW8A 4DYUA 3RE7A 1YV1A 2PYAA 3RZTA 4ETRA 3R2RA 2CLBA 1MFRA 5JACA 6RXNA 2HTNA 1JKUA 4AR6A 4ISPA 2W0OA 3E6RA 2ZA8A 2ZG8X 4MN9A 2IY4A 2V2NA 4RC7A 4POFA 2ZG7X 4TO9A 4TOFA 1JREA 3PW1B 4OYNA 2KN9A 2Z5RA 2ZG9X 4DYYA 4ZMCA 1Z6OA 1NFVA 4RXNA 4IWJA 2YW6A 4Z3BA 2F7NA 1BRFA 3PW1A 1VEQA 2FHAA 4E6KA 1NF6A 3PW8C 4ZL5A 1J30A 4CVRA 3AJOA 4ME3A 2XGWA 1RCDA 5GU1X 5K52A 1BQ9A 2ZA7A 5GU2X 1H7VA 3AF7X 3HL1A 4ZLWA 2CIHA 2VXXA 2WLAA 1B2JA 4POGA 5AI3A 3KYVA 1Z4AA 4DYXA 1LKPA 4XKTA 1F33A 3PVTA 4ZKHA 1VCXA 4LPJA 3R2SA 5GOUA 4IXKA 3SHXA 3R2MA 2V2IA 1VEIA 2RBDA 3R2OA 4ZJKA 3NP0X 4CYBA 3E2CA 4DZ0A 1L8IA 5GU3X 1KRQA 2VZBA 1YK5A 3HIUA 1RDGA 2BK6A 4EVCA 1UMNA 4TOCA 2GMGA 2PVEA 1SMWA 3WVWA 1N1QA 3F32A 4AM4A 1FHAA 3BT5A 3RZ6A 2ZURX 4M33A 2V15A 1RDVA 4RC6A 1TK6A 4TOAA 4LQVA 1RB9A 4R42A 3AK9A 4LQNA 3BVFA 5JKMA 1CAAA 3EZ0A 4EVBA 4LYUA 5GN8B 1O9IA 3E1OA 1LKOA 4RC5B 1RCCA 2YW7A 4CY9A 4M34A 4MKUA 1YUXA 1R03A 1DPSA 5FFEA 1BFRA 4RC5A 2D5KA 3RGDA 1T9QA 1E8JA 5AI2A 5I4JA 1ZS3A 1T9OA 1IERA 4KVSA 5J93A 4PGIA 1R0FA 3IS7A 1CADA 3EZUA 1H96A 1S2ZA 3E1JA 4MUDA 1Z6OM 4K9FA 3F39A 1RWDA 1C09A 3WNWA 4RC7B 3R2LA 2CN7A 4CVPA 1DX8A 3OGHA 4TW3A 2YJKA 1MOJA 5E2DA 5J8SA 4ERUA 4Y08A 2XJOA 4CMYA 1R0JA 3RBCA 3RAVA 3PWFA 3AK8A 3BVIA 2DSXA 3RYGA 1JIGA 2Z6MA 2JD80 2QQYA 5HQOA 1IU5A 1TJOA 4YKHA 4DI0A 1S30A 4II4B 4Z5SA 4ZKXA 2PVXA 3PZAA 8RXNA 2CF7A 3TA8A 1UVHA 1IRNA 2GYDA 3SE1A 2C41A 4QUWA 3T9JA 2FFXJ 4EVEA 2V2SA 3GE4A 4ISMA 4II4A 2RDVA 4ZTTA 3PVRA 4AM2A 3PWQA 2BW1A 3PVTB 3Q4QA 5J8WA 4LPNA 4TPUA 1R0HA 2CLUA 5ERKA 1IROA 4ML5A 5D8XA 1S24A 1IESA 4MJYA 3AJPA 3F33A 5CMQA 4XGSA 4CVTA 2V2JA 2XJMA 1OTKA 2V2MA 2GS4A 5GU0X 2WTLA 3H7GA 3UOIA 3A44A 4YWMA 2VXIA 1HRSA 3QD8A 3SH6A 1QYBA 2CEIA 2ITBA 5D8OA 4AR4A 5IY0A 3E6SA 4CYAA 4RC6B 2UX1A 1EUMA 4LQJA 5CZUA 2C2UA 5ERJA 3ES3A 2OC5A 3BVEA 4M32A 1B71A 3KA8A 4AR5A 1JGCA 1T9PA 3E1QA 3PWQC 4MY7A 2LCQA 3FVBA 4KVQA 1JYBA 4TOEA 4EVDA 2IB0A 5JKMG 3E1MA 4U3GA 2OH3A 4AM5A 3ERZA 2Z5PA 3QB9A 1F30A 5JKLA 1NNQA 2V3BB 1R0IA 3Q4NA 4PGKA 1LKMA 1FHHA 3AF8X 2BJYA 2IU2A 1JI5A 5D8QA 2V2RA 3BKNA 5LS9A 3WVVA 3UOFA 3IQ1A 5D8PA 1S3QA 1SQ3A 3F38A 3KXUA 2V2OA 5AXSA 1NF4A 1QCVA 2G4HA 4ZKWA 3SS2A 2FL0A 5LG2A 2FJCA 2C2JA 3ISFA 2JD60 4XKSA 4LQHA 5K53A 3PVYA 2JD70 2XKQA 1RCEA 1BE7A 1BCFA 3KA6A 4A25A 1TKOA 2Z90A 5D8RA 2HR5A 3F37A 3FI6A 3ISEA 2FG4A 2FG8A 2WLUA 5LBHA 4YWLA 3VNXA 3E1PA 2K2DA 3MPSA 5IX6A 1O9RA 4LYXA 2M4YA 1JI4A 3AJQA 1XZ1A 1RCGA 1RYTA 3PVRB 3KYXA 5FEJA 3SIDA 2PYBA 1IU6A 1BG7A 5C6FA 3KA3A 1YK4A 3F34A 4KVRA 4TOHA 3KA4A 2FKZA 3AF9X 3KX9A 4TODA 1DVBA 2V2PA 1AEWA 1QGHA 4DYZA 3E1NA 4DE6A 1L8HA 4PG1A 5J9VA 5FFCA 1VELA 3KYYA 1YUZA 1XZ3A 3GVYA 3NOZX 3KWOA 1SMUA 4ZL6A 3GHQA 3KYUA 1DATA 3E1LA 1JTSA 3O7SA 1GWGA 5CMRA 5D8YA 2CHIA
chains in the Genus database with same CATH superfamily
3QHBA 4LPMA 1RCIA 3U90A 4P18A 3H9CA 2CHPA 2Z5QA 4REUA 1B2OA 1JKVA 2CN6A 3O7RA 4TVMA 3F35A 2X170 3KA9A 4RC8A 5D8SA 1ZRPA 2XJNA 3FSEA 3Q4OA 2C2FA 2YJJA 2R92L 4LHNA 4XKUA 3WVUA 2M4VA 4BY7L 3DBYA 4TOBA 1SMMA 3GGYA 1R0GA 5FFBA 3JZAB 3S16L 2M6PA 3NP2X 4M35A 2Y3QA 5HJFA 5E1UA 2E2HL 2R7ZL 1B13A 4IWKA 4ITWA 4DASA 3S1ML 3B08B 3BVKA 1Y1VL 3QVDA 3LWOB 2V2LA 2A6HD 3OJ5A 2FZFA 1WCML 3RD0A 1VJXA 2GYQA 2AQCA 1VZIA 5HU6D 1OWCA 5JKLG 4GS7D 3I4ML 3QHCA 1FHMA 4XXBB 2KKDA 1BFYA 3W54A 1SOFA 4CMYV 2QL0A 2E2JL 4TOGA 2HVYC 1OWBA 2BKCA 4W4KB 2VL6A 5FFDA 3PIO1 3F36A 4A3IL 3I4NL 2CKAA 3BVLA 5LG8A 1I3QL 4BY1L 5FFAA 3H99A 4AR3A 3A9QA 1TKPA 3IS8A 2E2IL 5RXNA 1LTLA 4PG0A 5HJHA 3PVYB 3R2HA 2N02A 3LWRB 3UFBA 3S17L 3KYWA 3M4OL 3KHKA 4CVSA 2JA5L 3A68A 3Q4RA 2VUML 5DM71 2MS3A 4AHYA 3QZ3A 5GN8A 1VLGA 3L0MA 2AYJA 3GGZA 3EGMA 3H97A 1LB3A 3N6OA 2JA6L 3UNOA 7RXNA 5C4XL 2C6RA 1BQ8A 4ITTA 3S1NL 2QF9A 2ZA6A 1ZUJA 3R2KA 3PW8A 4DYUA 3RE7A 1YV1A 3KDQA 2PYAA 4BXXL 4A3LL 3RZTA 1TWGL 3HOUL 4ETRA 3R2RA 2CLBA 1MFRA 5JACA 1TWHL 2Z3QB 5JVG1 6RXNA 4AHXA 3GTML 2HTNA 4X0JA 3CQZL 1JKUA 4AR6A 3HJWB 2JI2A 4ISPA 3JR7A 2W0OA 3WWNB 3E6RA 1R9TL 2ZA8A 3M6JA 4A3FL 2ZG8X 4MN9A 2NYDA 2IY4A 2V2NA 4RC7A 4POFA 2ZG7X 4TO9A 4TOFA 3GTGL 5GAHc 1JREA 4C3IL 3PW1B 4OYNA 2KN9A 2Z5RA 4C3HL 2ZG9X 4DYYA 4ZMCA 1Z6OA 3GTOL 1NFVA 4X6AL 4RXNA 3HAXC 5IYBL 5C3EL 4IWJA 2WAQP 5MGNA 4ZN3B 2YW6A 4Z3BA 2F7NA 1BRFA 3PW1A 1VEQA 3J7Y1 2FHAA 3HOVL 4E6KA 1NF6A 3PW8C 4ZL5A 2JI3A 1J30A 4CVRA 2XJPA 3AJOA 4ME3A 2XGWA 1RCDA 5GU1X 5K52A 1BQ9A 2ZA7A 2EY4E 5GU2X 2OKCA 4G6BA 1H7VA 3AF7X 2C6AA 3HL1A 4ZLWA 2CIHA 2VXXA 2WLAA 3GTJL 1B2JA 4POGA 5AI3A 4ZN1B 2WWXB 3S14L 3KYVA 4AHZA 1Z4AA 4DYXA 1LKPA 4XKTA 3B0AB 1F33A 3PVTA 3S2HL 4ZKHA 5M5XL 1VCXA 4LPJA 3R2SA 5GOUA 4IXKA 3SHXA 2Y44A 3R2MA 2V2IA 1VEIA 4E40A 3S15L 2RBDA 3C1ZA 3R2OA 5MF6A 2A6ED 5JVH1 4ZJKA 3NP0X 1SFOL 4U671 4CYBA 5GAEc 3E2CA 4DZ0A 1L8IA 5GU3X 1KRQA 1PFWA 2VZBA 1YK5A 4C3JL 3HIUA 1RDGA 1TWAL 2BK6A 4EVCA 1UMNA 4TOCA 2GMGA 4A3DL 2PVEA 1SMWA 4YXJA 5AN9H 3LWPB 3WVWA 2J9UB 1N1QA 3F32A 4AM4A 1FHAA 3BT5A 3PO2L 3RZ6A 2ZURX 4M33A 2V15A 3HOXL 4AHWA 1RDVA 4RC6A 1TK6A 4TOAA 4LQVA 1RB9A 2O5JD 4R42A 3AK9A 2NVYL 5FLML 4LQNA 2PSMC 4AI1A 3BVFA 5JKMA 1CAAA 3H9BA 3EZ0A 4EVBA 3V3KB 2G38B 4LYUA 5GN8B 1NXGA 4BBRL 1O9IA 3E1OA 1LKOA 4RC5B 1RCCA 3GTLL 2YW7A 4CY9A 4A3GL 1NXEA 3K35A 3S1RL 4M34A 1PZXA 4MKUA 1TWFL 1YUXA 1R03A 2PMZP 1DPSA 3K7AL 5FFEA 1BFRA 4RC5A 5MFZA 2D5KA 3RGDA 1T9QA 2XJSA 5AI2A 3H3VM 1E8JA 3PO3L 5I4JA 1ZS3A 1T9OA 1IERA 4KVSA 5J93A 4PGIA 3P2AA 1R0FA 2A68D 3IS7A 1CADA 5DM61 4AI2A 3EZUA 5JDOB 1H96A 3LPEB 2BE5D 1S2ZA 3E1JA 4MUDA 1Z6OM 4K9FA 3F39A 4A3JL 4A3EL 3NFPI 1RWDA 1C09A 3PKIA 3WNWA 4E6YA 1PFUA 5K2ME 4RC7B 3R2LA 2CN7A 4CVPA 3MSUA 1DX8A 3OGHA 4TW3A 2YJKA 2JA8L 1MOJA 5E2DA 5JDOA 1ODHA 5J8SA 4ERUA 2JA7L 4Y08A 2XJOA 4CMYA 1R0JA 3RBCA 3RAVA 2AUSB 3PWFA 3AK8A 3BVIA 4LHLA 2DSXA 3RYGA 4V196 1JIGA 5GADc 2XJVA 2Z6MA 2JD80 2QQYA 3P8BA 5HQOA 1IU5A 2A69D 1TJOA 4YKHA 4DI0A 3S1QL 2APOB 1S30A 3HOZL 4II4B 4Z5SA 4ZKXA 2PVXA 3PZAA 8RXNA 2CF7A 4YVZA 3TA8A 2V0FA 1UVHA 1IRNA 2GYDA 3SE1A 2C41A 4QUWA 4A3BL 2CKCA 3RZDL 3T9JA 2FFXJ 4EVEA 2V2SA 3GE4A 4ISMA 4II4A 1K83L 2RDVA 3HKZP 5MFPA 5IYCL 3GTKL 4ZTTA 1Z92B 3PVRA 4AM2A 3IU3I 2CR8A 3PWQA 5M3ML 2BW1A 2V8UA 3PVTB 3Q4QA 5J8WA 4LPNA 4TPUA 3S2DL 1R0HA 2CLUA 2ERJA 5ERKA 1IROA 2XJQA 4ML5A 3FRSA 5D8XA 1S24A 1IESA 4MJYA 3AJPA 3D19A 3F33A 5CMQA 1I6HL 1F4LA 4AI3A 4XGSA 4CVTA 4A93L 2V2JA 2XJMA 4QIWP 1OTKA 2NVQL 2V2MA 3GTPL 2GS4A 5GU0X 2WTLA 3H7GA 3UOIA 3A44A 4YWMA 2VXIA 3FRRA 1HRSA 3QD8A 3PKJA 2CWLA 3SH6A 5M5WL 1QYBA 2CEIA 2ITBA 5D8OA 4AR4A 2RFKB 4JAEA 5IY0A 5IP7L 3E6SA 4CYAA 4RC6B 2UX1A 1EUMA 4LQJA 5CZUA 1PFYA 4Y7NL 2M6OA 5M5YL 2C2UA 5ERJA 3ES3A 3LKDA 2OC5A 4B8CD 4BBSL 3BVEA 4M32A 2AR0A 1B71A 3KA8A 4Y52L 4AR5A 1JGCA 1PFVA 1T9PA 3E1QA 3PWQC 3MQKB 4MY7A 1TWCL 2LCQA 3FVBA 4KVQA 1JYBA 4TOEA 2NVTL 4EVDA 2IB0A 1IW7D 5JKMG 3E1MA 5IYDL 4U3GA 2C6BA 2OH3A 2L0ZA 4AM5A 4KXRB 3ERZA 3LNLA 2Z5PA 3QB9A 1F30A 5JKLA 1NNQA 2V3BB 1R0IA 3Q4NA 4PGKA 1LKMA 2XJUA 3PIP1 1FHHA 3AF8X 3ZG6A 1VZGA 2BJYA 2IU2A 3C1YA 3QQCE 3VVAA 1JI5A 5D8QA 1VZHA 1QQTA 2V2RA 3BKNA 5LS9A 3WVVA 3UOFA 3IQ1A 3LWQB 5D8PA 1S3QA 2NVXL 1SQ3A 5C4JL 3F38A 3KXUA 2V2OA 4A3ML 5AXSA 3GTQL 1NF4A 1QCVA 2G4HA 4ZKWA 3SS2A 2FL0A 4YXMA 3VV9A 3RZOL 5LG2A 3FDJA 5EIOC 4W4LB 2FJCA 3H0GL 2C2JA 3ISFA 4JAGA 3LWVB 2JD60 2V8TA 2PPTA 4XKSA 4LQHA 5K53A 4A3KL 3PVYA 2JD70 2XKQA 1RCEA 5FJ8L 1BE7A 1BCFA 3KA6A 4A25A 1TKOA 2Z90A 5D8RA 2HR5A 3F37A 3FI6A 1RYQA 2B5ID 3ISEA 2FG4A 2FG8A 2WLUA 3JZ9A 5LBHA 4MXPA 1Y1WL 4YWLA 3VNXA 3E1PA 4WFN1 2K2DA 3FKIL 2YU9L 3MPSA 2MGYA 4WJG4 5IX6A 1O9RA 4LYXA 4C2M1 4XGHA 2M4YA 1JI4A 3AJQA 1XZ1A 5EINC 5GAGc 1RCGA 1RYTA 3PVRB 1WJVA 3KYXA 5FEJA 5MLC3 3SIDA 2PYBA 1IU6A 2XJTA 1BG7A 5C6FA 3KA3A 1YK4A 2WB1P 4JAFA 3M3YL 3F34A 4KVRA 4TOHA 3J7Z1 3KA4A 2H12A 2R93L 2FKZA 2Z3RB 3AF9X 3KX9A 4TODA 1DVBA 2V2PA 3C23A 1AEWA 1QGHA 4DYZA 3E1NA 4AYBP 3PL5A 4DE6A 2XJRA 1L8HA 3HOWL 4AI0A 3HJYB 4PG1A 5J9VA 2ZIXA 5FFCA 5C44L 1VELA 1P7PA 3KYYA 1YUZA 4UY81 1XZ3A 3GVYA 3NOZX 3KWOA 1SMUA 4ZL6A 3GHQA 3KYUA 1DATA 3E1LA 3C21A 3VPBE 1JTSA 3O7SA 1GWGA 5CMRA 5M3FL 4A3CL 5IP9L 2B63L 2V0EA 4JADA 2JI1A 2Y0SP 1I50L 5D8YA 3HOYL 2CHIA 5H1Sc 2ERSA 3WWLA
chains in the Genus database with same CATH topology
3QHBA 4LPMA 1RCIA 3U90A 4P18A 2CHPA 2Z5QA 4REUA 1B2OA 1JKVA 2CN6A 3O7RA 4TVMA 3F35A 2X170 3KA9A 4RC8A 5D8SA 1ZRPA 2XJNA 3FSEA 3Q4OA 2C2FA 2YJJA 4LHNA 4XKUA 3WVUA 2M4VA 3DBYA 4TOBA 1SMMA 3GGYA 1R0GA 5FFBA 3JZAB 2M6PA 3NP2X 4M35A 2Y3QA 5HJFA 5E1UA 1B13A 4IWKA 4ITWA 4DASA 3B08B 3BVKA 3QVDA 2V2LA 2A6HD 3OJ5A 2FZFA 3RD0A 1VJXA 2GYQA 1VZIA 5HU6D 1OWCA 5JKLG 4GS7D 3QHCA 1FHMA 4XXBB 2KKDA 1BFYA 3W54A 1SOFA 4CMYV 2QL0A 4TOGA 1OWBA 2BKCA 4W4KB 2VL6A 5FFDA 3PIO1 3F36A 2CKAA 3BVLA 5LG8A 5FFAA 4AR3A 3A9QA 1TKPA 3IS8A 5RXNA 1LTLA 4PG0A 5HJHA 3PVYB 3R2HA 2N02A 3UFBA 3KYWA 3KHKA 4CVSA 3A68A 3Q4RA 5DM71 2MS3A 4AHYA 3QZ3A 5GN8A 1VLGA 3L0MA 2AYJA 3GGZA 3EGMA 1LB3A 3N6OA 3UNOA 7RXNA 2C6RA 1BQ8A 4ITTA 2QF9A 2ZA6A 1ZUJA 3R2KA 3PW8A 4DYUA 3RE7A 1YV1A 3KDQA 2PYAA 3RZTA 4ETRA 3R2RA 2CLBA 1MFRA 5JACA 2Z3QB 5JVG1 6RXNA 4AHXA 2HTNA 4X0JA 1JKUA 4AR6A 2JI2A 4ISPA 2W0OA 3WWNB 3E6RA 2ZA8A 3M6JA 2ZG8X 4MN9A 2NYDA 2IY4A 2V2NA 4RC7A 4POFA 2ZG7X 4TO9A 4TOFA 5GAHc 1JREA 3PW1B 4OYNA 2KN9A 2Z5RA 2ZG9X 4DYYA 4ZMCA 1Z6OA 1NFVA 4RXNA 4IWJA 5MGNA 4ZN3B 2YW6A 4Z3BA 2F7NA 1BRFA 3PW1A 1VEQA 3J7Y1 2FHAA 4E6KA 1NF6A 3PW8C 4ZL5A 2JI3A 1J30A 4CVRA 2XJPA 3AJOA 4ME3A 2XGWA 1RCDA 5GU1X 5K52A 1BQ9A 2ZA7A 5GU2X 2OKCA 4G6BA 1H7VA 3AF7X 2C6AA 3HL1A 4ZLWA 2CIHA 2VXXA 2WLAA 1B2JA 4POGA 5AI3A 4ZN1B 2WWXB 3KYVA 4AHZA 1Z4AA 4DYXA 1LKPA 4XKTA 3B0AB 1F33A 3PVTA 4ZKHA 1VCXA 4LPJA 3R2SA 5GOUA 4IXKA 3SHXA 2Y44A 3R2MA 2V2IA 1VEIA 4E40A 2RBDA 3C1ZA 3R2OA 5MF6A 2A6ED 5JVH1 4ZJKA 3NP0X 4U671 4CYBA 5GAEc 3E2CA 4DZ0A 1L8IA 5GU3X 1KRQA 2VZBA 1YK5A 3HIUA 1RDGA 2BK6A 4EVCA 1UMNA 4TOCA 2GMGA 2PVEA 1SMWA 4YXJA 5AN9H 3WVWA 2J9UB 1N1QA 3F32A 4AM4A 1FHAA 3BT5A 3RZ6A 2ZURX 4M33A 2V15A 4AHWA 1RDVA 4RC6A 1TK6A 4TOAA 4LQVA 1RB9A 2O5JD 4R42A 3AK9A 4LQNA 2PSMC 4AI1A 3BVFA 5JKMA 1CAAA 3EZ0A 4EVBA 3V3KB 2G38B 4LYUA 5GN8B 1NXGA 1O9IA 3E1OA 1LKOA 4RC5B 1RCCA 2YW7A 4CY9A 1NXEA 3K35A 4M34A 4MKUA 1YUXA 1R03A 1DPSA 5FFEA 1BFRA 4RC5A 5MFZA 2D5KA 3RGDA 1T9QA 2XJSA 5AI2A 1E8JA 5I4JA 1ZS3A 1T9OA 1IERA 4KVSA 5J93A 4PGIA 3P2AA 1R0FA 2A68D 3IS7A 1CADA 5DM61 4AI2A 3EZUA 5JDOB 1H96A 3LPEB 2BE5D 1S2ZA 3E1JA 4MUDA 1Z6OM 4K9FA 3F39A 3NFPI 1RWDA 1C09A 3PKIA 3WNWA 4E6YA 5K2ME 4RC7B 3R2LA 2CN7A 4CVPA 3MSUA 1DX8A 3OGHA 4TW3A 2YJKA 1MOJA 5E2DA 5JDOA 1ODHA 5J8SA 4ERUA 4Y08A 2XJOA 4CMYA 1R0JA 3RBCA 3RAVA 3PWFA 3AK8A 3BVIA 4LHLA 2DSXA 3RYGA 4V196 1JIGA 5GADc 2XJVA 2Z6MA 2JD80 2QQYA 3P8BA 5HQOA 1IU5A 2A69D 1TJOA 4YKHA 4DI0A 1S30A 4II4B 4Z5SA 4ZKXA 2PVXA 3PZAA 8RXNA 2CF7A 4YVZA 3TA8A 2V0FA 1UVHA 1IRNA 2GYDA 3SE1A 2C41A 4QUWA 2CKCA 3T9JA 2FFXJ 4EVEA 2V2SA 3GE4A 4ISMA 4II4A 2RDVA 5MFPA 4ZTTA 1Z92B 3PVRA 4AM2A 3IU3I 2CR8A 3PWQA 2BW1A 2V8UA 3PVTB 3Q4QA 5J8WA 4LPNA 4TPUA 1R0HA 2CLUA 2ERJA 5ERKA 1IROA 2XJQA 4ML5A 3FRSA 5D8XA 1S24A 1IESA 4MJYA 3AJPA 3D19A 3F33A 5CMQA 4AI3A 4XGSA 4CVTA 2V2JA 2XJMA 1OTKA 2V2MA 2GS4A 5GU0X 2WTLA 3H7GA 3UOIA 3A44A 4YWMA 2VXIA 3FRRA 1HRSA 3QD8A 3PKJA 2CWLA 3SH6A 1QYBA 2CEIA 2ITBA 5D8OA 4AR4A 4JAEA 5IY0A 3E6SA 4CYAA 4RC6B 2UX1A 1EUMA 4LQJA 5CZUA 2M6OA 2C2UA 5ERJA 3ES3A 3LKDA 2OC5A 4B8CD 3BVEA 4M32A 2AR0A 1B71A 3KA8A 4AR5A 1JGCA 1T9PA 3E1QA 3PWQC 4MY7A 2LCQA 3FVBA 4KVQA 1JYBA 4TOEA 4EVDA 2IB0A 1IW7D 5JKMG 3E1MA 4U3GA 2C6BA 2OH3A 2L0ZA 4AM5A 4KXRB 3ERZA 3LNLA 2Z5PA 3QB9A 1F30A 5JKLA 1NNQA 2V3BB 1R0IA 3Q4NA 4PGKA 1LKMA 2XJUA 3PIP1 1FHHA 3AF8X 3ZG6A 1VZGA 2BJYA 2IU2A 3C1YA 3QQCE 3VVAA 1JI5A 5D8QA 1VZHA 2V2RA 3BKNA 5LS9A 3WVVA 3UOFA 3IQ1A 5D8PA 1S3QA 1SQ3A 3F38A 3KXUA 2V2OA 5AXSA 1NF4A 1QCVA 2G4HA 4ZKWA 3SS2A 2FL0A 4YXMA 3VV9A 5LG2A 5EIOC 4W4LB 2FJCA 2C2JA 3ISFA 4JAGA 2JD60 2V8TA 2PPTA 4XKSA 4LQHA 5K53A 3PVYA 2JD70 2XKQA 1RCEA 1BE7A 1BCFA 3KA6A 4A25A 1TKOA 2Z90A 5D8RA 2HR5A 3F37A 3FI6A 1RYQA 2B5ID 3ISEA 2FG4A 2FG8A 2WLUA 3JZ9A 5LBHA 4MXPA 4YWLA 3VNXA 3E1PA 4WFN1 2K2DA 3MPSA 2MGYA 4WJG4 5IX6A 1O9RA 4LYXA 4XGHA 2M4YA 1JI4A 3AJQA 1XZ1A 5EINC 5GAGc 1RCGA 1RYTA 3PVRB 1WJVA 3KYXA 5FEJA 5MLC3 3SIDA 2PYBA 1IU6A 2XJTA 1BG7A 5C6FA 3KA3A 1YK4A 4JAFA 3F34A 4KVRA 4TOHA 3J7Z1 3KA4A 2H12A 2FKZA 2Z3RB 3AF9X 3KX9A 4TODA 1DVBA 2V2PA 3C23A 1AEWA 1QGHA 4DYZA 3E1NA 4DE6A 2XJRA 1L8HA 4AI0A 4PG1A 5J9VA 2ZIXA 5FFCA 1VELA 3KYYA 4UY81 1YUZA 1XZ3A 3GVYA 3NOZX 3KWOA 1SMUA 4ZL6A 3GHQA 3KYUA 1DATA 3E1LA 3C21A 3VPBE 1JTSA 3O7SA 1GWGA 5CMRA 2V0EA 4JADA 2JI1A 5D8YA 2CHIA 5H1Sc 2ERSA 3WWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHB A;  4LPM A;  1RCI A;  3U90 A;  4P18 A;  2CHP A;  2Z5Q A;  4REU A;  1B2O A;  1JKV A;  2CN6 A;  3O7R A;  3F35 A;  2X17 0;  3KA9 A;  4RC8 A;  5D8S A;  1ZRP A;  2XJN A;  3FSE A;  3Q4O A;  2C2F A;  2YJJ A;  4XKU A;  3WVU A;  4TOB A;  1SMM A;  1R0G A;  5FFB A;  3NP2 X;  4M35 A;  2Y3Q A;  5HJF A;  5E1U A;  1B13 A;  4IWK A;  4ITW A;  4DAS A;  3BVK A;  3QVD A;  2V2L A;  3OJ5 A;  2FZF A;  3RD0 A;  1VJX A;  2GYQ A;  5JKL G;  3QHC A;  1FHM A;  1BFY A;  2KKD A;  1SOF A;  4CMY V;  2QL0 A;  4TOG A;  2BKC A;  2VL6 A;  5FFD A;  3F36 A;  3BVL A;  5LG8 A;  5FFA A;  4AR3 A;  3A9Q A;  1TKP A;  3IS8 A;  5RXN A;  1LTL A;  4PG0 A;  5HJH A;  3PVY B;  3R2H A;  3KYW A;  4CVS A;  3A68 A;  3Q4R A;  2MS3 A;  3QZ3 A;  5GN8 A;  1VLG A;  3EGM A;  1LB3 A;  3UNO A;  7RXN A;  2C6R A;  1BQ8 A;  4ITT A;  2QF9 A;  2ZA6 A;  1ZUJ A;  3R2K A;  3PW8 A;  4DYU A;  3RE7 A;  1YV1 A;  2PYA A;  3RZT A;  4ETR A;  3R2R A;  2CLB A;  1MFR A;  5JAC A;  6RXN A;  2HTN A;  1JKU A;  4AR6 A;  4ISP A;  2W0O A;  3E6R A;  2ZA8 A;  2ZG8 X;  4MN9 A;  2IY4 A;  2V2N A;  4RC7 A;  4POF A;  2ZG7 X;  4TO9 A;  4TOF A;  1JRE A;  3PW1 B;  4OYN A;  2KN9 A;  2Z5R A;  2ZG9 X;  4DYY A;  4ZMC A;  1Z6O A;  1NFV A;  4RXN A;  4IWJ A;  2YW6 A;  4Z3B A;  2F7N A;  1BRF A;  3PW1 A;  1VEQ A;  2FHA A;  4E6K A;  1NF6 A;  3PW8 C;  4ZL5 A;  1J30 A;  4CVR A;  3AJO A;  4ME3 A;  2XGW A;  1RCD A;  5GU1 X;  5K52 A;  1BQ9 A;  2ZA7 A;  5GU2 X;  1H7V A;  3AF7 X;  3HL1 A;  4ZLW A;  2CIH A;  2VXX A;  2WLA A;  1B2J A;  4POG A;  5AI3 A;  3KYV A;  1Z4A A;  4DYX A;  1LKP A;  4XKT A;  1F33 A;  3PVT A;  4ZKH A;  1VCX A;  4LPJ A;  3R2S A;  5GOU A;  4IXK A;  3SHX A;  3R2M A;  2V2I A;  1VEI A;  2RBD A;  3R2O A;  4ZJK A;  3NP0 X;  4CYB A;  3E2C A;  4DZ0 A;  1L8I A;  5GU3 X;  1KRQ A;  2VZB A;  1YK5 A;  3HIU A;  1RDG A;  2BK6 A;  4EVC A;  1UMN A;  4TOC A;  2GMG A;  2PVE A;  1SMW A;  3WVW A;  1N1Q A;  3F32 A;  4AM4 A;  1FHA A;  3BT5 A;  3RZ6 A;  2ZUR X;  4M33 A;  2V15 A;  1RDV A;  4RC6 A;  1TK6 A;  4TOA A;  4LQV A;  1RB9 A;  4R42 A;  3AK9 A;  4LQN A;  3BVF A;  5JKM A;  1CAA A;  3EZ0 A;  4EVB A;  4LYU A;  5GN8 B;  1O9I A;  3E1O A;  1LKO A;  4RC5 B;  1RCC A;  2YW7 A;  4CY9 A;  4M34 A;  4MKU A;  1YUX A;  1R03 A;  1DPS A;  5FFE A;  1BFR A;  4RC5 A;  2D5K A;  3RGD A;  1T9Q A;  1E8J A;  5AI2 A;  5I4J A;  1ZS3 A;  1T9O A;  1IER A;  4KVS A;  5J93 A;  4PGI A;  1R0F A;  3IS7 A;  1CAD A;  3EZU A;  1H96 A;  1S2Z A;  3E1J A;  4MUD A;  1Z6O M;  4K9F A;  3F39 A;  1RWD A;  1C09 A;  3WNW A;  4RC7 B;  3R2L A;  2CN7 A;  4CVP A;  1DX8 A;  3OGH A;  4TW3 A;  2YJK A;  1MOJ A;  5E2D A;  5J8S A;  4ERU A;  4Y08 A;  2XJO A;  4CMY A;  1R0J A;  3RBC A;  3RAV A;  3PWF A;  3AK8 A;  3BVI A;  2DSX A;  3RYG A;  1JIG A;  2Z6M A;  2JD8 0;  2QQY A;  5HQO A;  1IU5 A;  1TJO A;  4YKH A;  4DI0 A;  1S30 A;  4II4 B;  4Z5S A;  4ZKX A;  2PVX A;  3PZA A;  8RXN A;  2CF7 A;  3TA8 A;  1UVH A;  1IRN A;  2GYD A;  3SE1 A;  2C41 A;  4QUW A;  3T9J A;  2FFX J;  4EVE A;  2V2S A;  3GE4 A;  4ISM A;  4II4 A;  2RDV A;  4ZTT A;  3PVR A;  4AM2 A;  3PWQ A;  2BW1 A;  3PVT B;  3Q4Q A;  5J8W A;  4LPN A;  4TPU A;  1R0H A;  2CLU A;  5ERK A;  1IRO A;  4ML5 A;  5D8X A;  1S24 A;  1IES A;  4MJY A;  3AJP A;  3F33 A;  5CMQ A;  4XGS A;  4CVT A;  2V2J A;  2XJM A;  1OTK A;  2V2M A;  2GS4 A;  5GU0 X;  2WTL A;  3H7G A;  3UOI A;  3A44 A;  4YWM A;  2VXI A;  1HRS A;  3QD8 A;  3SH6 A;  1QYB A;  2CEI A;  2ITB A;  5D8O A;  4AR4 A;  5IY0 A;  3E6S A;  4CYA A;  4RC6 B;  2UX1 A;  1EUM A;  4LQJ A;  5CZU A;  2C2U A;  5ERJ A;  3ES3 A;  2OC5 A;  3BVE A;  4M32 A;  1B71 A;  3KA8 A;  4AR5 A;  1JGC A;  1T9P A;  3E1Q A;  3PWQ C;  4MY7 A;  2LCQ A;  3FVB A;  4KVQ A;  1JYB A;  4TOE A;  4EVD A;  2IB0 A;  5JKM G;  3E1M A;  4U3G A;  2OH3 A;  4AM5 A;  3ERZ A;  2Z5P A;  3QB9 A;  1F30 A;  5JKL A;  1NNQ A;  2V3B B;  1R0I A;  3Q4N A;  4PGK A;  1LKM A;  1FHH A;  3AF8 X;  2BJY A;  2IU2 A;  1JI5 A;  5D8Q A;  2V2R A;  3BKN A;  5LS9 A;  3WVV A;  3UOF A;  3IQ1 A;  5D8P A;  1S3Q A;  1SQ3 A;  3F38 A;  3KXU A;  2V2O A;  5AXS A;  1NF4 A;  1QCV A;  2G4H A;  4ZKW A;  3SS2 A;  2FL0 A;  5LG2 A;  2FJC A;  2C2J A;  3ISF A;  2JD6 0;  4XKS A;  4LQH A;  5K53 A;  3PVY A;  2JD7 0;  2XKQ A;  1RCE A;  1BE7 A;  1BCF A;  3KA6 A;  4A25 A;  1TKO A;  2Z90 A;  5D8R A;  2HR5 A;  3F37 A;  3FI6 A;  3ISE A;  2FG4 A;  2FG8 A;  2WLU A;  5LBH A;  4YWL A;  3VNX A;  3E1P A;  2K2D A;  3MPS A;  5IX6 A;  1O9R A;  4LYX A;  2M4Y A;  1JI4 A;  3AJQ A;  1XZ1 A;  1RCG A;  1RYT A;  3PVR B;  3KYX A;  5FEJ A;  3SID A;  2PYB A;  1IU6 A;  1BG7 A;  5C6F A;  3KA3 A;  1YK4 A;  3F34 A;  4KVR A;  4TOH A;  3KA4 A;  2FKZ A;  3AF9 X;  3KX9 A;  4TOD A;  1DVB A;  2V2P A;  1AEW A;  1QGH A;  4DYZ A;  3E1N A;  4DE6 A;  1L8H A;  4PG1 A;  5J9V A;  5FFC A;  1VEL A;  3KYY A;  1YUZ A;  1XZ3 A;  3GVY A;  3NOZ X;  3KWO A;  1SMU A;  4ZL6 A;  3GHQ A;  3KYU A;  1DAT A;  3E1L A;  1JTS A;  3O7S A;  1GWG A;  5CMR A;  5D8Y A;  2CHI A; 
#chains in the Genus database with same CATH topology
 3QHB A;  4LPM A;  1RCI A;  3U90 A;  4P18 A;  3H9C A;  2CHP A;  2Z5Q A;  4REU A;  1B2O A;  1JKV A;  2CN6 A;  3O7R A;  4TVM A;  3F35 A;  2X17 0;  3KA9 A;  4RC8 A;  5D8S A;  1ZRP A;  2XJN A;  3FSE A;  3Q4O A;  2C2F A;  2YJJ A;  2R92 L;  4LHN A;  4XKU A;  3WVU A;  2M4V A;  4BY7 L;  3DBY A;  4TOB A;  1SMM A;  3GGY A;  1R0G A;  5FFB A;  3JZA B;  3S16 L;  2M6P A;  3NP2 X;  4M35 A;  2Y3Q A;  5HJF A;  5E1U A;  2E2H L;  2R7Z L;  1B13 A;  4IWK A;  4ITW A;  4DAS A;  3S1M L;  3B08 B;  3BVK A;  1Y1V L;  3QVD A;  3LWO B;  2V2L A;  2A6H D;  3OJ5 A;  2FZF A;  1WCM L;  3RD0 A;  1VJX A;  2GYQ A;  2AQC A;  1VZI A;  5HU6 D;  1OWC A;  5JKL G;  4GS7 D;  3I4M L;  3QHC A;  1FHM A;  4XXB B;  2KKD A;  1BFY A;  3W54 A;  1SOF A;  4CMY V;  2QL0 A;  2E2J L;  4TOG A;  2HVY C;  1OWB A;  2BKC A;  4W4K B;  2VL6 A;  5FFD A;  3PIO 1;  3F36 A;  4A3I L;  3I4N L;  2CKA A;  3BVL A;  5LG8 A;  1I3Q L;  4BY1 L;  5FFA A;  3H99 A;  4AR3 A;  3A9Q A;  1TKP A;  3IS8 A;  2E2I L;  5RXN A;  1LTL A;  4PG0 A;  5HJH A;  3PVY B;  3R2H A;  2N02 A;  3LWR B;  3UFB A;  3S17 L;  3KYW A;  3M4O L;  3KHK A;  4CVS A;  2JA5 L;  3A68 A;  3Q4R A;  2VUM L;  5DM7 1;  2MS3 A;  4AHY A;  3QZ3 A;  5GN8 A;  1VLG A;  3L0M A;  2AYJ A;  3GGZ A;  3EGM A;  3H97 A;  1LB3 A;  3N6O A;  2JA6 L;  3UNO A;  7RXN A;  5C4X L;  2C6R A;  1BQ8 A;  4ITT A;  3S1N L;  2QF9 A;  2ZA6 A;  1ZUJ A;  3R2K A;  3PW8 A;  4DYU A;  3RE7 A;  1YV1 A;  3KDQ A;  2PYA A;  4BXX L;  4A3L L;  3RZT A;  1TWG L;  3HOU L;  4ETR A;  3R2R A;  2CLB A;  1MFR A;  5JAC A;  1TWH L;  2Z3Q B;  5JVG 1;  6RXN A;  4AHX A;  3GTM L;  2HTN A;  4X0J A;  3CQZ L;  1JKU A;  4AR6 A;  3HJW B;  2JI2 A;  4ISP A;  3JR7 A;  2W0O A;  3WWN B;  3E6R A;  1R9T L;  2ZA8 A;  3M6J A;  4A3F L;  2ZG8 X;  4MN9 A;  2NYD A;  2IY4 A;  2V2N A;  4RC7 A;  4POF A;  2ZG7 X;  4TO9 A;  4TOF A;  3GTG L;  5GAH c;  1JRE A;  4C3I L;  3PW1 B;  4OYN A;  2KN9 A;  2Z5R A;  4C3H L;  2ZG9 X;  4DYY A;  4ZMC A;  1Z6O A;  3GTO L;  1NFV A;  4X6A L;  4RXN A;  3HAX C;  5IYB L;  5C3E L;  4IWJ A;  2WAQ P;  5MGN A;  4ZN3 B;  2YW6 A;  4Z3B A;  2F7N A;  1BRF A;  3PW1 A;  1VEQ A;  3J7Y 1;  2FHA A;  3HOV L;  4E6K A;  1NF6 A;  3PW8 C;  4ZL5 A;  2JI3 A;  1J30 A;  4CVR A;  2XJP A;  3AJO A;  4ME3 A;  2XGW A;  1RCD A;  5GU1 X;  5K52 A;  1BQ9 A;  2ZA7 A;  2EY4 E;  5GU2 X;  2OKC A;  4G6B A;  1H7V A;  3AF7 X;  2C6A A;  3HL1 A;  4ZLW A;  2CIH A;  2VXX A;  2WLA A;  3GTJ L;  1B2J A;  4POG A;  5AI3 A;  4ZN1 B;  2WWX B;  3S14 L;  3KYV A;  4AHZ A;  1Z4A A;  4DYX A;  1LKP A;  4XKT A;  3B0A B;  1F33 A;  3PVT A;  3S2H L;  4ZKH A;  5M5X L;  1VCX A;  4LPJ A;  3R2S A;  5GOU A;  4IXK A;  3SHX A;  2Y44 A;  3R2M A;  2V2I A;  1VEI A;  4E40 A;  3S15 L;  2RBD A;  3C1Z A;  3R2O A;  5MF6 A;  2A6E D;  5JVH 1;  4ZJK A;  3NP0 X;  1SFO L;  4U67 1;  4CYB A;  5GAE c;  3E2C A;  4DZ0 A;  1L8I A;  5GU3 X;  1KRQ A;  1PFW A;  2VZB A;  1YK5 A;  4C3J L;  3HIU A;  1RDG A;  1TWA L;  2BK6 A;  4EVC A;  1UMN A;  4TOC A;  2GMG A;  4A3D L;  2PVE A;  1SMW A;  4YXJ A;  5AN9 H;  3LWP B;  3WVW A;  2J9U B;  1N1Q A;  3F32 A;  4AM4 A;  1FHA A;  3BT5 A;  3PO2 L;  3RZ6 A;  2ZUR X;  4M33 A;  2V15 A;  3HOX L;  4AHW A;  1RDV A;  4RC6 A;  1TK6 A;  4TOA A;  4LQV A;  1RB9 A;  2O5J D;  4R42 A;  3AK9 A;  2NVY L;  5FLM L;  4LQN A;  2PSM C;  4AI1 A;  3BVF A;  5JKM A;  1CAA A;  3H9B A;  3EZ0 A;  4EVB A;  3V3K B;  2G38 B;  4LYU A;  5GN8 B;  1NXG A;  4BBR L;  1O9I A;  3E1O A;  1LKO A;  4RC5 B;  1RCC A;  3GTL L;  2YW7 A;  4CY9 A;  4A3G L;  1NXE A;  3K35 A;  3S1R L;  4M34 A;  1PZX A;  4MKU A;  1TWF L;  1YUX A;  1R03 A;  2PMZ P;  1DPS A;  3K7A L;  5FFE A;  1BFR A;  4RC5 A;  5MFZ A;  2D5K A;  3RGD A;  1T9Q A;  2XJS A;  5AI2 A;  3H3V M;  1E8J A;  3PO3 L;  5I4J A;  1ZS3 A;  1T9O A;  1IER A;  4KVS A;  5J93 A;  4PGI A;  3P2A A;  1R0F A;  2A68 D;  3IS7 A;  1CAD A;  5DM6 1;  4AI2 A;  3EZU A;  5JDO B;  1H96 A;  3LPE B;  2BE5 D;  1S2Z A;  3E1J A;  4MUD A;  1Z6O M;  4K9F A;  3F39 A;  4A3J L;  4A3E L;  3NFP I;  1RWD A;  1C09 A;  3PKI A;  3WNW A;  4E6Y A;  1PFU A;  5K2M E;  4RC7 B;  3R2L A;  2CN7 A;  4CVP A;  3MSU A;  1DX8 A;  3OGH A;  4TW3 A;  2YJK A;  2JA8 L;  1MOJ A;  5E2D A;  5JDO A;  1ODH A;  5J8S A;  4ERU A;  2JA7 L;  4Y08 A;  2XJO A;  4CMY A;  1R0J A;  3RBC A;  3RAV A;  2AUS B;  3PWF A;  3AK8 A;  3BVI A;  4LHL A;  2DSX A;  3RYG A;  4V19 6;  1JIG A;  5GAD c;  2XJV A;  2Z6M A;  2JD8 0;  2QQY A;  3P8B A;  5HQO A;  1IU5 A;  2A69 D;  1TJO A;  4YKH A;  4DI0 A;  3S1Q L;  2APO B;  1S30 A;  3HOZ L;  4II4 B;  4Z5S A;  4ZKX A;  2PVX A;  3PZA A;  8RXN A;  2CF7 A;  4YVZ A;  3TA8 A;  2V0F A;  1UVH A;  1IRN A;  2GYD A;  3SE1 A;  2C41 A;  4QUW A;  4A3B L;  2CKC A;  3RZD L;  3T9J A;  2FFX J;  4EVE A;  2V2S A;  3GE4 A;  4ISM A;  4II4 A;  1K83 L;  2RDV A;  3HKZ P;  5MFP A;  5IYC L;  3GTK L;  4ZTT A;  1Z92 B;  3PVR A;  4AM2 A;  3IU3 I;  2CR8 A;  3PWQ A;  5M3M L;  2BW1 A;  2V8U A;  3PVT B;  3Q4Q A;  5J8W A;  4LPN A;  4TPU A;  3S2D L;  1R0H A;  2CLU A;  2ERJ A;  5ERK A;  1IRO A;  2XJQ A;  4ML5 A;  3FRS A;  5D8X A;  1S24 A;  1IES A;  4MJY A;  3AJP A;  3D19 A;  3F33 A;  5CMQ A;  1I6H L;  1F4L A;  4AI3 A;  4XGS A;  4CVT A;  4A93 L;  2V2J A;  2XJM A;  4QIW P;  1OTK A;  2NVQ L;  2V2M A;  3GTP L;  2GS4 A;  5GU0 X;  2WTL A;  3H7G A;  3UOI A;  3A44 A;  4YWM A;  2VXI A;  3FRR A;  1HRS A;  3QD8 A;  3PKJ A;  2CWL A;  3SH6 A;  5M5W L;  1QYB A;  2CEI A;  2ITB A;  5D8O A;  4AR4 A;  2RFK B;  4JAE A;  5IY0 A;  5IP7 L;  3E6S A;  4CYA A;  4RC6 B;  2UX1 A;  1EUM A;  4LQJ A;  5CZU A;  1PFY A;  4Y7N L;  2M6O A;  5M5Y L;  2C2U A;  5ERJ A;  3ES3 A;  3LKD A;  2OC5 A;  4B8C D;  4BBS L;  3BVE A;  4M32 A;  2AR0 A;  1B71 A;  3KA8 A;  4Y52 L;  4AR5 A;  1JGC A;  1PFV A;  1T9P A;  3E1Q A;  3PWQ C;  3MQK B;  4MY7 A;  1TWC L;  2LCQ A;  3FVB A;  4KVQ A;  1JYB A;  4TOE A;  2NVT L;  4EVD A;  2IB0 A;  1IW7 D;  5JKM G;  3E1M A;  5IYD L;  4U3G A;  2C6B A;  2OH3 A;  2L0Z A;  4AM5 A;  4KXR B;  3ERZ A;  3LNL A;  2Z5P A;  3QB9 A;  1F30 A;  5JKL A;  1NNQ A;  2V3B B;  1R0I A;  3Q4N A;  4PGK A;  1LKM A;  2XJU A;  3PIP 1;  1FHH A;  3AF8 X;  3ZG6 A;  1VZG A;  2BJY A;  2IU2 A;  3C1Y A;  3QQC E;  3VVA A;  1JI5 A;  5D8Q A;  1VZH A;  1QQT A;  2V2R A;  3BKN A;  5LS9 A;  3WVV A;  3UOF A;  3IQ1 A;  3LWQ B;  5D8P A;  1S3Q A;  2NVX L;  1SQ3 A;  5C4J L;  3F38 A;  3KXU A;  2V2O A;  4A3M L;  5AXS A;  3GTQ L;  1NF4 A;  1QCV A;  2G4H A;  4ZKW A;  3SS2 A;  2FL0 A;  4YXM A;  3VV9 A;  3RZO L;  5LG2 A;  3FDJ A;  5EIO C;  4W4L B;  2FJC A;  3H0G L;  2C2J A;  3ISF A;  4JAG A;  3LWV B;  2JD6 0;  2V8T A;  2PPT A;  4XKS A;  4LQH A;  5K53 A;  4A3K L;  3PVY A;  2JD7 0;  2XKQ A;  1RCE A;  5FJ8 L;  1BE7 A;  1BCF A;  3KA6 A;  4A25 A;  1TKO A;  2Z90 A;  5D8R A;  2HR5 A;  3F37 A;  3FI6 A;  1RYQ A;  2B5I D;  3ISE A;  2FG4 A;  2FG8 A;  2WLU A;  3JZ9 A;  5LBH A;  4MXP A;  1Y1W L;  4YWL A;  3VNX A;  3E1P A;  4WFN 1;  2K2D A;  3FKI L;  2YU9 L;  3MPS A;  2MGY A;  4WJG 4;  5IX6 A;  1O9R A;  4LYX A;  4C2M 1;  4XGH A;  2M4Y A;  1JI4 A;  3AJQ A;  1XZ1 A;  5EIN C;  5GAG c;  1RCG A;  1RYT A;  3PVR B;  1WJV A;  3KYX A;  5FEJ A;  5MLC 3;  3SID A;  2PYB A;  1IU6 A;  2XJT A;  1BG7 A;  5C6F A;  3KA3 A;  1YK4 A;  2WB1 P;  4JAF A;  3M3Y L;  3F34 A;  4KVR A;  4TOH A;  3J7Z 1;  3KA4 A;  2H12 A;  2R93 L;  2FKZ A;  2Z3R B;  3AF9 X;  3KX9 A;  4TOD A;  1DVB A;  2V2P A;  3C23 A;  1AEW A;  1QGH A;  4DYZ A;  3E1N A;  4AYB P;  3PL5 A;  4DE6 A;  2XJR A;  1L8H A;  3HOW L;  4AI0 A;  3HJY B;  4PG1 A;  5J9V A;  2ZIX A;  5FFC A;  5C44 L;  1VEL A;  1P7P A;  3KYY A;  1YUZ A;  4UY8 1;  1XZ3 A;  3GVY A;  3NOZ X;  3KWO A;  1SMU A;  4ZL6 A;  3GHQ A;  3KYU A;  1DAT A;  3E1L A;  3C21 A;  3VPB E;  1JTS A;  3O7S A;  1GWG A;  5CMR A;  5M3F L;  4A3C L;  5IP9 L;  2B63 L;  2V0E A;  4JAD A;  2JI1 A;  2Y0S P;  1I50 L;  5D8Y A;  3HOY L;  2CHI A;  5H1S c;  2ERS A;  3WWL A; 
#chains in the Genus database with same CATH homology
 3QHB A;  4LPM A;  1RCI A;  3U90 A;  4P18 A;  2CHP A;  2Z5Q A;  4REU A;  1B2O A;  1JKV A;  2CN6 A;  3O7R A;  4TVM A;  3F35 A;  2X17 0;  3KA9 A;  4RC8 A;  5D8S A;  1ZRP A;  2XJN A;  3FSE A;  3Q4O A;  2C2F A;  2YJJ A;  4LHN A;  4XKU A;  3WVU A;  2M4V A;  3DBY A;  4TOB A;  1SMM A;  3GGY A;  1R0G A;  5FFB A;  3JZA B;  2M6P A;  3NP2 X;  4M35 A;  2Y3Q A;  5HJF A;  5E1U A;  1B13 A;  4IWK A;  4ITW A;  4DAS A;  3B08 B;  3BVK A;  3QVD A;  2V2L A;  2A6H D;  3OJ5 A;  2FZF A;  3RD0 A;  1VJX A;  2GYQ A;  1VZI A;  5HU6 D;  1OWC A;  5JKL G;  4GS7 D;  3QHC A;  1FHM A;  4XXB B;  2KKD A;  1BFY A;  3W54 A;  1SOF A;  4CMY V;  2QL0 A;  4TOG A;  1OWB A;  2BKC A;  4W4K B;  2VL6 A;  5FFD A;  3PIO 1;  3F36 A;  2CKA A;  3BVL A;  5LG8 A;  5FFA A;  4AR3 A;  3A9Q A;  1TKP A;  3IS8 A;  5RXN A;  1LTL A;  4PG0 A;  5HJH A;  3PVY B;  3R2H A;  2N02 A;  3UFB A;  3KYW A;  3KHK A;  4CVS A;  3A68 A;  3Q4R A;  5DM7 1;  2MS3 A;  4AHY A;  3QZ3 A;  5GN8 A;  1VLG A;  3L0M A;  2AYJ A;  3GGZ A;  3EGM A;  1LB3 A;  3N6O A;  3UNO A;  7RXN A;  2C6R A;  1BQ8 A;  4ITT A;  2QF9 A;  2ZA6 A;  1ZUJ A;  3R2K A;  3PW8 A;  4DYU A;  3RE7 A;  1YV1 A;  3KDQ A;  2PYA A;  3RZT A;  4ETR A;  3R2R A;  2CLB A;  1MFR A;  5JAC A;  2Z3Q B;  5JVG 1;  6RXN A;  4AHX A;  2HTN A;  4X0J A;  1JKU A;  4AR6 A;  2JI2 A;  4ISP A;  2W0O A;  3WWN B;  3E6R A;  2ZA8 A;  3M6J A;  2ZG8 X;  4MN9 A;  2NYD A;  2IY4 A;  2V2N A;  4RC7 A;  4POF A;  2ZG7 X;  4TO9 A;  4TOF A;  5GAH c;  1JRE A;  3PW1 B;  4OYN A;  2KN9 A;  2Z5R A;  2ZG9 X;  4DYY A;  4ZMC A;  1Z6O A;  1NFV A;  4RXN A;  4IWJ A;  5MGN A;  4ZN3 B;  2YW6 A;  4Z3B A;  2F7N A;  1BRF A;  3PW1 A;  1VEQ A;  3J7Y 1;  2FHA A;  4E6K A;  1NF6 A;  3PW8 C;  4ZL5 A;  2JI3 A;  1J30 A;  4CVR A;  2XJP A;  3AJO A;  4ME3 A;  2XGW A;  1RCD A;  5GU1 X;  5K52 A;  1BQ9 A;  2ZA7 A;  5GU2 X;  2OKC A;  4G6B A;  1H7V A;  3AF7 X;  2C6A A;  3HL1 A;  4ZLW A;  2CIH A;  2VXX A;  2WLA A;  1B2J A;  4POG A;  5AI3 A;  4ZN1 B;  2WWX B;  3KYV A;  4AHZ A;  1Z4A A;  4DYX A;  1LKP A;  4XKT A;  3B0A B;  1F33 A;  3PVT A;  4ZKH A;  1VCX A;  4LPJ A;  3R2S A;  5GOU A;  4IXK A;  3SHX A;  2Y44 A;  3R2M A;  2V2I A;  1VEI A;  4E40 A;  2RBD A;  3C1Z A;  3R2O A;  5MF6 A;  2A6E D;  5JVH 1;  4ZJK A;  3NP0 X;  4U67 1;  4CYB A;  5GAE c;  3E2C A;  4DZ0 A;  1L8I A;  5GU3 X;  1KRQ A;  2VZB A;  1YK5 A;  3HIU A;  1RDG A;  2BK6 A;  4EVC A;  1UMN A;  4TOC A;  2GMG A;  2PVE A;  1SMW A;  4YXJ A;  5AN9 H;  3WVW A;  2J9U B;  1N1Q A;  3F32 A;  4AM4 A;  1FHA A;  3BT5 A;  3RZ6 A;  2ZUR X;  4M33 A;  2V15 A;  4AHW A;  1RDV A;  4RC6 A;  1TK6 A;  4TOA A;  4LQV A;  1RB9 A;  2O5J D;  4R42 A;  3AK9 A;  4LQN A;  2PSM C;  4AI1 A;  3BVF A;  5JKM A;  1CAA A;  3EZ0 A;  4EVB A;  3V3K B;  2G38 B;  4LYU A;  5GN8 B;  1NXG A;  1O9I A;  3E1O A;  1LKO A;  4RC5 B;  1RCC A;  2YW7 A;  4CY9 A;  1NXE A;  3K35 A;  4M34 A;  4MKU A;  1YUX A;  1R03 A;  1DPS A;  5FFE A;  1BFR A;  4RC5 A;  5MFZ A;  2D5K A;  3RGD A;  1T9Q A;  2XJS A;  5AI2 A;  1E8J A;  5I4J A;  1ZS3 A;  1T9O A;  1IER A;  4KVS A;  5J93 A;  4PGI A;  3P2A A;  1R0F A;  2A68 D;  3IS7 A;  1CAD A;  5DM6 1;  4AI2 A;  3EZU A;  5JDO B;  1H96 A;  3LPE B;  2BE5 D;  1S2Z A;  3E1J A;  4MUD A;  1Z6O M;  4K9F A;  3F39 A;  3NFP I;  1RWD A;  1C09 A;  3PKI A;  3WNW A;  4E6Y A;  5K2M E;  4RC7 B;  3R2L A;  2CN7 A;  4CVP A;  3MSU A;  1DX8 A;  3OGH A;  4TW3 A;  2YJK A;  1MOJ A;  5E2D A;  5JDO A;  1ODH A;  5J8S A;  4ERU A;  4Y08 A;  2XJO A;  4CMY A;  1R0J A;  3RBC A;  3RAV A;  3PWF A;  3AK8 A;  3BVI A;  4LHL A;  2DSX A;  3RYG A;  4V19 6;  1JIG A;  5GAD c;  2XJV A;  2Z6M A;  2JD8 0;  2QQY A;  3P8B A;  5HQO A;  1IU5 A;  2A69 D;  1TJO A;  4YKH A;  4DI0 A;  1S30 A;  4II4 B;  4Z5S A;  4ZKX A;  2PVX A;  3PZA A;  8RXN A;  2CF7 A;  4YVZ A;  3TA8 A;  2V0F A;  1UVH A;  1IRN A;  2GYD A;  3SE1 A;  2C41 A;  4QUW A;  2CKC A;  3T9J A;  2FFX J;  4EVE A;  2V2S A;  3GE4 A;  4ISM A;  4II4 A;  2RDV A;  5MFP A;  4ZTT A;  1Z92 B;  3PVR A;  4AM2 A;  3IU3 I;  2CR8 A;  3PWQ A;  2BW1 A;  2V8U A;  3PVT B;  3Q4Q A;  5J8W A;  4LPN A;  4TPU A;  1R0H A;  2CLU A;  2ERJ A;  5ERK A;  1IRO A;  2XJQ A;  4ML5 A;  3FRS A;  5D8X A;  1S24 A;  1IES A;  4MJY A;  3AJP A;  3D19 A;  3F33 A;  5CMQ A;  4AI3 A;  4XGS A;  4CVT A;  2V2J A;  2XJM A;  1OTK A;  2V2M A;  2GS4 A;  5GU0 X;  2WTL A;  3H7G A;  3UOI A;  3A44 A;  4YWM A;  2VXI A;  3FRR A;  1HRS A;  3QD8 A;  3PKJ A;  2CWL A;  3SH6 A;  1QYB A;  2CEI A;  2ITB A;  5D8O A;  4AR4 A;  4JAE A;  5IY0 A;  3E6S A;  4CYA A;  4RC6 B;  2UX1 A;  1EUM A;  4LQJ A;  5CZU A;  2M6O A;  2C2U A;  5ERJ A;  3ES3 A;  3LKD A;  2OC5 A;  4B8C D;  3BVE A;  4M32 A;  2AR0 A;  1B71 A;  3KA8 A;  4AR5 A;  1JGC A;  1T9P A;  3E1Q A;  3PWQ C;  4MY7 A;  2LCQ A;  3FVB A;  4KVQ A;  1JYB A;  4TOE A;  4EVD A;  2IB0 A;  1IW7 D;  5JKM G;  3E1M A;  4U3G A;  2C6B A;  2OH3 A;  2L0Z A;  4AM5 A;  4KXR B;  3ERZ A;  3LNL A;  2Z5P A;  3QB9 A;  1F30 A;  5JKL A;  1NNQ A;  2V3B B;  1R0I A;  3Q4N A;  4PGK A;  1LKM A;  2XJU A;  3PIP 1;  1FHH A;  3AF8 X;  3ZG6 A;  1VZG A;  2BJY A;  2IU2 A;  3C1Y A;  3QQC E;  3VVA A;  1JI5 A;  5D8Q A;  1VZH A;  2V2R A;  3BKN A;  5LS9 A;  3WVV A;  3UOF A;  3IQ1 A;  5D8P A;  1S3Q A;  1SQ3 A;  3F38 A;  3KXU A;  2V2O A;  5AXS A;  1NF4 A;  1QCV A;  2G4H A;  4ZKW A;  3SS2 A;  2FL0 A;  4YXM A;  3VV9 A;  5LG2 A;  5EIO C;  4W4L B;  2FJC A;  2C2J A;  3ISF A;  4JAG A;  2JD6 0;  2V8T A;  2PPT A;  4XKS A;  4LQH A;  5K53 A;  3PVY A;  2JD7 0;  2XKQ A;  1RCE A;  1BE7 A;  1BCF A;  3KA6 A;  4A25 A;  1TKO A;  2Z90 A;  5D8R A;  2HR5 A;  3F37 A;  3FI6 A;  1RYQ A;  2B5I D;  3ISE A;  2FG4 A;  2FG8 A;  2WLU A;  3JZ9 A;  5LBH A;  4MXP A;  4YWL A;  3VNX A;  3E1P A;  4WFN 1;  2K2D A;  3MPS A;  2MGY A;  4WJG 4;  5IX6 A;  1O9R A;  4LYX A;  4XGH A;  2M4Y A;  1JI4 A;  3AJQ A;  1XZ1 A;  5EIN C;  5GAG c;  1RCG A;  1RYT A;  3PVR B;  1WJV A;  3KYX A;  5FEJ A;  5MLC 3;  3SID A;  2PYB A;  1IU6 A;  2XJT A;  1BG7 A;  5C6F A;  3KA3 A;  1YK4 A;  4JAF A;  3F34 A;  4KVR A;  4TOH A;  3J7Z 1;  3KA4 A;  2H12 A;  2FKZ A;  2Z3R B;  3AF9 X;  3KX9 A;  4TOD A;  1DVB A;  2V2P A;  3C23 A;  1AEW A;  1QGH A;  4DYZ A;  3E1N A;  4DE6 A;  2XJR A;  1L8H A;  4AI0 A;  4PG1 A;  5J9V A;  2ZIX A;  5FFC A;  1VEL A;  3KYY A;  4UY8 1;  1YUZ A;  1XZ3 A;  3GVY A;  3NOZ X;  3KWO A;  1SMU A;  4ZL6 A;  3GHQ A;  3KYU A;  1DAT A;  3E1L A;  3C21 A;  3VPB E;  1JTS A;  3O7S A;  1GWG A;  5CMR A;  2V0E A;  4JAD A;  2JI1 A;  5D8Y A;  2CHI A;  5H1S c;  2ERS A;  3WWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...