5K52A

Crystal structures of aldehyde deformylating oxygenase from limnothrix sp. knua012
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
221
structure length
221
Chain Sequence
IDYQSETYKDAYSRINAIVIEGEDEAANNYVRLAELMPEQSEELASLAKMEARHKKGFTACGKNLNVTPDMDFAKKFFSDLHGNFQVAAAAGNIVTCLLIQALIIEAFAISAYNVYIPHADDFARKITENVVKDEYLHLNFGEQWLKANFESAKDELERANRENLAIVWRMLDEVAGDALVLGMEKEALMEDFTIAYQEALQNIGFSTRETLRMLTAGLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Aldehyde decarbonylase
publication title Crystal structures of aldehyde deformylating oxygenase from Limnothrix sp. KNUA012 and Oscillatoria sp. KNUA011.
pubmed doi rcsb
source organism Limnothrix sp. knua012
total genus 92
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 4.1.99.5: Aldehyde oxygenase (deformylating).
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11266 Ald_deCOase Long-chain fatty aldehyde decarbonylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5k52A01
3PVRA 2G4HA 4AM5A 3KA8A 1RCDA 4DYUA 5JKLA 1BCFA 5LS9A 3QB9A 2IU2A 3SE1A 5FEJA 5D8SA 1JIGA 3ISEA 2V2SA 1LB3A 4TW3A 5CMQA 3VNXA 5HJFA 3H7GA 1GWGA 3F37A 3PW1A 5FFAA 5GN8B 3QHBA 1NNQA 4ZMCA 5I4JA 2V15A 5K52A 1B71A 1YUXA 2C2JA 4PG1A 1F33A 5FFDA 2V2IA 2ZURX 1OTKA 1AEWA 3WNWA 1L8IA 4TOEA 4OYNA 4RC6A 3QD8A 4QUWA 1EUMA 3PVYB 1IESA 2CF7A 4RC7A 3FSEA 4CMYV 1LKOA 1JKVA 3Q4NA 3KX9A 5HJHA 2V2MA 5J8SA 4CVSA 4ML5A 2WTLA 4DZ0A 2IB0A 4RC7B 3RGDA 2ZG8X 1NF6A 3AJQA 2FZFA 3SIDA 2FG4A 4TOFA 4LQNA 3IS7A 1TK6A 3F39A 3O7SA 3OJ5A 3FI6A 4MJYA 1RCEA 3UNOA 3F33A 2C2UA 4MKUA 2VZBA 4LYUA 1VEIA 4LQHA 2RBDA 1JI5A 1QGHA 4ITWA 3OGHA 3FVBA 4M32A 3R2MA 4CYBA 2YJKA 4MN9A 3KA9A 4DYYA 1JI4A 3E1MA 3GVYA 4LPJA 1BG7A 1DPSA 5D8XA 3UOIA 3AK9A 4CYAA 1ZUJA 3E1PA 3AF9X 2CLUA 2BKCA 2V2JA 3GHQA 2Z6MA 3IS8A 3AK8A 4EVCA 3SH6A 4XKUA 1VJXA 1S30A 3R2HA 3TA8A 1SOFA 3Q4QA 3WVWA 2V2LA 4LPMA 2ZG9X 3BVFA 4II4B 1F30A 2ZG7X 1TKOA 1RCCA 5JKMA 3F36A 4IXKA 5D8RA 3GE4A 1Z4AA 5GN8A 5CZUA 3ISFA 5D8QA 1QYBA 2VXXA 4TOAA 2GYQA 2ZA7A 3PZAA 1ZS3A 2FFXJ 3WVVA 3E1NA 3R2LA 2V2PA 1J30A 4LPNA 3RAVA 3RBCA 4TOGA 3PVYA 4AM4A 1VELA 1IERA 3NP0X 5FFBA 4TOCA 5JKLG 4RC8A 3BVLA 1KRQA 4CVPA 3NOZX 4Y08A 1JYBA 2V2OA 2C41A 2XKQA 4PGKA 1TJOA 2JD80 5GOUA 4XKSA 4MUDA 2CEIA 4DI0A 3E6RA 1XZ1A 2W0OA 2ZA6A 5AXSA 5D8PA 3E2CA 4ERUA 4ETRA 1N1QA 4XGSA 4ZKWA 4CY9A 1MOJA 4DYXA 1L8HA 1YUZA 5GU2X 2F7NA 3QVDA 4ZL5A 3A9QA 2V2NA 3HL1A 1UVHA 2Z90A 2CHPA 5GU0X 1VEQA 2D5KA 4ZKHA 3ES3A 5FFEA 1TKPA 3KA6A 3KA3A 4REUA 1O9IA 1VLGA 4AM2A 2OC5A 4ZKXA 3PW8A 1XZ3A 2FG8A 5HQOA 2FL0A 2Z5QA 1MFRA 4R42A 3BVIA 2PYBA 1S2ZA 3QHCA 1R03A 3WVUA 5D8YA 5J93A 5C6FA 3E1OA 3E1LA 3E6SA 3UOFA 4Z5SA 2XGWA 4PGIA 2CN7A 4TODA 1JREA 2Z5RA 4II4A 4EVEA 5ERJA 2ZA8A 4XKTA 2C6RA 3PWFA 1LKMA 4KVQA 4KVSA 4M35A 2FJCA 2UX1A 4A25A 1DVBA 1YV1A 5E1UA 3U90A 2QQYA 1FHAA 4ISPA 4MY7A 3PVTA 2YW7A 2XJNA 3QZ3A 5LG2A 2HR5A 5ERKA 3MPSA 4ZTTA 2X170 3PWQA 5FFCA 3AJPA 5GU3X 5LG8A 4TOHA 5D8OA 2CN6A 3PVTB 3AJOA 4RC5B 4Z3BA 1JGCA 2CLBA 4TOBA 3F32A 5JACA 3KWOA 3BVEA 3PVRB 4DASA 3F34A 2XJOA 2BJYA 3A68A 3SHXA 4DE6A 4P18A 5JKMG 4E6KA 3R2SA 2BK6A 3E1JA 3PW8C 1Z6OM 5GU1X 1JTSA 3F38A 3Q4RA 3BVKA 2FKZA 1Z6OA 3ERZA 3KA4A 3PW1B 1RCIA 2VXIA 5LBHA 4YKHA 3R2KA 3BKNA 1JKUA 5IX6A 3IQ1A 3RD0A 2IY4A 3O7RA 3Q4OA 4RC6B 2WLUA 5CMRA 4M33A 3T9JA 2HTNA 1RYTA 2OH3A 2BW1A 3AF8X 2CHIA 4LQVA 3NP2X 2GYDA 4CVRA 4CVTA 2YJJA 4EVBA 2C2FA 2GS4A 2JD60 1RCGA 3EZUA 2YW6A 1BFRA 3BT5A 4ZLWA 3R2RA 4IWJA 2CIHA 2QF9A 4ISMA 4ITTA 5J8WA 1H96A 3AF7X 1NF4A 1S3QA 3PWQC 4U3GA 2JD70 4TO9A 5K53A 3KXUA 4EVDA 3F35A 2FHAA 1NFVA 4CMYA 2V2RA 4KVRA 1SQ3A 2Z5PA 3EZ0A 1DATA 4M34A 4ZL6A 1O9RA 1LKPA 2WLAA 1HRSA 3HIUA 1UMNA 4LYXA 3E1QA 3RE7A 3R2OA 2ITBA 2Y3QA 4DYZA 4ZJKA 3EGMA 4PG0A 5J9VA 5E2DA 4RC5A 4LQJA 2XJMA 4IWKA
chains in the Genus database with same CATH superfamily
3PVRA 2G4HA 4AM5A 3KA8A 1RCDA 3LKDA 4DYUA 5JKLA 1BCFA 5LS9A 3N6OA 3QB9A 2IU2A 3SE1A 5FEJA 5D8SA 1JIGA 3ISEA 2V2SA 1LB3A 4TW3A 5CMQA 3VNXA 5HJFA 3H7GA 1GWGA 3KDQA 3F37A 3PW1A 5FFAA 5GN8B 3QHBA 1NNQA 4ZMCA 5I4JA 2V15A 5K52A 1B71A 1YUXA 2C2JA 4PG1A 1F33A 5FFDA 5JDOA 2V2IA 2ZURX 1OTKA 1AEWA 3WNWA 1L8IA 4TOEA 4OYNA 4RC6A 3QD8A 4QUWA 1EUMA 3PVYB 1IESA 2CF7A 4RC7A 3FSEA 4CMYV 1LKOA 1JKVA 3Q4NA 3KX9A 5HJHA 2V2MA 5J8SA 4CVSA 4ML5A 2WTLA 4DZ0A 4W4LB 2IB0A 4RC7B 3RGDA 2ZG8X 1NF6A 3AJQA 2FZFA 3SIDA 3C1YA 2FG4A 4TOFA 4LQNA 3IS7A 1TK6A 2CWLA 3F39A 3O7SA 3OJ5A 3FI6A 4MJYA 1RCEA 3UNOA 3JZAB 3F33A 2C2UA 4MKUA 2VZBA 4LYUA 1VEIA 4LQHA 2RBDA 1JI5A 1QGHA 4ITWA 3OGHA 3FVBA 4M32A 3R2MA 4CYBA 2YJKA 4MN9A 3KA9A 4DYYA 1JI4A 3E1MA 3GVYA 1BG7A 4LPJA 1DPSA 5D8XA 3UOIA 3AK9A 4CYAA 1ZUJA 3E1PA 3AF9X 4KXRB 4W4KB 2CLUA 2BKCA 2V2JA 3GHQA 2Z6MA 3IS8A 4E40A 3AK8A 4EVCA 3SH6A 4XKUA 1VJXA 1S30A 3R2HA 3TA8A 1SOFA 3Q4QA 3WVWA 2V2LA 4LPMA 2ZG9X 2OKCA 3BVFA 4II4B 1F30A 2ZG7X 1TKOA 1RCCA 3JZ9A 5JKMA 3F36A 4IXKA 5D8RA 3GE4A 1Z4AA 5GN8A 5CZUA 3ISFA 5D8QA 1QYBA 2VXXA 4TOAA 2GYQA 2ZA7A 3PZAA 1ZS3A 2FFXJ 3WVVA 3E1NA 3R2LA 2V2PA 1J30A 4LPNA 3RAVA 3RBCA 4TOGA 3PVYA 4AM4A 1VELA 1IERA 3NP0X 5FFBA 4MXPA 4TOCA 5JKLG 4RC8A 3BVLA 1KRQA 4CVPA 3NOZX 4Y08A 1JYBA 2V2OA 2C41A 2XKQA 4PGKA 1TJOA 2JD80 5GOUA 4XKSA 4MUDA 2CEIA 4DI0A 3E6RA 1XZ1A 2W0OA 2ZA6A 5AXSA 5D8PA 3E2CA 4ERUA 4ETRA 1N1QA 4XGSA 4ZKWA 3D19A 4CY9A 1MOJA 4DYXA 3GGZA 1L8HA 1YUZA 5GU2X 2F7NA 3QVDA 4ZL5A 3C21A 3VVAA 3A9QA 2V2NA 5HU6D 3HL1A 1UVHA 2AR0A 2Z90A 2CHPA 5GU0X 1VEQA 2D5KA 4ZKHA 4YXJA 3ES3A 3VV9A 5FFEA 1TKPA 2V8UA 3KA6A 3KA3A 4REUA 1O9IA 1VLGA 4WJG4 4AM2A 2OC5A 4ZKXA 3PW8A 1XZ3A 2FG8A 5HQOA 2FL0A 2Z5QA 1MFRA 4R42A 3BVIA 2PYBA 1S2ZA 3GGYA 3QHCA 1R03A 3WVUA 5D8YA 5J93A 5C6FA 3E1OA 3E1LA 3E6SA 3UOFA 4Z5SA 2XGWA 4PGIA 2CN7A 4TODA 1JREA 2Z5RA 4II4A 4EVEA 5ERJA 2ZA8A 4XKTA 2C6RA 3PWFA 1LKMA 4YVZA 4KVQA 4KVSA 4M35A 2FJCA 4X0JA 2UX1A 4A25A 1DVBA 1YV1A 3M6JA 5E1UA 3U90A 2QQYA 1FHAA 4ISPA 4MY7A 3PVTA 2YW7A 2XJNA 3QZ3A 5LG2A 2HR5A 5ERKA 3MPSA 4ZTTA 3FRSA 2X170 3PWQA 5FFCA 3AJPA 5GU3X 5LG8A 4TOHA 5D8OA 2CN6A 3PVTB 3AJOA 4RC5B 4Z3BA 1JGCA 2CLBA 4TOBA 3F32A 5JACA 3KWOA 3BVEA 3PVRB 4DASA 3UFBA 3F34A 2XJOA 2BJYA 3A68A 3SHXA 4DE6A 4P18A 3KHKA 5JKMG 4E6KA 3R2SA 2BK6A 3E1JA 2Y44A 3PW8C 2MGYA 1Z6OM 5GU1X 1JTSA 2V8TA 3F38A 3Q4RA 2WWXB 3BVKA 2FKZA 1Z6OA 3ERZA 3KA4A 3PW1B 1RCIA 2VXIA 5LBHA 3C23A 4YKHA 3R2KA 3BKNA 1JKUA 5IX6A 3IQ1A 3RD0A 2IY4A 5JDOB 3O7RA 2N02A 3Q4OA 4RC6B 3V3KB 2WLUA 5CMRA 4M33A 3T9JA 2HTNA 1RYTA 2OH3A 2BW1A 3AF8X 2CHIA 3C1ZA 4LQVA 3NP2X 2GYDA 4CVRA 4CVTA 2YJJA 4EVBA 2C2FA 2GS4A 2JD60 1RCGA 3EZUA 2YW6A 1BFRA 3BT5A 4ZLWA 3R2RA 4IWJA 2CIHA 2QF9A 4ISMA 4ITTA 5J8WA 1H96A 3AF7X 1NF4A 1S3QA 3PWQC 4U3GA 2JD70 4TO9A 5K53A 3L0MA 3KXUA 4EVDA 3F35A 2FHAA 1NFVA 4CMYA 2V2RA 4KVRA 3W54A 1SQ3A 2Z5PA 3EZ0A 1DATA 4M34A 4ZL6A 1O9RA 1LKPA 2WLAA 1HRSA 3FRRA 3HIUA 1UMNA 4LYXA 3E1QA 3RE7A 3R2OA 2ITBA 2Y3QA 4YXMA 4DYZA 3EGMA 4ZJKA 4PG0A 5J9VA 5E2DA 4RC5A 4LQJA 2G38B 3DBYA 2XJMA 4IWKA
chains in the Genus database with same CATH topology
3PVRA 2G4HA 4AM5A 3KA8A 1RCDA 3LKDA 4DYUA 5JKLA 1BCFA 5LS9A 3N6OA 3QB9A 2IU2A 3SE1A 5FEJA 5D8SA 1JIGA 3ISEA 2V2SA 1LB3A 4TW3A 5CMQA 3VNXA 5HJFA 3H7GA 1GWGA 3KDQA 3F37A 3PW1A 5FFAA 5GN8B 3QHBA 1NNQA 4ZMCA 5I4JA 2V15A 5K52A 1B71A 1YUXA 2C2JA 4PG1A 1F33A 5FFDA 5JDOA 2V2IA 2ZURX 1OTKA 1AEWA 3WNWA 1L8IA 4TOEA 4OYNA 4RC6A 3QD8A 4QUWA 1EUMA 3PVYB 1IESA 2CF7A 4RC7A 3FSEA 4CMYV 1LKOA 1JKVA 3Q4NA 3KX9A 5HJHA 2V2MA 5J8SA 4CVSA 4ML5A 2WTLA 4DZ0A 4W4LB 2IB0A 4RC7B 3RGDA 2ZG8X 1NF6A 3AJQA 2FZFA 3SIDA 3C1YA 2FG4A 4TOFA 4LQNA 3IS7A 1TK6A 2CWLA 3F39A 3O7SA 3OJ5A 3FI6A 4MJYA 1RCEA 3UNOA 3JZAB 3F33A 2C2UA 4MKUA 2VZBA 4LYUA 1VEIA 4LQHA 2RBDA 1JI5A 1QGHA 4ITWA 3OGHA 3FVBA 4M32A 3R2MA 4CYBA 2YJKA 4MN9A 3KA9A 4DYYA 1JI4A 3E1MA 3GVYA 1BG7A 4LPJA 1DPSA 5D8XA 3UOIA 3AK9A 4CYAA 1ZUJA 3E1PA 3AF9X 4KXRB 4W4KB 2CLUA 2BKCA 2V2JA 3GHQA 2Z6MA 3IS8A 4E40A 3AK8A 4EVCA 3SH6A 4XKUA 1VJXA 1S30A 3R2HA 3TA8A 1SOFA 3Q4QA 3WVWA 2V2LA 4LPMA 2ZG9X 2OKCA 3BVFA 4II4B 1F30A 2ZG7X 1TKOA 1RCCA 3JZ9A 5JKMA 3F36A 4IXKA 5D8RA 3GE4A 1Z4AA 5GN8A 5CZUA 3ISFA 5D8QA 1QYBA 2VXXA 4TOAA 2GYQA 2ZA7A 3PZAA 1ZS3A 2FFXJ 3WVVA 3E1NA 3R2LA 2V2PA 1J30A 4LPNA 3RAVA 3RBCA 4TOGA 3PVYA 4AM4A 1VELA 1IERA 3NP0X 5FFBA 4MXPA 4TOCA 5JKLG 4RC8A 3BVLA 1KRQA 4CVPA 3NOZX 4Y08A 1JYBA 2V2OA 2C41A 2XKQA 4PGKA 1TJOA 2JD80 5GOUA 4XKSA 4MUDA 2CEIA 4DI0A 3E6RA 1XZ1A 2W0OA 2ZA6A 5AXSA 5D8PA 3E2CA 4ERUA 4ETRA 1N1QA 4XGSA 4ZKWA 3D19A 4CY9A 1MOJA 4DYXA 3GGZA 1L8HA 1YUZA 5GU2X 2F7NA 3QVDA 4ZL5A 3C21A 3VVAA 3A9QA 2V2NA 5HU6D 3HL1A 1UVHA 2AR0A 2Z90A 2CHPA 5GU0X 1VEQA 2D5KA 4ZKHA 4YXJA 3ES3A 3VV9A 5FFEA 1TKPA 2V8UA 3KA6A 3KA3A 4REUA 1O9IA 1VLGA 4WJG4 4AM2A 2OC5A 4ZKXA 3PW8A 1XZ3A 2FG8A 5HQOA 2FL0A 2Z5QA 1MFRA 4R42A 3BVIA 2PYBA 1S2ZA 3GGYA 3QHCA 1R03A 3WVUA 5D8YA 5J93A 5C6FA 3E1OA 3E1LA 3E6SA 3UOFA 4Z5SA 2XGWA 4PGIA 2CN7A 4TODA 1JREA 2Z5RA 4II4A 4EVEA 5ERJA 2ZA8A 4XKTA 2C6RA 3PWFA 1LKMA 4YVZA 4KVQA 4KVSA 4M35A 2FJCA 4X0JA 2UX1A 4A25A 1DVBA 1YV1A 3M6JA 5E1UA 3U90A 2QQYA 1FHAA 4ISPA 4MY7A 3PVTA 2YW7A 2XJNA 3QZ3A 5LG2A 2HR5A 5ERKA 3MPSA 4ZTTA 3FRSA 2X170 3PWQA 5FFCA 3AJPA 5GU3X 5LG8A 4TOHA 5D8OA 2CN6A 3PVTB 3AJOA 4RC5B 4Z3BA 1JGCA 2CLBA 4TOBA 3F32A 5JACA 3KWOA 3BVEA 3PVRB 4DASA 3UFBA 3F34A 2XJOA 2BJYA 3A68A 3SHXA 4DE6A 4P18A 3KHKA 5JKMG 4E6KA 3R2SA 2BK6A 3E1JA 2Y44A 3PW8C 2MGYA 1Z6OM 5GU1X 1JTSA 2V8TA 3F38A 3Q4RA 2WWXB 3BVKA 2FKZA 1Z6OA 3ERZA 3KA4A 3PW1B 1RCIA 2VXIA 5LBHA 3C23A 4YKHA 3R2KA 3BKNA 1JKUA 5IX6A 3IQ1A 3RD0A 2IY4A 5JDOB 3O7RA 2N02A 3Q4OA 4RC6B 3V3KB 2WLUA 5CMRA 4M33A 3T9JA 2HTNA 1RYTA 2OH3A 2BW1A 3AF8X 2CHIA 3C1ZA 4LQVA 3NP2X 2GYDA 4CVRA 4CVTA 2YJJA 4EVBA 2C2FA 2GS4A 2JD60 1RCGA 3EZUA 2YW6A 1BFRA 3BT5A 4ZLWA 3R2RA 4IWJA 2CIHA 2QF9A 4ISMA 4ITTA 5J8WA 1H96A 3AF7X 1NF4A 1S3QA 3PWQC 4U3GA 2JD70 4TO9A 5K53A 3L0MA 3KXUA 4EVDA 3F35A 2FHAA 1NFVA 4CMYA 2V2RA 4KVRA 3W54A 1SQ3A 2Z5PA 3EZ0A 1DATA 4M34A 4ZL6A 1O9RA 1LKPA 2WLAA 1HRSA 3FRRA 3HIUA 1UMNA 4LYXA 3E1QA 3RE7A 3R2OA 2ITBA 2Y3QA 4YXMA 4DYZA 3EGMA 4ZJKA 4PG0A 5J9VA 5E2DA 4RC5A 4LQJA 2G38B 3DBYA 2XJMA 4IWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVR A;  2G4H A;  4AM5 A;  3KA8 A;  1RCD A;  4DYU A;  5JKL A;  1BCF A;  5LS9 A;  3QB9 A;  2IU2 A;  3SE1 A;  5FEJ A;  5D8S A;  1JIG A;  3ISE A;  2V2S A;  1LB3 A;  4TW3 A;  5CMQ A;  3VNX A;  5HJF A;  3H7G A;  1GWG A;  3F37 A;  3PW1 A;  5FFA A;  5GN8 B;  3QHB A;  1NNQ A;  4ZMC A;  5I4J A;  2V15 A;  5K52 A;  1B71 A;  1YUX A;  2C2J A;  4PG1 A;  1F33 A;  5FFD A;  2V2I A;  2ZUR X;  1OTK A;  1AEW A;  3WNW A;  1L8I A;  4TOE A;  4OYN A;  4RC6 A;  3QD8 A;  4QUW A;  1EUM A;  3PVY B;  1IES A;  2CF7 A;  4RC7 A;  3FSE A;  4CMY V;  1LKO A;  1JKV A;  3Q4N A;  3KX9 A;  5HJH A;  2V2M A;  5J8S A;  4CVS A;  4ML5 A;  2WTL A;  4DZ0 A;  2IB0 A;  4RC7 B;  3RGD A;  2ZG8 X;  1NF6 A;  3AJQ A;  2FZF A;  3SID A;  2FG4 A;  4TOF A;  4LQN A;  3IS7 A;  1TK6 A;  3F39 A;  3O7S A;  3OJ5 A;  3FI6 A;  4MJY A;  1RCE A;  3UNO A;  3F33 A;  2C2U A;  4MKU A;  2VZB A;  4LYU A;  1VEI A;  4LQH A;  2RBD A;  1JI5 A;  1QGH A;  4ITW A;  3OGH A;  3FVB A;  4M32 A;  3R2M A;  4CYB A;  2YJK A;  4MN9 A;  3KA9 A;  4DYY A;  1JI4 A;  3E1M A;  3GVY A;  4LPJ A;  1BG7 A;  1DPS A;  5D8X A;  3UOI A;  3AK9 A;  4CYA A;  1ZUJ A;  3E1P A;  3AF9 X;  2CLU A;  2BKC A;  2V2J A;  3GHQ A;  2Z6M A;  3IS8 A;  3AK8 A;  4EVC A;  3SH6 A;  4XKU A;  1VJX A;  1S30 A;  3R2H A;  3TA8 A;  1SOF A;  3Q4Q A;  3WVW A;  2V2L A;  4LPM A;  2ZG9 X;  3BVF A;  4II4 B;  1F30 A;  2ZG7 X;  1TKO A;  1RCC A;  5JKM A;  3F36 A;  4IXK A;  5D8R A;  3GE4 A;  1Z4A A;  5GN8 A;  5CZU A;  3ISF A;  5D8Q A;  1QYB A;  2VXX A;  4TOA A;  2GYQ A;  2ZA7 A;  3PZA A;  1ZS3 A;  2FFX J;  3WVV A;  3E1N A;  3R2L A;  2V2P A;  1J30 A;  4LPN A;  3RAV A;  3RBC A;  4TOG A;  3PVY A;  4AM4 A;  1VEL A;  1IER A;  3NP0 X;  5FFB A;  4TOC A;  5JKL G;  4RC8 A;  3BVL A;  1KRQ A;  4CVP A;  3NOZ X;  4Y08 A;  1JYB A;  2V2O A;  2C41 A;  2XKQ A;  4PGK A;  1TJO A;  2JD8 0;  5GOU A;  4XKS A;  4MUD A;  2CEI A;  4DI0 A;  3E6R A;  1XZ1 A;  2W0O A;  2ZA6 A;  5AXS A;  5D8P A;  3E2C A;  4ERU A;  4ETR A;  1N1Q A;  4XGS A;  4ZKW A;  4CY9 A;  1MOJ A;  4DYX A;  1L8H A;  1YUZ A;  5GU2 X;  2F7N A;  3QVD A;  4ZL5 A;  3A9Q A;  2V2N A;  3HL1 A;  1UVH A;  2Z90 A;  2CHP A;  5GU0 X;  1VEQ A;  2D5K A;  4ZKH A;  3ES3 A;  5FFE A;  1TKP A;  3KA6 A;  3KA3 A;  4REU A;  1O9I A;  1VLG A;  4AM2 A;  2OC5 A;  4ZKX A;  3PW8 A;  1XZ3 A;  2FG8 A;  5HQO A;  2FL0 A;  2Z5Q A;  1MFR A;  4R42 A;  3BVI A;  2PYB A;  1S2Z A;  3QHC A;  1R03 A;  3WVU A;  5D8Y A;  5J93 A;  5C6F A;  3E1O A;  3E1L A;  3E6S A;  3UOF A;  4Z5S A;  2XGW A;  4PGI A;  2CN7 A;  4TOD A;  1JRE A;  2Z5R A;  4II4 A;  4EVE A;  5ERJ A;  2ZA8 A;  4XKT A;  2C6R A;  3PWF A;  1LKM A;  4KVQ A;  4KVS A;  4M35 A;  2FJC A;  2UX1 A;  4A25 A;  1DVB A;  1YV1 A;  5E1U A;  3U90 A;  2QQY A;  1FHA A;  4ISP A;  4MY7 A;  3PVT A;  2YW7 A;  2XJN A;  3QZ3 A;  5LG2 A;  2HR5 A;  5ERK A;  3MPS A;  4ZTT A;  2X17 0;  3PWQ A;  5FFC A;  3AJP A;  5GU3 X;  5LG8 A;  4TOH A;  5D8O A;  2CN6 A;  3PVT B;  3AJO A;  4RC5 B;  4Z3B A;  1JGC A;  2CLB A;  4TOB A;  3F32 A;  5JAC A;  3KWO A;  3BVE A;  3PVR B;  4DAS A;  3F34 A;  2XJO A;  2BJY A;  3A68 A;  3SHX A;  4DE6 A;  4P18 A;  5JKM G;  4E6K A;  3R2S A;  2BK6 A;  3E1J A;  3PW8 C;  1Z6O M;  5GU1 X;  1JTS A;  3F38 A;  3Q4R A;  3BVK A;  2FKZ A;  1Z6O A;  3ERZ A;  3KA4 A;  3PW1 B;  1RCI A;  2VXI A;  5LBH A;  4YKH A;  3R2K A;  3BKN A;  1JKU A;  5IX6 A;  3IQ1 A;  3RD0 A;  2IY4 A;  3O7R A;  3Q4O A;  4RC6 B;  2WLU A;  5CMR A;  4M33 A;  3T9J A;  2HTN A;  1RYT A;  2OH3 A;  2BW1 A;  3AF8 X;  2CHI A;  4LQV A;  3NP2 X;  2GYD A;  4CVR A;  4CVT A;  2YJJ A;  4EVB A;  2C2F A;  2GS4 A;  2JD6 0;  1RCG A;  3EZU A;  2YW6 A;  1BFR A;  3BT5 A;  4ZLW A;  3R2R A;  4IWJ A;  2CIH A;  2QF9 A;  4ISM A;  4ITT A;  5J8W A;  1H96 A;  3AF7 X;  1NF4 A;  1S3Q A;  3PWQ C;  4U3G A;  2JD7 0;  4TO9 A;  5K53 A;  3KXU A;  4EVD A;  3F35 A;  2FHA A;  1NFV A;  4CMY A;  2V2R A;  4KVR A;  1SQ3 A;  2Z5P A;  3EZ0 A;  1DAT A;  4M34 A;  4ZL6 A;  1O9R A;  1LKP A;  2WLA A;  1HRS A;  3HIU A;  1UMN A;  4LYX A;  3E1Q A;  3RE7 A;  3R2O A;  2ITB A;  2Y3Q A;  4DYZ A;  4ZJK A;  3EGM A;  4PG0 A;  5J9V A;  5E2D A;  4RC5 A;  4LQJ A;  2XJM A;  4IWK A; 
#chains in the Genus database with same CATH topology
 3PVR A;  2G4H A;  4AM5 A;  3KA8 A;  1RCD A;  3LKD A;  4DYU A;  5JKL A;  1BCF A;  5LS9 A;  3N6O A;  3QB9 A;  2IU2 A;  3SE1 A;  5FEJ A;  5D8S A;  1JIG A;  3ISE A;  2V2S A;  1LB3 A;  4TW3 A;  5CMQ A;  3VNX A;  5HJF A;  3H7G A;  1GWG A;  3KDQ A;  3F37 A;  3PW1 A;  5FFA A;  5GN8 B;  3QHB A;  1NNQ A;  4ZMC A;  5I4J A;  2V15 A;  5K52 A;  1B71 A;  1YUX A;  2C2J A;  4PG1 A;  1F33 A;  5FFD A;  5JDO A;  2V2I A;  2ZUR X;  1OTK A;  1AEW A;  3WNW A;  1L8I A;  4TOE A;  4OYN A;  4RC6 A;  3QD8 A;  4QUW A;  1EUM A;  3PVY B;  1IES A;  2CF7 A;  4RC7 A;  3FSE A;  4CMY V;  1LKO A;  1JKV A;  3Q4N A;  3KX9 A;  5HJH A;  2V2M A;  5J8S A;  4CVS A;  4ML5 A;  2WTL A;  4DZ0 A;  4W4L B;  2IB0 A;  4RC7 B;  3RGD A;  2ZG8 X;  1NF6 A;  3AJQ A;  2FZF A;  3SID A;  3C1Y A;  2FG4 A;  4TOF A;  4LQN A;  3IS7 A;  1TK6 A;  2CWL A;  3F39 A;  3O7S A;  3OJ5 A;  3FI6 A;  4MJY A;  1RCE A;  3UNO A;  3JZA B;  3F33 A;  2C2U A;  4MKU A;  2VZB A;  4LYU A;  1VEI A;  4LQH A;  2RBD A;  1JI5 A;  1QGH A;  4ITW A;  3OGH A;  3FVB A;  4M32 A;  3R2M A;  4CYB A;  2YJK A;  4MN9 A;  3KA9 A;  4DYY A;  1JI4 A;  3E1M A;  3GVY A;  1BG7 A;  4LPJ A;  1DPS A;  5D8X A;  3UOI A;  3AK9 A;  4CYA A;  1ZUJ A;  3E1P A;  3AF9 X;  4KXR B;  4W4K B;  2CLU A;  2BKC A;  2V2J A;  3GHQ A;  2Z6M A;  3IS8 A;  4E40 A;  3AK8 A;  4EVC A;  3SH6 A;  4XKU A;  1VJX A;  1S30 A;  3R2H A;  3TA8 A;  1SOF A;  3Q4Q A;  3WVW A;  2V2L A;  4LPM A;  2ZG9 X;  2OKC A;  3BVF A;  4II4 B;  1F30 A;  2ZG7 X;  1TKO A;  1RCC A;  3JZ9 A;  5JKM A;  3F36 A;  4IXK A;  5D8R A;  3GE4 A;  1Z4A A;  5GN8 A;  5CZU A;  3ISF A;  5D8Q A;  1QYB A;  2VXX A;  4TOA A;  2GYQ A;  2ZA7 A;  3PZA A;  1ZS3 A;  2FFX J;  3WVV A;  3E1N A;  3R2L A;  2V2P A;  1J30 A;  4LPN A;  3RAV A;  3RBC A;  4TOG A;  3PVY A;  4AM4 A;  1VEL A;  1IER A;  3NP0 X;  5FFB A;  4MXP A;  4TOC A;  5JKL G;  4RC8 A;  3BVL A;  1KRQ A;  4CVP A;  3NOZ X;  4Y08 A;  1JYB A;  2V2O A;  2C41 A;  2XKQ A;  4PGK A;  1TJO A;  2JD8 0;  5GOU A;  4XKS A;  4MUD A;  2CEI A;  4DI0 A;  3E6R A;  1XZ1 A;  2W0O A;  2ZA6 A;  5AXS A;  5D8P A;  3E2C A;  4ERU A;  4ETR A;  1N1Q A;  4XGS A;  4ZKW A;  3D19 A;  4CY9 A;  1MOJ A;  4DYX A;  3GGZ A;  1L8H A;  1YUZ A;  5GU2 X;  2F7N A;  3QVD A;  4ZL5 A;  3C21 A;  3VVA A;  3A9Q A;  2V2N A;  5HU6 D;  3HL1 A;  1UVH A;  2AR0 A;  2Z90 A;  2CHP A;  5GU0 X;  1VEQ A;  2D5K A;  4ZKH A;  4YXJ A;  3ES3 A;  3VV9 A;  5FFE A;  1TKP A;  2V8U A;  3KA6 A;  3KA3 A;  4REU A;  1O9I A;  1VLG A;  4WJG 4;  4AM2 A;  2OC5 A;  4ZKX A;  3PW8 A;  1XZ3 A;  2FG8 A;  5HQO A;  2FL0 A;  2Z5Q A;  1MFR A;  4R42 A;  3BVI A;  2PYB A;  1S2Z A;  3GGY A;  3QHC A;  1R03 A;  3WVU A;  5D8Y A;  5J93 A;  5C6F A;  3E1O A;  3E1L A;  3E6S A;  3UOF A;  4Z5S A;  2XGW A;  4PGI A;  2CN7 A;  4TOD A;  1JRE A;  2Z5R A;  4II4 A;  4EVE A;  5ERJ A;  2ZA8 A;  4XKT A;  2C6R A;  3PWF A;  1LKM A;  4YVZ A;  4KVQ A;  4KVS A;  4M35 A;  2FJC A;  4X0J A;  2UX1 A;  4A25 A;  1DVB A;  1YV1 A;  3M6J A;  5E1U A;  3U90 A;  2QQY A;  1FHA A;  4ISP A;  4MY7 A;  3PVT A;  2YW7 A;  2XJN A;  3QZ3 A;  5LG2 A;  2HR5 A;  5ERK A;  3MPS A;  4ZTT A;  3FRS A;  2X17 0;  3PWQ A;  5FFC A;  3AJP A;  5GU3 X;  5LG8 A;  4TOH A;  5D8O A;  2CN6 A;  3PVT B;  3AJO A;  4RC5 B;  4Z3B A;  1JGC A;  2CLB A;  4TOB A;  3F32 A;  5JAC A;  3KWO A;  3BVE A;  3PVR B;  4DAS A;  3UFB A;  3F34 A;  2XJO A;  2BJY A;  3A68 A;  3SHX A;  4DE6 A;  4P18 A;  3KHK A;  5JKM G;  4E6K A;  3R2S A;  2BK6 A;  3E1J A;  2Y44 A;  3PW8 C;  2MGY A;  1Z6O M;  5GU1 X;  1JTS A;  2V8T A;  3F38 A;  3Q4R A;  2WWX B;  3BVK A;  2FKZ A;  1Z6O A;  3ERZ A;  3KA4 A;  3PW1 B;  1RCI A;  2VXI A;  5LBH A;  3C23 A;  4YKH A;  3R2K A;  3BKN A;  1JKU A;  5IX6 A;  3IQ1 A;  3RD0 A;  2IY4 A;  5JDO B;  3O7R A;  2N02 A;  3Q4O A;  4RC6 B;  3V3K B;  2WLU A;  5CMR A;  4M33 A;  3T9J A;  2HTN A;  1RYT A;  2OH3 A;  2BW1 A;  3AF8 X;  2CHI A;  3C1Z A;  4LQV A;  3NP2 X;  2GYD A;  4CVR A;  4CVT A;  2YJJ A;  4EVB A;  2C2F A;  2GS4 A;  2JD6 0;  1RCG A;  3EZU A;  2YW6 A;  1BFR A;  3BT5 A;  4ZLW A;  3R2R A;  4IWJ A;  2CIH A;  2QF9 A;  4ISM A;  4ITT A;  5J8W A;  1H96 A;  3AF7 X;  1NF4 A;  1S3Q A;  3PWQ C;  4U3G A;  2JD7 0;  4TO9 A;  5K53 A;  3L0M A;  3KXU A;  4EVD A;  3F35 A;  2FHA A;  1NFV A;  4CMY A;  2V2R A;  4KVR A;  3W54 A;  1SQ3 A;  2Z5P A;  3EZ0 A;  1DAT A;  4M34 A;  4ZL6 A;  1O9R A;  1LKP A;  2WLA A;  1HRS A;  3FRR A;  3HIU A;  1UMN A;  4LYX A;  3E1Q A;  3RE7 A;  3R2O A;  2ITB A;  2Y3Q A;  4YXM A;  4DYZ A;  3EGM A;  4ZJK A;  4PG0 A;  5J9V A;  5E2D A;  4RC5 A;  4LQJ A;  2G38 B;  3DBY A;  2XJM A;  4IWK A; 
#chains in the Genus database with same CATH homology
 3PVR A;  2G4H A;  4AM5 A;  3KA8 A;  1RCD A;  3LKD A;  4DYU A;  5JKL A;  1BCF A;  5LS9 A;  3N6O A;  3QB9 A;  2IU2 A;  3SE1 A;  5FEJ A;  5D8S A;  1JIG A;  3ISE A;  2V2S A;  1LB3 A;  4TW3 A;  5CMQ A;  3VNX A;  5HJF A;  3H7G A;  1GWG A;  3KDQ A;  3F37 A;  3PW1 A;  5FFA A;  5GN8 B;  3QHB A;  1NNQ A;  4ZMC A;  5I4J A;  2V15 A;  5K52 A;  1B71 A;  1YUX A;  2C2J A;  4PG1 A;  1F33 A;  5FFD A;  5JDO A;  2V2I A;  2ZUR X;  1OTK A;  1AEW A;  3WNW A;  1L8I A;  4TOE A;  4OYN A;  4RC6 A;  3QD8 A;  4QUW A;  1EUM A;  3PVY B;  1IES A;  2CF7 A;  4RC7 A;  3FSE A;  4CMY V;  1LKO A;  1JKV A;  3Q4N A;  3KX9 A;  5HJH A;  2V2M A;  5J8S A;  4CVS A;  4ML5 A;  2WTL A;  4DZ0 A;  4W4L B;  2IB0 A;  4RC7 B;  3RGD A;  2ZG8 X;  1NF6 A;  3AJQ A;  2FZF A;  3SID A;  3C1Y A;  2FG4 A;  4TOF A;  4LQN A;  3IS7 A;  1TK6 A;  2CWL A;  3F39 A;  3O7S A;  3OJ5 A;  3FI6 A;  4MJY A;  1RCE A;  3UNO A;  3JZA B;  3F33 A;  2C2U A;  4MKU A;  2VZB A;  4LYU A;  1VEI A;  4LQH A;  2RBD A;  1JI5 A;  1QGH A;  4ITW A;  3OGH A;  3FVB A;  4M32 A;  3R2M A;  4CYB A;  2YJK A;  4MN9 A;  3KA9 A;  4DYY A;  1JI4 A;  3E1M A;  3GVY A;  1BG7 A;  4LPJ A;  1DPS A;  5D8X A;  3UOI A;  3AK9 A;  4CYA A;  1ZUJ A;  3E1P A;  3AF9 X;  4KXR B;  4W4K B;  2CLU A;  2BKC A;  2V2J A;  3GHQ A;  2Z6M A;  3IS8 A;  4E40 A;  3AK8 A;  4EVC A;  3SH6 A;  4XKU A;  1VJX A;  1S30 A;  3R2H A;  3TA8 A;  1SOF A;  3Q4Q A;  3WVW A;  2V2L A;  4LPM A;  2ZG9 X;  2OKC A;  3BVF A;  4II4 B;  1F30 A;  2ZG7 X;  1TKO A;  1RCC A;  3JZ9 A;  5JKM A;  3F36 A;  4IXK A;  5D8R A;  3GE4 A;  1Z4A A;  5GN8 A;  5CZU A;  3ISF A;  5D8Q A;  1QYB A;  2VXX A;  4TOA A;  2GYQ A;  2ZA7 A;  3PZA A;  1ZS3 A;  2FFX J;  3WVV A;  3E1N A;  3R2L A;  2V2P A;  1J30 A;  4LPN A;  3RAV A;  3RBC A;  4TOG A;  3PVY A;  4AM4 A;  1VEL A;  1IER A;  3NP0 X;  5FFB A;  4MXP A;  4TOC A;  5JKL G;  4RC8 A;  3BVL A;  1KRQ A;  4CVP A;  3NOZ X;  4Y08 A;  1JYB A;  2V2O A;  2C41 A;  2XKQ A;  4PGK A;  1TJO A;  2JD8 0;  5GOU A;  4XKS A;  4MUD A;  2CEI A;  4DI0 A;  3E6R A;  1XZ1 A;  2W0O A;  2ZA6 A;  5AXS A;  5D8P A;  3E2C A;  4ERU A;  4ETR A;  1N1Q A;  4XGS A;  4ZKW A;  3D19 A;  4CY9 A;  1MOJ A;  4DYX A;  3GGZ A;  1L8H A;  1YUZ A;  5GU2 X;  2F7N A;  3QVD A;  4ZL5 A;  3C21 A;  3VVA A;  3A9Q A;  2V2N A;  5HU6 D;  3HL1 A;  1UVH A;  2AR0 A;  2Z90 A;  2CHP A;  5GU0 X;  1VEQ A;  2D5K A;  4ZKH A;  4YXJ A;  3ES3 A;  3VV9 A;  5FFE A;  1TKP A;  2V8U A;  3KA6 A;  3KA3 A;  4REU A;  1O9I A;  1VLG A;  4WJG 4;  4AM2 A;  2OC5 A;  4ZKX A;  3PW8 A;  1XZ3 A;  2FG8 A;  5HQO A;  2FL0 A;  2Z5Q A;  1MFR A;  4R42 A;  3BVI A;  2PYB A;  1S2Z A;  3GGY A;  3QHC A;  1R03 A;  3WVU A;  5D8Y A;  5J93 A;  5C6F A;  3E1O A;  3E1L A;  3E6S A;  3UOF A;  4Z5S A;  2XGW A;  4PGI A;  2CN7 A;  4TOD A;  1JRE A;  2Z5R A;  4II4 A;  4EVE A;  5ERJ A;  2ZA8 A;  4XKT A;  2C6R A;  3PWF A;  1LKM A;  4YVZ A;  4KVQ A;  4KVS A;  4M35 A;  2FJC A;  4X0J A;  2UX1 A;  4A25 A;  1DVB A;  1YV1 A;  3M6J A;  5E1U A;  3U90 A;  2QQY A;  1FHA A;  4ISP A;  4MY7 A;  3PVT A;  2YW7 A;  2XJN A;  3QZ3 A;  5LG2 A;  2HR5 A;  5ERK A;  3MPS A;  4ZTT A;  3FRS A;  2X17 0;  3PWQ A;  5FFC A;  3AJP A;  5GU3 X;  5LG8 A;  4TOH A;  5D8O A;  2CN6 A;  3PVT B;  3AJO A;  4RC5 B;  4Z3B A;  1JGC A;  2CLB A;  4TOB A;  3F32 A;  5JAC A;  3KWO A;  3BVE A;  3PVR B;  4DAS A;  3UFB A;  3F34 A;  2XJO A;  2BJY A;  3A68 A;  3SHX A;  4DE6 A;  4P18 A;  3KHK A;  5JKM G;  4E6K A;  3R2S A;  2BK6 A;  3E1J A;  2Y44 A;  3PW8 C;  2MGY A;  1Z6O M;  5GU1 X;  1JTS A;  2V8T A;  3F38 A;  3Q4R A;  2WWX B;  3BVK A;  2FKZ A;  1Z6O A;  3ERZ A;  3KA4 A;  3PW1 B;  1RCI A;  2VXI A;  5LBH A;  3C23 A;  4YKH A;  3R2K A;  3BKN A;  1JKU A;  5IX6 A;  3IQ1 A;  3RD0 A;  2IY4 A;  5JDO B;  3O7R A;  2N02 A;  3Q4O A;  4RC6 B;  3V3K B;  2WLU A;  5CMR A;  4M33 A;  3T9J A;  2HTN A;  1RYT A;  2OH3 A;  2BW1 A;  3AF8 X;  2CHI A;  3C1Z A;  4LQV A;  3NP2 X;  2GYD A;  4CVR A;  4CVT A;  2YJJ A;  4EVB A;  2C2F A;  2GS4 A;  2JD6 0;  1RCG A;  3EZU A;  2YW6 A;  1BFR A;  3BT5 A;  4ZLW A;  3R2R A;  4IWJ A;  2CIH A;  2QF9 A;  4ISM A;  4ITT A;  5J8W A;  1H96 A;  3AF7 X;  1NF4 A;  1S3Q A;  3PWQ C;  4U3G A;  2JD7 0;  4TO9 A;  5K53 A;  3L0M A;  3KXU A;  4EVD A;  3F35 A;  2FHA A;  1NFV A;  4CMY A;  2V2R A;  4KVR A;  3W54 A;  1SQ3 A;  2Z5P A;  3EZ0 A;  1DAT A;  4M34 A;  4ZL6 A;  1O9R A;  1LKP A;  2WLA A;  1HRS A;  3FRR A;  3HIU A;  1UMN A;  4LYX A;  3E1Q A;  3RE7 A;  3R2O A;  2ITB A;  2Y3Q A;  4YXM A;  4DYZ A;  3EGM A;  4ZJK A;  4PG0 A;  5J9V A;  5E2D A;  4RC5 A;  4LQJ A;  2G38 B;  3DBY A;  2XJM A;  4IWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...