5K52A

Crystal structures of aldehyde deformylating oxygenase from limnothrix sp. knua012
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
221
structure length
221
Chain Sequence
IDYQSETYKDAYSRINAIVIEGEDEAANNYVRLAELMPEQSEELASLAKMEARHKKGFTACGKNLNVTPDMDFAKKFFSDLHGNFQVAAAAGNIVTCLLIQALIIEAFAISAYNVYIPHADDFARKITENVVKDEYLHLNFGEQWLKANFESAKDELERANRENLAIVWRMLDEVAGDALVLGMEKEALMEDFTIAYQEALQNIGFSTRETLRMLTAGLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldehyde decarbonylase
publication title Crystal structures of aldehyde deformylating oxygenase from Limnothrix sp. KNUA012 and Oscillatoria sp. KNUA011.
pubmed doi rcsb
source organism Limnothrix sp. knua012
molecule tags Metal binding protein
total genus 92
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 4.1.99.5: Aldehyde oxygenase (deformylating).
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11266 Ald_deCOase Long-chain fatty aldehyde decarbonylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 5k52A01
3UOIA 2XJMA 3Q4QA 5LS9A 1NFVA 1O9RA 4KVSA 3NP0X 3PVRA 5D8PA 5GU2X 3ERZA 4REUA 2JD60 2CLUA 2VXIA 4ZKWA 5E1UA 3UNOA 4DZ0A 2BW1A 3RGDA 3R2LA 3EZUA 5J93A 2CEIA 4AM5A 1VEIA 1NF4A 3PVYB 3PZAA 3QVDA 3PWFA 4CMYA 2JD70 1GWGA 1S30A 4DYZA 2IB0A 1JKUA 1VELA 2FL0A 4TOEA 4CVSA 4TOBA 5D8RA 1ZS3A 3T9JA 2ZA8A 5K53A 3F36A 2GYDA 3Q4OA 3QHCA 5D8YA 1ZUJA 3SIDA 5ERKA 2FJCA 5GU1X 3IS8A 3R2OA 2D5KA 4CVPA 1IERA 2QF9A 2X170 3AJQA 4YKHA 1QYBA 5HJFA 3PVYA 3F32A 3ES3A 2Z5PA 1F33A 3KXUA 5CMQA 4A25A 2ZA6A 3E6RA 3AF9X 4MKUA 1MOJA 3KA8A 4ZJKA 3Q4NA 4XKSA 2V2LA 3PW1B 5JKMG 1RCIA 2GYQA 3MPSA 5J9VA 2ZA7A 5GN8A 4ERUA 3A9QA 5LBHA 2C2FA 1MFRA 3WNWA 4LQVA 3NOZX 5C6FA 4Z3BA 2CN6A 3OJ5A 4LQJA 2VXXA 5HQOA 1FHAA 2V2RA 4TW3A 4IXKA 4OYNA 4DI0A 4IWJA 3BVFA 3WVUA 4KVRA 4ZKHA 2CHIA 4RC8A 1AEWA 2V2PA 3KA6A 1NF6A 4XKUA 5FFAA 1LKOA 2BJYA 3WVVA 3AF7X 3QHBA 4LYXA 3E1QA 4P18A 4LQNA 3KA9A 5FFCA 1BCFA 3R2HA 2HR5A 4ZTTA 5JKMA 1R03A 4DYUA 2XJNA 4DYXA 1YUXA 1JREA 1F30A 5ERJA 4MY7A 2V2OA 1JI5A 4ITTA 2BKCA 3KWOA 4DASA 1JKVA 1O9IA 3RBCA 4PGIA 2CF7A 4TOFA 4XGSA 5CZUA 2ZG8X 2CHPA 4RC7B 2V15A 5FEJA 4ITWA 4TOHA 2YW6A 2FZFA 2JD80 1VJXA 4M33A 5E2DA 4ML5A 2ZURX 5D8XA 3WVWA 2XGWA 3QZ3A 1BFRA 5AXSA 1RCDA 1JIGA 4ZL5A 3E1JA 2XKQA 3GE4A 3BVEA 2IY4A 2V2IA 2OH3A 3KA4A 3F39A 3F34A 1DVBA 1QGHA 1S3QA 1JTSA 4RC7A 5D8OA 3E1MA 2ZG7X 3UOFA 4RC6B 1N1QA 2FHAA 4XKTA 4LPMA 3RE7A 3SH6A 2Z5RA 3PVTB 5HJHA 1IESA 2V2JA 3VNXA 3E1OA 4II4B 3TA8A 5JKLG 1UMNA 2G4HA 4Z5SA 3HL1A 3Q4RA 2RBDA 2WLUA 1XZ3A 4DYYA 3IS7A 4RC5B 4QUWA 1RCCA 4MJYA 2YW7A 2ZG9X 3PWQA 3BVLA 1YV1A 1TJOA 3FSEA 3RD0A 3O7RA 3E6SA 4LQHA 5JACA 4RC6A 1JGCA 2QQYA 2CN7A 1HRSA 3GVYA 5FFDA 5GU3X 1TKPA 2F7NA 5FFBA 3E1LA 3SE1A 3KX9A 2VZBA 3KA3A 1RYTA 4II4A 2C6RA 5GU0X 4IWKA 1Z4AA 1OTKA 2BK6A 2C41A 2YJKA 3OGHA 3FVBA 5FFEA 3PW1A 2Y3QA 3PVRB 5K52A 1L8IA 4RC5A 1EUMA 5JKLA 3E1PA 4EVEA 4TOCA 4MN9A 1H96A 1SOFA 4ETRA 4LYUA 3IQ1A 1KRQA 4PG0A 4PGKA 2XJOA 4ZMCA 3R2KA 2W0OA 1TK6A 1NNQA 2HTNA 3F33A 2GS4A 4CVTA 4LPNA 1SQ3A 1LKMA 4ISMA 4Y08A 2FFXJ 2C2JA 4KVQA 3U90A 3BT5A 1LKPA 4EVCA 3R2RA 3GHQA 2V2SA 4M34A 4U3GA 4DE6A 4EVDA 3R2MA 4AM4A 3PWQC 5J8WA 2Z5QA 5GOUA 4MUDA 2FG4A 1DATA 2FG8A 2OC5A 2C2UA 3ISEA 4CVRA 3O7SA 3HIUA 3F35A 2CLBA 4LPJA 4CYAA 3PW8A 1JI4A 4TOAA 2Z6MA 1LB3A 4CY9A 2IU2A 5GN8B 5CMRA 5D8SA 4CYBA 4AM2A 3BVKA 3A68A 2ITBA 5LG2A 4R42A 1L8HA 3RAVA 5IX6A 3NP2X 2V2MA 3AK9A 4TO9A 2FKZA 4M32A 2UX1A 3BKNA 1RCGA 3F38A 2YJJA 1RCEA 3EZ0A 5D8QA 2PYBA 4M35A 4TOGA 5I4JA 3R2SA 3ISFA 3AJPA 3PVTA 2WLAA 3EGMA 1DPSA 4ZL6A 3QD8A 3AJOA 2CIHA 4CMYV 5J8SA 3AK8A 4ISPA 4EVBA 4PG1A 3H7GA 1Z6OM 3E2CA 2WTLA 3SHXA 3QB9A 3AF8X 1VLGA 4ZKXA 1BG7A 1XZ1A 3E1NA 1JYBA 1S2ZA 1TKOA 4TODA 1UVHA 3F37A 5LG8A 4E6KA 1J30A 2V2NA 3PW8C 3BVIA 4ZLWA 3FI6A 2Z90A 1Z6OA 1B71A 1VEQA 1YUZA
chains in the Genus database with same CATH superfamily
3UOIA 2G38B 2XJMA 3Q4QA 5LS9A 1NFVA 1O9RA 4KVSA 3NP0X 3PVRA 5D8PA 5GU2X 3ERZA 4REUA 2JD60 2CWLA 2CLUA 2VXIA 4ZKWA 5E1UA 3UNOA 4DZ0A 2BW1A 3RGDA 3R2LA 3EZUA 5J93A 2CEIA 4AM5A 1VEIA 1NF4A 3PVYB 3PZAA 3QVDA 3PWFA 4CMYA 2JD70 1GWGA 1S30A 4DYZA 2IB0A 1JKUA 1VELA 2FL0A 4TOEA 2V8TA 4CVSA 4TOBA 5D8RA 1ZS3A 3T9JA 3VVAA 2ZA8A 5K53A 3F36A 2GYDA 3Q4OA 3QHCA 5D8YA 1ZUJA 3SIDA 5ERKA 2FJCA 4WJG4 5GU1X 3IS8A 3R2OA 3C1ZA 2D5KA 4CVPA 1IERA 2QF9A 5JDOB 2X170 3AJQA 4YKHA 1QYBA 5HJFA 3PVYA 3F32A 4YXJA 3ES3A 2Z5PA 1F33A 3KXUA 5CMQA 4A25A 2ZA6A 3E6RA 3AF9X 4MKUA 1MOJA 3KA8A 4ZJKA 3Q4NA 4XKSA 2V2LA 3PW1B 5JKMG 1RCIA 2GYQA 3MPSA 5J9VA 2ZA7A 5GN8A 4ERUA 3A9QA 3L0MA 5LBHA 2C2FA 1MFRA 3WNWA 4LQVA 3NOZX 5C6FA 3JZ9A 4Z3BA 2CN6A 3OJ5A 4LQJA 2VXXA 5HQOA 1FHAA 3GGZA 2V2RA 4TW3A 2N02A 4IXKA 4OYNA 4DI0A 4IWJA 3BVFA 3WVUA 4KVRA 4ZKHA 2CHIA 4RC8A 1AEWA 2V2PA 3KA6A 1NF6A 4XKUA 5FFAA 1LKOA 2BJYA 3WVVA 3AF7X 3QHBA 4LYXA 3E1QA 3N6OA 4P18A 4LQNA 4X0JA 3KA9A 5FFCA 1BCFA 3C23A 3R2HA 2HR5A 4ZTTA 5JKMA 1R03A 4DYUA 2XJNA 4DYXA 1YUXA 1JREA 1F30A 5ERJA 4MY7A 2V2OA 1JI5A 4ITTA 2BKCA 3KWOA 4DASA 1JKVA 1O9IA 3RBCA 4PGIA 2CF7A 4TOFA 4XGSA 5CZUA 2ZG8X 2CHPA 4RC7B 2V15A 5FEJA 4ITWA 4TOHA 2YW6A 2FZFA 4W4KB 2JD80 1VJXA 4M33A 5E2DA 4ML5A 2ZURX 5D8XA 3WVWA 2XGWA 3QZ3A 1BFRA 5AXSA 1RCDA 1JIGA 4ZL5A 3E1JA 2XKQA 3GE4A 3BVEA 2IY4A 2V2IA 2OH3A 3KA4A 3F39A 3C21A 3F34A 1DVBA 1QGHA 1S3QA 1JTSA 4RC7A 5D8OA 3E1MA 2ZG7X 3UOFA 4RC6B 1N1QA 2FHAA 3D19A 4XKTA 4LPMA 3RE7A 3SH6A 2Z5RA 3PVTB 5HJHA 1IESA 2V2JA 3VNXA 3E1OA 4II4B 3TA8A 5JKLG 1UMNA 2G4HA 4Z5SA 3HL1A 3Q4RA 2RBDA 2WLUA 1XZ3A 4DYYA 3IS7A 4RC5B 4QUWA 1RCCA 4MJYA 2YW7A 4E40A 2ZG9X 3PWQA 3BVLA 3C1YA 1YV1A 1TJOA 3FSEA 3RD0A 3O7RA 3E6SA 4LQHA 5JDOA 5JACA 4RC6A 1JGCA 2QQYA 2CN7A 1HRSA 3GVYA 5FFDA 5GU3X 1TKPA 2F7NA 5FFBA 3E1LA 3SE1A 3KX9A 2VZBA 3KA3A 1RYTA 4II4A 2C6RA 5GU0X 4IWKA 1Z4AA 1OTKA 2BK6A 2C41A 2YJKA 3OGHA 3FVBA 5FFEA 3LKDA 3PW1A 2Y3QA 3PVRB 3V3KB 4YVZA 5K52A 1L8IA 4RC5A 1EUMA 4YXMA 5JKLA 3E1PA 4EVEA 4TOCA 4MN9A 3FRRA 1H96A 1SOFA 4ETRA 4LYUA 3IQ1A 1KRQA 4PG0A 4PGKA 2XJOA 4ZMCA 3R2KA 2W0OA 3UFBA 1TK6A 1NNQA 2HTNA 3F33A 2GS4A 3M6JA 4CVTA 4LPNA 1SQ3A 1LKMA 4ISMA 4Y08A 2FFXJ 2C2JA 4KVQA 3U90A 3BT5A 1LKPA 4EVCA 3R2RA 3GHQA 3FRSA 2V2SA 4M34A 4U3GA 4DE6A 4EVDA 3R2MA 4AM4A 3JZAB 3PWQC 5J8WA 2Z5QA 5GOUA 4MUDA 2FG4A 3VV9A 1DATA 2FG8A 2OC5A 2C2UA 3ISEA 4CVRA 2Y44A 3O7SA 3HIUA 3F35A 2CLBA 4LPJA 4CYAA 3PW8A 1JI4A 4TOAA 2Z6MA 1LB3A 2AR0A 4W4LB 4CY9A 2IU2A 5GN8B 5CMRA 5D8SA 4CYBA 4AM2A 2MGYA 3BVKA 3A68A 2ITBA 5LG2A 4R42A 1L8HA 3RAVA 5IX6A 3NP2X 2V2MA 3AK9A 4TO9A 5HU6D 2FKZA 4M32A 2UX1A 3BKNA 1RCGA 2WWXB 3F38A 2YJJA 1RCEA 3EZ0A 5D8QA 3GGYA 2PYBA 4M35A 3KDQA 4TOGA 5I4JA 4KXRB 3R2SA 3ISFA 3AJPA 3PVTA 2WLAA 3EGMA 3KHKA 1DPSA 4ZL6A 3QD8A 3AJOA 2CIHA 4CMYV 5J8SA 3AK8A 4ISPA 4EVBA 4PG1A 3DBYA 3H7GA 1Z6OM 3E2CA 2WTLA 4MXPA 3SHXA 3QB9A 3AF8X 1VLGA 4ZKXA 1BG7A 1XZ1A 3E1NA 1JYBA 1S2ZA 1TKOA 4TODA 1UVHA 3F37A 2OKCA 5LG8A 4E6KA 2V8UA 1J30A 2V2NA 3PW8C 3BVIA 4ZLWA 3FI6A 2Z90A 1Z6OA 1B71A 1VEQA 1YUZA 3W54A
chains in the Genus database with same CATH topology
3UOIA 2G38B 2XJMA 3Q4QA 5LS9A 1NFVA 1O9RA 4KVSA 3NP0X 3PVRA 5D8PA 5GU2X 3ERZA 4REUA 2JD60 2CWLA 2CLUA 2VXIA 4ZKWA 5E1UA 3UNOA 4DZ0A 2BW1A 3RGDA 3R2LA 3EZUA 5J93A 2CEIA 4AM5A 1VEIA 1NF4A 3PVYB 3PZAA 3QVDA 3PWFA 4CMYA 2JD70 1GWGA 1S30A 4DYZA 2IB0A 1JKUA 1VELA 2FL0A 4TOEA 2V8TA 4CVSA 4TOBA 5D8RA 1ZS3A 3T9JA 3VVAA 2ZA8A 5K53A 3F36A 2GYDA 3Q4OA 3QHCA 5D8YA 1ZUJA 3SIDA 5ERKA 2FJCA 4WJG4 5GU1X 3IS8A 3R2OA 3C1ZA 2D5KA 4CVPA 1IERA 2QF9A 5JDOB 2X170 3AJQA 4YKHA 1QYBA 5HJFA 3PVYA 3F32A 4YXJA 3ES3A 2Z5PA 1F33A 3KXUA 5CMQA 4A25A 2ZA6A 3E6RA 3AF9X 4MKUA 1MOJA 3KA8A 4ZJKA 3Q4NA 4XKSA 2V2LA 3PW1B 5JKMG 1RCIA 2GYQA 3MPSA 5J9VA 2ZA7A 5GN8A 4ERUA 3A9QA 3L0MA 5LBHA 2C2FA 1MFRA 3WNWA 4LQVA 3NOZX 5C6FA 3JZ9A 4Z3BA 2CN6A 3OJ5A 4LQJA 2VXXA 5HQOA 1FHAA 3GGZA 2V2RA 4TW3A 2N02A 4IXKA 4OYNA 4DI0A 4IWJA 3BVFA 3WVUA 4KVRA 4ZKHA 2CHIA 4RC8A 1AEWA 2V2PA 3KA6A 1NF6A 4XKUA 5FFAA 1LKOA 2BJYA 3WVVA 3AF7X 3QHBA 4LYXA 3E1QA 3N6OA 4P18A 4LQNA 4X0JA 3KA9A 5FFCA 1BCFA 3C23A 3R2HA 2HR5A 4ZTTA 5JKMA 1R03A 4DYUA 2XJNA 4DYXA 1YUXA 1JREA 1F30A 5ERJA 4MY7A 2V2OA 1JI5A 4ITTA 2BKCA 3KWOA 4DASA 1JKVA 1O9IA 3RBCA 4PGIA 2CF7A 4TOFA 4XGSA 5CZUA 2ZG8X 2CHPA 4RC7B 2V15A 5FEJA 4ITWA 4TOHA 2YW6A 2FZFA 4W4KB 2JD80 1VJXA 4M33A 5E2DA 4ML5A 2ZURX 5D8XA 3WVWA 2XGWA 3QZ3A 1BFRA 5AXSA 1RCDA 1JIGA 4ZL5A 3E1JA 2XKQA 3GE4A 3BVEA 2IY4A 2V2IA 2OH3A 3KA4A 3F39A 3C21A 3F34A 1DVBA 1QGHA 1S3QA 1JTSA 4RC7A 5D8OA 3E1MA 2ZG7X 3UOFA 4RC6B 1N1QA 2FHAA 3D19A 4XKTA 4LPMA 3RE7A 3SH6A 2Z5RA 3PVTB 5HJHA 1IESA 2V2JA 3VNXA 3E1OA 4II4B 3TA8A 5JKLG 1UMNA 2G4HA 4Z5SA 3HL1A 3Q4RA 2RBDA 2WLUA 1XZ3A 4DYYA 3IS7A 4RC5B 4QUWA 1RCCA 4MJYA 2YW7A 4E40A 2ZG9X 3PWQA 3BVLA 3C1YA 1YV1A 1TJOA 3FSEA 3RD0A 3O7RA 3E6SA 4LQHA 5JDOA 5JACA 4RC6A 1JGCA 2QQYA 2CN7A 1HRSA 3GVYA 5FFDA 5GU3X 1TKPA 2F7NA 5FFBA 3E1LA 3SE1A 3KX9A 2VZBA 3KA3A 1RYTA 4II4A 2C6RA 5GU0X 4IWKA 1Z4AA 1OTKA 2BK6A 2C41A 2YJKA 3OGHA 3FVBA 5FFEA 3LKDA 3PW1A 2Y3QA 3PVRB 3V3KB 4YVZA 5K52A 1L8IA 4RC5A 1EUMA 4YXMA 5JKLA 3E1PA 4EVEA 4TOCA 4MN9A 3FRRA 1H96A 1SOFA 4ETRA 4LYUA 3IQ1A 1KRQA 4PG0A 4PGKA 2XJOA 4ZMCA 3R2KA 2W0OA 3UFBA 1TK6A 1NNQA 2HTNA 3F33A 2GS4A 3M6JA 4CVTA 4LPNA 1SQ3A 1LKMA 4ISMA 4Y08A 2FFXJ 2C2JA 4KVQA 3U90A 3BT5A 1LKPA 4EVCA 3R2RA 3GHQA 3FRSA 2V2SA 4M34A 4U3GA 4DE6A 4EVDA 3R2MA 4AM4A 3JZAB 3PWQC 5J8WA 2Z5QA 5GOUA 4MUDA 2FG4A 3VV9A 1DATA 2FG8A 2OC5A 2C2UA 3ISEA 4CVRA 2Y44A 3O7SA 3HIUA 3F35A 2CLBA 4LPJA 4CYAA 3PW8A 1JI4A 4TOAA 2Z6MA 1LB3A 2AR0A 4W4LB 4CY9A 2IU2A 5GN8B 5CMRA 5D8SA 4CYBA 4AM2A 2MGYA 3BVKA 3A68A 2ITBA 5LG2A 4R42A 1L8HA 3RAVA 5IX6A 3NP2X 2V2MA 3AK9A 4TO9A 5HU6D 2FKZA 4M32A 2UX1A 3BKNA 1RCGA 2WWXB 3F38A 2YJJA 1RCEA 3EZ0A 5D8QA 3GGYA 2PYBA 4M35A 3KDQA 4TOGA 5I4JA 4KXRB 3R2SA 3ISFA 3AJPA 3PVTA 2WLAA 3EGMA 3KHKA 1DPSA 4ZL6A 3QD8A 3AJOA 2CIHA 4CMYV 5J8SA 3AK8A 4ISPA 4EVBA 4PG1A 3DBYA 3H7GA 1Z6OM 3E2CA 2WTLA 4MXPA 3SHXA 3QB9A 3AF8X 1VLGA 4ZKXA 1BG7A 1XZ1A 3E1NA 1JYBA 1S2ZA 1TKOA 4TODA 1UVHA 3F37A 2OKCA 5LG8A 4E6KA 2V8UA 1J30A 2V2NA 3PW8C 3BVIA 4ZLWA 3FI6A 2Z90A 1Z6OA 1B71A 1VEQA 1YUZA 3W54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOI A;  2XJM A;  3Q4Q A;  5LS9 A;  1NFV A;  1O9R A;  4KVS A;  3NP0 X;  3PVR A;  5D8P A;  5GU2 X;  3ERZ A;  4REU A;  2JD6 0;  2CLU A;  2VXI A;  4ZKW A;  5E1U A;  3UNO A;  4DZ0 A;  2BW1 A;  3RGD A;  3R2L A;  3EZU A;  5J93 A;  2CEI A;  4AM5 A;  1VEI A;  1NF4 A;  3PVY B;  3PZA A;  3QVD A;  3PWF A;  4CMY A;  2JD7 0;  1GWG A;  1S30 A;  4DYZ A;  2IB0 A;  1JKU A;  1VEL A;  2FL0 A;  4TOE A;  4CVS A;  4TOB A;  5D8R A;  1ZS3 A;  3T9J A;  2ZA8 A;  5K53 A;  3F36 A;  2GYD A;  3Q4O A;  3QHC A;  5D8Y A;  1ZUJ A;  3SID A;  5ERK A;  2FJC A;  5GU1 X;  3IS8 A;  3R2O A;  2D5K A;  4CVP A;  1IER A;  2QF9 A;  2X17 0;  3AJQ A;  4YKH A;  1QYB A;  5HJF A;  3PVY A;  3F32 A;  3ES3 A;  2Z5P A;  1F33 A;  3KXU A;  5CMQ A;  4A25 A;  2ZA6 A;  3E6R A;  3AF9 X;  4MKU A;  1MOJ A;  3KA8 A;  4ZJK A;  3Q4N A;  4XKS A;  2V2L A;  3PW1 B;  5JKM G;  1RCI A;  2GYQ A;  3MPS A;  5J9V A;  2ZA7 A;  5GN8 A;  4ERU A;  3A9Q A;  5LBH A;  2C2F A;  1MFR A;  3WNW A;  4LQV A;  3NOZ X;  5C6F A;  4Z3B A;  2CN6 A;  3OJ5 A;  4LQJ A;  2VXX A;  5HQO A;  1FHA A;  2V2R A;  4TW3 A;  4IXK A;  4OYN A;  4DI0 A;  4IWJ A;  3BVF A;  3WVU A;  4KVR A;  4ZKH A;  2CHI A;  4RC8 A;  1AEW A;  2V2P A;  3KA6 A;  1NF6 A;  4XKU A;  5FFA A;  1LKO A;  2BJY A;  3WVV A;  3AF7 X;  3QHB A;  4LYX A;  3E1Q A;  4P18 A;  4LQN A;  3KA9 A;  5FFC A;  1BCF A;  3R2H A;  2HR5 A;  4ZTT A;  5JKM A;  1R03 A;  4DYU A;  2XJN A;  4DYX A;  1YUX A;  1JRE A;  1F30 A;  5ERJ A;  4MY7 A;  2V2O A;  1JI5 A;  4ITT A;  2BKC A;  3KWO A;  4DAS A;  1JKV A;  1O9I A;  3RBC A;  4PGI A;  2CF7 A;  4TOF A;  4XGS A;  5CZU A;  2ZG8 X;  2CHP A;  4RC7 B;  2V15 A;  5FEJ A;  4ITW A;  4TOH A;  2YW6 A;  2FZF A;  2JD8 0;  1VJX A;  4M33 A;  5E2D A;  4ML5 A;  2ZUR X;  5D8X A;  3WVW A;  2XGW A;  3QZ3 A;  1BFR A;  5AXS A;  1RCD A;  1JIG A;  4ZL5 A;  3E1J A;  2XKQ A;  3GE4 A;  3BVE A;  2IY4 A;  2V2I A;  2OH3 A;  3KA4 A;  3F39 A;  3F34 A;  1DVB A;  1QGH A;  1S3Q A;  1JTS A;  4RC7 A;  5D8O A;  3E1M A;  2ZG7 X;  3UOF A;  4RC6 B;  1N1Q A;  2FHA A;  4XKT A;  4LPM A;  3RE7 A;  3SH6 A;  2Z5R A;  3PVT B;  5HJH A;  1IES A;  2V2J A;  3VNX A;  3E1O A;  4II4 B;  3TA8 A;  5JKL G;  1UMN A;  2G4H A;  4Z5S A;  3HL1 A;  3Q4R A;  2RBD A;  2WLU A;  1XZ3 A;  4DYY A;  3IS7 A;  4RC5 B;  4QUW A;  1RCC A;  4MJY A;  2YW7 A;  2ZG9 X;  3PWQ A;  3BVL A;  1YV1 A;  1TJO A;  3FSE A;  3RD0 A;  3O7R A;  3E6S A;  4LQH A;  5JAC A;  4RC6 A;  1JGC A;  2QQY A;  2CN7 A;  1HRS A;  3GVY A;  5FFD A;  5GU3 X;  1TKP A;  2F7N A;  5FFB A;  3E1L A;  3SE1 A;  3KX9 A;  2VZB A;  3KA3 A;  1RYT A;  4II4 A;  2C6R A;  5GU0 X;  4IWK A;  1Z4A A;  1OTK A;  2BK6 A;  2C41 A;  2YJK A;  3OGH A;  3FVB A;  5FFE A;  3PW1 A;  2Y3Q A;  3PVR B;  5K52 A;  1L8I A;  4RC5 A;  1EUM A;  5JKL A;  3E1P A;  4EVE A;  4TOC A;  4MN9 A;  1H96 A;  1SOF A;  4ETR A;  4LYU A;  3IQ1 A;  1KRQ A;  4PG0 A;  4PGK A;  2XJO A;  4ZMC A;  3R2K A;  2W0O A;  1TK6 A;  1NNQ A;  2HTN A;  3F33 A;  2GS4 A;  4CVT A;  4LPN A;  1SQ3 A;  1LKM A;  4ISM A;  4Y08 A;  2FFX J;  2C2J A;  4KVQ A;  3U90 A;  3BT5 A;  1LKP A;  4EVC A;  3R2R A;  3GHQ A;  2V2S A;  4M34 A;  4U3G A;  4DE6 A;  4EVD A;  3R2M A;  4AM4 A;  3PWQ C;  5J8W A;  2Z5Q A;  5GOU A;  4MUD A;  2FG4 A;  1DAT A;  2FG8 A;  2OC5 A;  2C2U A;  3ISE A;  4CVR A;  3O7S A;  3HIU A;  3F35 A;  2CLB A;  4LPJ A;  4CYA A;  3PW8 A;  1JI4 A;  4TOA A;  2Z6M A;  1LB3 A;  4CY9 A;  2IU2 A;  5GN8 B;  5CMR A;  5D8S A;  4CYB A;  4AM2 A;  3BVK A;  3A68 A;  2ITB A;  5LG2 A;  4R42 A;  1L8H A;  3RAV A;  5IX6 A;  3NP2 X;  2V2M A;  3AK9 A;  4TO9 A;  2FKZ A;  4M32 A;  2UX1 A;  3BKN A;  1RCG A;  3F38 A;  2YJJ A;  1RCE A;  3EZ0 A;  5D8Q A;  2PYB A;  4M35 A;  4TOG A;  5I4J A;  3R2S A;  3ISF A;  3AJP A;  3PVT A;  2WLA A;  3EGM A;  1DPS A;  4ZL6 A;  3QD8 A;  3AJO A;  2CIH A;  4CMY V;  5J8S A;  3AK8 A;  4ISP A;  4EVB A;  4PG1 A;  3H7G A;  1Z6O M;  3E2C A;  2WTL A;  3SHX A;  3QB9 A;  3AF8 X;  1VLG A;  4ZKX A;  1BG7 A;  1XZ1 A;  3E1N A;  1JYB A;  1S2Z A;  1TKO A;  4TOD A;  1UVH A;  3F37 A;  5LG8 A;  4E6K A;  1J30 A;  2V2N A;  3PW8 C;  3BVI A;  4ZLW A;  3FI6 A;  2Z90 A;  1Z6O A;  1B71 A;  1VEQ A;  1YUZ A; 
#chains in the Genus database with same CATH topology
 3UOI A;  2G38 B;  2XJM A;  3Q4Q A;  5LS9 A;  1NFV A;  1O9R A;  4KVS A;  3NP0 X;  3PVR A;  5D8P A;  5GU2 X;  3ERZ A;  4REU A;  2JD6 0;  2CWL A;  2CLU A;  2VXI A;  4ZKW A;  5E1U A;  3UNO A;  4DZ0 A;  2BW1 A;  3RGD A;  3R2L A;  3EZU A;  5J93 A;  2CEI A;  4AM5 A;  1VEI A;  1NF4 A;  3PVY B;  3PZA A;  3QVD A;  3PWF A;  4CMY A;  2JD7 0;  1GWG A;  1S30 A;  4DYZ A;  2IB0 A;  1JKU A;  1VEL A;  2FL0 A;  4TOE A;  2V8T A;  4CVS A;  4TOB A;  5D8R A;  1ZS3 A;  3T9J A;  3VVA A;  2ZA8 A;  5K53 A;  3F36 A;  2GYD A;  3Q4O A;  3QHC A;  5D8Y A;  1ZUJ A;  3SID A;  5ERK A;  2FJC A;  4WJG 4;  5GU1 X;  3IS8 A;  3R2O A;  3C1Z A;  2D5K A;  4CVP A;  1IER A;  2QF9 A;  5JDO B;  2X17 0;  3AJQ A;  4YKH A;  1QYB A;  5HJF A;  3PVY A;  3F32 A;  4YXJ A;  3ES3 A;  2Z5P A;  1F33 A;  3KXU A;  5CMQ A;  4A25 A;  2ZA6 A;  3E6R A;  3AF9 X;  4MKU A;  1MOJ A;  3KA8 A;  4ZJK A;  3Q4N A;  4XKS A;  2V2L A;  3PW1 B;  5JKM G;  1RCI A;  2GYQ A;  3MPS A;  5J9V A;  2ZA7 A;  5GN8 A;  4ERU A;  3A9Q A;  3L0M A;  5LBH A;  2C2F A;  1MFR A;  3WNW A;  4LQV A;  3NOZ X;  5C6F A;  3JZ9 A;  4Z3B A;  2CN6 A;  3OJ5 A;  4LQJ A;  2VXX A;  5HQO A;  1FHA A;  3GGZ A;  2V2R A;  4TW3 A;  2N02 A;  4IXK A;  4OYN A;  4DI0 A;  4IWJ A;  3BVF A;  3WVU A;  4KVR A;  4ZKH A;  2CHI A;  4RC8 A;  1AEW A;  2V2P A;  3KA6 A;  1NF6 A;  4XKU A;  5FFA A;  1LKO A;  2BJY A;  3WVV A;  3AF7 X;  3QHB A;  4LYX A;  3E1Q A;  3N6O A;  4P18 A;  4LQN A;  4X0J A;  3KA9 A;  5FFC A;  1BCF A;  3C23 A;  3R2H A;  2HR5 A;  4ZTT A;  5JKM A;  1R03 A;  4DYU A;  2XJN A;  4DYX A;  1YUX A;  1JRE A;  1F30 A;  5ERJ A;  4MY7 A;  2V2O A;  1JI5 A;  4ITT A;  2BKC A;  3KWO A;  4DAS A;  1JKV A;  1O9I A;  3RBC A;  4PGI A;  2CF7 A;  4TOF A;  4XGS A;  5CZU A;  2ZG8 X;  2CHP A;  4RC7 B;  2V15 A;  5FEJ A;  4ITW A;  4TOH A;  2YW6 A;  2FZF A;  4W4K B;  2JD8 0;  1VJX A;  4M33 A;  5E2D A;  4ML5 A;  2ZUR X;  5D8X A;  3WVW A;  2XGW A;  3QZ3 A;  1BFR A;  5AXS A;  1RCD A;  1JIG A;  4ZL5 A;  3E1J A;  2XKQ A;  3GE4 A;  3BVE A;  2IY4 A;  2V2I A;  2OH3 A;  3KA4 A;  3F39 A;  3C21 A;  3F34 A;  1DVB A;  1QGH A;  1S3Q A;  1JTS A;  4RC7 A;  5D8O A;  3E1M A;  2ZG7 X;  3UOF A;  4RC6 B;  1N1Q A;  2FHA A;  3D19 A;  4XKT A;  4LPM A;  3RE7 A;  3SH6 A;  2Z5R A;  3PVT B;  5HJH A;  1IES A;  2V2J A;  3VNX A;  3E1O A;  4II4 B;  3TA8 A;  5JKL G;  1UMN A;  2G4H A;  4Z5S A;  3HL1 A;  3Q4R A;  2RBD A;  2WLU A;  1XZ3 A;  4DYY A;  3IS7 A;  4RC5 B;  4QUW A;  1RCC A;  4MJY A;  2YW7 A;  4E40 A;  2ZG9 X;  3PWQ A;  3BVL A;  3C1Y A;  1YV1 A;  1TJO A;  3FSE A;  3RD0 A;  3O7R A;  3E6S A;  4LQH A;  5JDO A;  5JAC A;  4RC6 A;  1JGC A;  2QQY A;  2CN7 A;  1HRS A;  3GVY A;  5FFD A;  5GU3 X;  1TKP A;  2F7N A;  5FFB A;  3E1L A;  3SE1 A;  3KX9 A;  2VZB A;  3KA3 A;  1RYT A;  4II4 A;  2C6R A;  5GU0 X;  4IWK A;  1Z4A A;  1OTK A;  2BK6 A;  2C41 A;  2YJK A;  3OGH A;  3FVB A;  5FFE A;  3LKD A;  3PW1 A;  2Y3Q A;  3PVR B;  3V3K B;  4YVZ A;  5K52 A;  1L8I A;  4RC5 A;  1EUM A;  4YXM A;  5JKL A;  3E1P A;  4EVE A;  4TOC A;  4MN9 A;  3FRR A;  1H96 A;  1SOF A;  4ETR A;  4LYU A;  3IQ1 A;  1KRQ A;  4PG0 A;  4PGK A;  2XJO A;  4ZMC A;  3R2K A;  2W0O A;  3UFB A;  1TK6 A;  1NNQ A;  2HTN A;  3F33 A;  2GS4 A;  3M6J A;  4CVT A;  4LPN A;  1SQ3 A;  1LKM A;  4ISM A;  4Y08 A;  2FFX J;  2C2J A;  4KVQ A;  3U90 A;  3BT5 A;  1LKP A;  4EVC A;  3R2R A;  3GHQ A;  3FRS A;  2V2S A;  4M34 A;  4U3G A;  4DE6 A;  4EVD A;  3R2M A;  4AM4 A;  3JZA B;  3PWQ C;  5J8W A;  2Z5Q A;  5GOU A;  4MUD A;  2FG4 A;  3VV9 A;  1DAT A;  2FG8 A;  2OC5 A;  2C2U A;  3ISE A;  4CVR A;  2Y44 A;  3O7S A;  3HIU A;  3F35 A;  2CLB A;  4LPJ A;  4CYA A;  3PW8 A;  1JI4 A;  4TOA A;  2Z6M A;  1LB3 A;  2AR0 A;  4W4L B;  4CY9 A;  2IU2 A;  5GN8 B;  5CMR A;  5D8S A;  4CYB A;  4AM2 A;  2MGY A;  3BVK A;  3A68 A;  2ITB A;  5LG2 A;  4R42 A;  1L8H A;  3RAV A;  5IX6 A;  3NP2 X;  2V2M A;  3AK9 A;  4TO9 A;  5HU6 D;  2FKZ A;  4M32 A;  2UX1 A;  3BKN A;  1RCG A;  2WWX B;  3F38 A;  2YJJ A;  1RCE A;  3EZ0 A;  5D8Q A;  3GGY A;  2PYB A;  4M35 A;  3KDQ A;  4TOG A;  5I4J A;  4KXR B;  3R2S A;  3ISF A;  3AJP A;  3PVT A;  2WLA A;  3EGM A;  3KHK A;  1DPS A;  4ZL6 A;  3QD8 A;  3AJO A;  2CIH A;  4CMY V;  5J8S A;  3AK8 A;  4ISP A;  4EVB A;  4PG1 A;  3DBY A;  3H7G A;  1Z6O M;  3E2C A;  2WTL A;  4MXP A;  3SHX A;  3QB9 A;  3AF8 X;  1VLG A;  4ZKX A;  1BG7 A;  1XZ1 A;  3E1N A;  1JYB A;  1S2Z A;  1TKO A;  4TOD A;  1UVH A;  3F37 A;  2OKC A;  5LG8 A;  4E6K A;  2V8U A;  1J30 A;  2V2N A;  3PW8 C;  3BVI A;  4ZLW A;  3FI6 A;  2Z90 A;  1Z6O A;  1B71 A;  1VEQ A;  1YUZ A;  3W54 A; 
#chains in the Genus database with same CATH homology
 3UOI A;  2G38 B;  2XJM A;  3Q4Q A;  5LS9 A;  1NFV A;  1O9R A;  4KVS A;  3NP0 X;  3PVR A;  5D8P A;  5GU2 X;  3ERZ A;  4REU A;  2JD6 0;  2CWL A;  2CLU A;  2VXI A;  4ZKW A;  5E1U A;  3UNO A;  4DZ0 A;  2BW1 A;  3RGD A;  3R2L A;  3EZU A;  5J93 A;  2CEI A;  4AM5 A;  1VEI A;  1NF4 A;  3PVY B;  3PZA A;  3QVD A;  3PWF A;  4CMY A;  2JD7 0;  1GWG A;  1S30 A;  4DYZ A;  2IB0 A;  1JKU A;  1VEL A;  2FL0 A;  4TOE A;  2V8T A;  4CVS A;  4TOB A;  5D8R A;  1ZS3 A;  3T9J A;  3VVA A;  2ZA8 A;  5K53 A;  3F36 A;  2GYD A;  3Q4O A;  3QHC A;  5D8Y A;  1ZUJ A;  3SID A;  5ERK A;  2FJC A;  4WJG 4;  5GU1 X;  3IS8 A;  3R2O A;  3C1Z A;  2D5K A;  4CVP A;  1IER A;  2QF9 A;  5JDO B;  2X17 0;  3AJQ A;  4YKH A;  1QYB A;  5HJF A;  3PVY A;  3F32 A;  4YXJ A;  3ES3 A;  2Z5P A;  1F33 A;  3KXU A;  5CMQ A;  4A25 A;  2ZA6 A;  3E6R A;  3AF9 X;  4MKU A;  1MOJ A;  3KA8 A;  4ZJK A;  3Q4N A;  4XKS A;  2V2L A;  3PW1 B;  5JKM G;  1RCI A;  2GYQ A;  3MPS A;  5J9V A;  2ZA7 A;  5GN8 A;  4ERU A;  3A9Q A;  3L0M A;  5LBH A;  2C2F A;  1MFR A;  3WNW A;  4LQV A;  3NOZ X;  5C6F A;  3JZ9 A;  4Z3B A;  2CN6 A;  3OJ5 A;  4LQJ A;  2VXX A;  5HQO A;  1FHA A;  3GGZ A;  2V2R A;  4TW3 A;  2N02 A;  4IXK A;  4OYN A;  4DI0 A;  4IWJ A;  3BVF A;  3WVU A;  4KVR A;  4ZKH A;  2CHI A;  4RC8 A;  1AEW A;  2V2P A;  3KA6 A;  1NF6 A;  4XKU A;  5FFA A;  1LKO A;  2BJY A;  3WVV A;  3AF7 X;  3QHB A;  4LYX A;  3E1Q A;  3N6O A;  4P18 A;  4LQN A;  4X0J A;  3KA9 A;  5FFC A;  1BCF A;  3C23 A;  3R2H A;  2HR5 A;  4ZTT A;  5JKM A;  1R03 A;  4DYU A;  2XJN A;  4DYX A;  1YUX A;  1JRE A;  1F30 A;  5ERJ A;  4MY7 A;  2V2O A;  1JI5 A;  4ITT A;  2BKC A;  3KWO A;  4DAS A;  1JKV A;  1O9I A;  3RBC A;  4PGI A;  2CF7 A;  4TOF A;  4XGS A;  5CZU A;  2ZG8 X;  2CHP A;  4RC7 B;  2V15 A;  5FEJ A;  4ITW A;  4TOH A;  2YW6 A;  2FZF A;  4W4K B;  2JD8 0;  1VJX A;  4M33 A;  5E2D A;  4ML5 A;  2ZUR X;  5D8X A;  3WVW A;  2XGW A;  3QZ3 A;  1BFR A;  5AXS A;  1RCD A;  1JIG A;  4ZL5 A;  3E1J A;  2XKQ A;  3GE4 A;  3BVE A;  2IY4 A;  2V2I A;  2OH3 A;  3KA4 A;  3F39 A;  3C21 A;  3F34 A;  1DVB A;  1QGH A;  1S3Q A;  1JTS A;  4RC7 A;  5D8O A;  3E1M A;  2ZG7 X;  3UOF A;  4RC6 B;  1N1Q A;  2FHA A;  3D19 A;  4XKT A;  4LPM A;  3RE7 A;  3SH6 A;  2Z5R A;  3PVT B;  5HJH A;  1IES A;  2V2J A;  3VNX A;  3E1O A;  4II4 B;  3TA8 A;  5JKL G;  1UMN A;  2G4H A;  4Z5S A;  3HL1 A;  3Q4R A;  2RBD A;  2WLU A;  1XZ3 A;  4DYY A;  3IS7 A;  4RC5 B;  4QUW A;  1RCC A;  4MJY A;  2YW7 A;  4E40 A;  2ZG9 X;  3PWQ A;  3BVL A;  3C1Y A;  1YV1 A;  1TJO A;  3FSE A;  3RD0 A;  3O7R A;  3E6S A;  4LQH A;  5JDO A;  5JAC A;  4RC6 A;  1JGC A;  2QQY A;  2CN7 A;  1HRS A;  3GVY A;  5FFD A;  5GU3 X;  1TKP A;  2F7N A;  5FFB A;  3E1L A;  3SE1 A;  3KX9 A;  2VZB A;  3KA3 A;  1RYT A;  4II4 A;  2C6R A;  5GU0 X;  4IWK A;  1Z4A A;  1OTK A;  2BK6 A;  2C41 A;  2YJK A;  3OGH A;  3FVB A;  5FFE A;  3LKD A;  3PW1 A;  2Y3Q A;  3PVR B;  3V3K B;  4YVZ A;  5K52 A;  1L8I A;  4RC5 A;  1EUM A;  4YXM A;  5JKL A;  3E1P A;  4EVE A;  4TOC A;  4MN9 A;  3FRR A;  1H96 A;  1SOF A;  4ETR A;  4LYU A;  3IQ1 A;  1KRQ A;  4PG0 A;  4PGK A;  2XJO A;  4ZMC A;  3R2K A;  2W0O A;  3UFB A;  1TK6 A;  1NNQ A;  2HTN A;  3F33 A;  2GS4 A;  3M6J A;  4CVT A;  4LPN A;  1SQ3 A;  1LKM A;  4ISM A;  4Y08 A;  2FFX J;  2C2J A;  4KVQ A;  3U90 A;  3BT5 A;  1LKP A;  4EVC A;  3R2R A;  3GHQ A;  3FRS A;  2V2S A;  4M34 A;  4U3G A;  4DE6 A;  4EVD A;  3R2M A;  4AM4 A;  3JZA B;  3PWQ C;  5J8W A;  2Z5Q A;  5GOU A;  4MUD A;  2FG4 A;  3VV9 A;  1DAT A;  2FG8 A;  2OC5 A;  2C2U A;  3ISE A;  4CVR A;  2Y44 A;  3O7S A;  3HIU A;  3F35 A;  2CLB A;  4LPJ A;  4CYA A;  3PW8 A;  1JI4 A;  4TOA A;  2Z6M A;  1LB3 A;  2AR0 A;  4W4L B;  4CY9 A;  2IU2 A;  5GN8 B;  5CMR A;  5D8S A;  4CYB A;  4AM2 A;  2MGY A;  3BVK A;  3A68 A;  2ITB A;  5LG2 A;  4R42 A;  1L8H A;  3RAV A;  5IX6 A;  3NP2 X;  2V2M A;  3AK9 A;  4TO9 A;  5HU6 D;  2FKZ A;  4M32 A;  2UX1 A;  3BKN A;  1RCG A;  2WWX B;  3F38 A;  2YJJ A;  1RCE A;  3EZ0 A;  5D8Q A;  3GGY A;  2PYB A;  4M35 A;  3KDQ A;  4TOG A;  5I4J A;  4KXR B;  3R2S A;  3ISF A;  3AJP A;  3PVT A;  2WLA A;  3EGM A;  3KHK A;  1DPS A;  4ZL6 A;  3QD8 A;  3AJO A;  2CIH A;  4CMY V;  5J8S A;  3AK8 A;  4ISP A;  4EVB A;  4PG1 A;  3DBY A;  3H7G A;  1Z6O M;  3E2C A;  2WTL A;  4MXP A;  3SHX A;  3QB9 A;  3AF8 X;  1VLG A;  4ZKX A;  1BG7 A;  1XZ1 A;  3E1N A;  1JYB A;  1S2Z A;  1TKO A;  4TOD A;  1UVH A;  3F37 A;  2OKC A;  5LG8 A;  4E6K A;  2V8U A;  1J30 A;  2V2N A;  3PW8 C;  3BVI A;  4ZLW A;  3FI6 A;  2Z90 A;  1Z6O A;  1B71 A;  1VEQ A;  1YUZ A;  3W54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...