3QB9A

Mycobacterium tuberculosis bacterioferritin, bfra
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
159
structure length
159
Chain Sequence
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Bacterioferritin
publication title Mycobacterium tuberculosis bacterioferritin, BfrA
rcsb
source organism Mycobacterium tuberculosis
total genus 77
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3qb9A00
3EZ0A 1MFRA 3ISFA 5LBHA 1L8IA 5FFEA 4ISPA 4EVEA 3WVVA 1S2ZA 1F33A 3UOFA 1NFVA 5HQOA 3E2CA 5D8PA 4E6KA 4M33A 4TO9A 1RCGA 1RCDA 1YV1A 3E1MA 4YKHA 5CMRA 3GE4A 2QF9A 4CVSA 4CVTA 4EVBA 3TA8A 3R2OA 3RGDA 1J30A 3ES3A 1BCFA 2ITBA 1JKUA 2BJYA 4LPNA 3HL1A 1Z4AA 2JD80 2W0OA 3NP2X 4DYUA 3PW1B 5GU3X 4ML5A 3AJOA 5J93A 4Z5SA 3PVYB 3R2LA 4LQHA 5D8OA 1RCEA 3T9JA 2XKQA 4P18A 2RBDA 3E6RA 3BVIA 1LB3A 3WNWA 3PVRB 1NF6A 3PVTA 2V2IA 4TODA 5JKLA 2YJJA 2ZA8A 3RAVA 3F33A 4LPMA 1TK6A 3SH6A 5J9VA 3IQ1A 1YUZA 3BVEA 2FKZA 1IESA 3Q4NA 3E1JA 2Z6MA 3F39A 4XGSA 4A25A 5CZUA 4DYXA 4AM5A 2XJOA 3E1QA 1QYBA 3OJ5A 4CYBA 2C41A 2IB0A 3F32A 3AF8X 3OGHA 5E2DA 2Z90A 4LQVA 3F37A 4LPJA 4TOAA 4XKTA 5JKMA 2JD60 4IXKA 1YUXA 2FG8A 2Z5PA 3KWOA 2F7NA 1F30A 2ZA7A 5D8RA 5I4JA 2D5KA 3AF9X 4RC6B 2X170 3KXUA 4M32A 2V2SA 5J8SA 5ERKA 3AK9A 1TKOA 4TOCA 3R2KA 3HIUA 5D8QA 1LKPA 3BVLA 5D8SA 4AM2A 4MUDA 4ZKXA 1VEIA 4ZJKA 3O7SA 3ERZA 3BT5A 1HRSA 1EUMA 4RC5B 3UNOA 3PW8A 1ZUJA 3KA3A 5D8XA 1JI4A 4RC7A 2G4HA 1NF4A 3GHQA 3KA8A 4DZ0A 4DYYA 1Z6OA 1XZ1A 2V2JA 2YJKA 2OC5A 4TOFA 2XJNA 1JI5A 2V2OA 2WLAA 5GN8B 4XKUA 2Z5QA 2YW6A 3H7GA 4II4B 4LYUA 1JYBA 3QVDA 1S30A 1IERA 1NNQA 1UVHA 4CYAA 2GYQA 1VEQA 1XZ3A 3A68A 1SOFA 3R2SA 3E1NA 3BKNA 4M35A 4MN9A 1RCCA 2OH3A 1QGHA 4KVQA 3KA9A 4KVSA 2XJMA 2V2NA 4Y08A 1JREA 2BKCA 4TW3A 5GU1X 5HJHA 3R2MA 1O9IA 2CEIA 5FFDA 2FJCA 4ITTA 5GU2X 2FL0A 4ISMA 2CN7A 3EGMA 2ZG7X 3QHBA 5IX6A 2FHAA 3SE1A 1AEWA 1BFRA 5GN8A 3O7RA 3BVFA 1DVBA 5CMQA 1R03A 3IS7A 2CIHA 3R2HA 5GOUA 3AK8A 2GYDA 3ISEA 3QHCA 3PW1A 4CMYV 3AJPA 4DYZA 4RC8A 2V2LA 3PVYA 5C6FA 4PG1A 1JIGA 1TKPA 4DASA 4EVDA 5HJFA 1GWGA 1OTKA 2V2MA 3PVRA 3Q4OA 2IY4A 1RYTA 4OYNA 1TJOA 1Z6OM 4ZKWA 4LQNA 1VLGA 5JACA 2Z5RA 3WVWA 2YW7A 3PWQC 2Y3QA 4CY9A 5E1UA 4CVPA 2IU2A 5LG2A 1BG7A 1JTSA 3RD0A 2QQYA 2CHPA 4DI0A 4MY7A 4ITWA 1MOJA 3E1OA 2CLBA 1FHAA 1JGCA 3QB9A 4PG0A 4CVRA 2FZFA 3Q4QA 4QUWA 4Z3BA 4XKSA 1SQ3A 3PWFA 4TOEA 3FVBA 1LKOA 1S3QA 5D8YA 1VJXA 3AJQA 5AXSA 4DE6A 4ZL5A 5K52A 2CF7A 5JKLG 4RC6A 4M34A 3QZ3A 1VELA 5J8WA 4REUA 5FEJA 3PVTB 4ZKHA 3F35A 2VXIA 4ZTTA 3WVUA 3SIDA 3SHXA 4MKUA 3R2RA 1DATA 2GS4A 3VNXA 2XGWA 2V15A 1N1QA 2WLUA 3FSEA 3F36A 4RC5A 2ZURX 4IWKA 5K53A 4PGIA 2HTNA 4ZMCA 5ERJA 5FFCA 3A9QA 4LQJA 3NOZX 1UMNA 2BK6A 5JKMG 3IS8A 3QD8A 2C2JA 4TOBA 5FFAA 1KRQA 1RCIA 2VZBA 3KA6A 2UX1A 4TOHA 1L8HA 4II4A 3E6SA 1H96A 4ZL6A 2C2FA 4LYXA 4EVCA 3E1LA 2HR5A 4U3GA 3KX9A 4ZLWA 2CHIA 2ZA6A 2C2UA 2FG4A 4MJYA 5LS9A 2ZG8X 3F34A 2CN6A 3E1PA 3F38A 4ETRA 4KVRA 3EZUA 3RE7A 3U90A 2V2RA 3Q4RA 4R42A 2JD70 4RC7B 2V2PA 2FFXJ 1LKMA 3MPSA 1B71A 2BW1A 1DPSA 3AF7X 2VXXA 3UOIA 1ZS3A 3PW8C 3PZAA 2WTLA 3FI6A 3RBCA 4IWJA 3GVYA 5LG8A 5GU0X 1O9RA 3NP0X 2ZG9X 2PYBA 5FFBA 3BVKA 1JKVA 3PWQA 4ERUA 2C6RA 4AM4A 4CMYA 2CLUA 3KA4A 4PGKA 4TOGA
chains in the Genus database with same CATH superfamily
3EZ0A 1MFRA 3ISFA 3VVAA 5LBHA 1L8IA 5FFEA 4ISPA 4EVEA 3WVVA 1S2ZA 1F33A 3UOFA 1NFVA 4YVZA 5HQOA 3E2CA 5D8PA 4E6KA 4M33A 4TO9A 1RCGA 1RCDA 1YV1A 3E1MA 4YKHA 5JDOA 5CMRA 3GE4A 2QF9A 4CVSA 4CVTA 4EVBA 3VV9A 3TA8A 3R2OA 3RGDA 1J30A 3ES3A 1BCFA 2ITBA 1JKUA 2BJYA 4LPNA 3HL1A 4X0JA 1Z4AA 2JD80 2AR0A 2W0OA 3NP2X 4DYUA 3N6OA 3PW1B 5GU3X 4ML5A 3AJOA 5J93A 4Z5SA 3PVYB 3C1YA 3R2LA 4LQHA 5D8OA 1RCEA 3T9JA 2XKQA 4P18A 2RBDA 3E6RA 3BVIA 3C23A 4W4KB 1LB3A 2CWLA 3WNWA 3PVRB 1NF6A 3PVTA 2V8UA 2V2IA 4TODA 5JKLA 2YJJA 2ZA8A 3RAVA 3F33A 4LPMA 1TK6A 3SH6A 5J9VA 3IQ1A 1YUZA 3JZAB 3BVEA 2FKZA 1IESA 3Q4NA 3E1JA 2Z6MA 3F39A 4XGSA 4A25A 5CZUA 3LKDA 4DYXA 4AM5A 2XJOA 3E1QA 1QYBA 3OJ5A 4CYBA 2C41A 2IB0A 3F32A 3AF8X 3OGHA 5E2DA 2Z90A 4LQVA 3F37A 3D19A 4LPJA 4TOAA 4XKTA 5JKMA 2JD60 4IXKA 3DBYA 1YUXA 2FG8A 2Z5PA 3KWOA 2F7NA 1F30A 2ZA7A 5D8RA 5I4JA 2D5KA 3AF9X 4RC6B 2X170 3KXUA 4M32A 2V2SA 5J8SA 5ERKA 3AK9A 1TKOA 4TOCA 3R2KA 3HIUA 5D8QA 1LKPA 3BVLA 5D8SA 4AM2A 4MUDA 4ZKXA 1VEIA 4ZJKA 3O7SA 3ERZA 3BT5A 1HRSA 1EUMA 4RC5B 3UNOA 3PW8A 4MXPA 1ZUJA 3KA3A 5D8XA 1JI4A 4RC7A 2G4HA 1NF4A 3GHQA 3KA8A 4DZ0A 4DYYA 1Z6OA 1XZ1A 2V2JA 2YJKA 3GGZA 2OC5A 4TOFA 2XJNA 1JI5A 2V2OA 2WLAA 5GN8B 4XKUA 2Z5QA 2YW6A 3H7GA 4II4B 3UFBA 4LYUA 1JYBA 3QVDA 1S30A 1IERA 1NNQA 1UVHA 4CYAA 2GYQA 1VEQA 1XZ3A 3A68A 4YXJA 1SOFA 3R2SA 3E1NA 3BKNA 4M35A 4MN9A 1RCCA 2OH3A 1QGHA 4KVQA 3KA9A 3V3KB 4KVSA 2XJMA 2V2NA 4Y08A 1JREA 2BKCA 4TW3A 5GU1X 3JZ9A 3R2MA 1O9IA 5HJHA 2CEIA 5FFDA 2FJCA 4ITTA 5GU2X 4W4LB 2FL0A 4ISMA 2CN7A 3EGMA 2ZG7X 3QHBA 2MGYA 5IX6A 2FHAA 3SE1A 1AEWA 1BFRA 5GN8A 3O7RA 3BVFA 1DVBA 5CMQA 1R03A 3IS7A 2CIHA 3R2HA 5GOUA 3AK8A 2GYDA 3ISEA 3QHCA 3PW1A 4CMYV 3AJPA 4DYZA 4RC8A 2V2LA 3PVYA 5C6FA 4PG1A 1JIGA 3FRSA 1TKPA 2OKCA 4DASA 4EVDA 3KHKA 5HJFA 1GWGA 1OTKA 2V2MA 3PVRA 3Q4OA 2IY4A 1RYTA 4OYNA 4E40A 1TJOA 1Z6OM 4ZKWA 4LQNA 1VLGA 5JACA 2Z5RA 3C21A 3WVWA 2YW7A 3PWQC 2Y3QA 4CY9A 5E1UA 4CVPA 2IU2A 5LG2A 1BG7A 1JTSA 3RD0A 2QQYA 2CHPA 4DI0A 4MY7A 4ITWA 1MOJA 3E1OA 2CLBA 1FHAA 1JGCA 3QB9A 4PG0A 4CVRA 2FZFA 3Q4QA 4QUWA 4Z3BA 4XKSA 1SQ3A 3PWFA 4TOEA 3FVBA 1LKOA 1S3QA 5D8YA 4YXMA 1VJXA 3AJQA 5AXSA 4DE6A 4ZL5A 5K52A 2CF7A 5JKLG 4RC6A 4M34A 3QZ3A 1VELA 5J8WA 4REUA 5FEJA 3PVTB 4ZKHA 3C1ZA 2WWXB 3F35A 2VXIA 4ZTTA 3WVUA 3SIDA 3SHXA 4MKUA 3R2RA 1DATA 2GS4A 2Y44A 3VNXA 2XGWA 2V15A 1N1QA 2WLUA 3FSEA 3F36A 4RC5A 2ZURX 3FRRA 4IWKA 5K53A 4PGIA 2HTNA 4ZMCA 5HU6D 5ERJA 5FFCA 3A9QA 4LQJA 3NOZX 1UMNA 2BK6A 5JKMG 3L0MA 3IS8A 3QD8A 2C2JA 4TOBA 5FFAA 1KRQA 1RCIA 2VZBA 3KA6A 2UX1A 4TOHA 1L8HA 3M6JA 4II4A 3E6SA 1H96A 4ZL6A 2C2FA 4LYXA 4EVCA 3E1LA 2HR5A 4U3GA 3KX9A 4ZLWA 2CHIA 4KXRB 2ZA6A 2C2UA 2FG4A 4MJYA 5LS9A 2ZG8X 3F34A 2CN6A 3E1PA 3W54A 3F38A 4ETRA 4KVRA 3EZUA 3RE7A 2G38B 3U90A 2V2RA 3Q4RA 4R42A 2JD70 4RC7B 2V2PA 2FFXJ 2V8TA 1LKMA 3MPSA 1B71A 2BW1A 1DPSA 3AF7X 2VXXA 3UOIA 1ZS3A 3PW8C 3PZAA 2WTLA 5JDOB 3FI6A 3RBCA 4IWJA 2N02A 3GVYA 5LG8A 5GU0X 1O9RA 3NP0X 2ZG9X 2PYBA 3KDQA 5FFBA 3GGYA 3BVKA 1JKVA 3PWQA 4WJG4 4ERUA 2C6RA 4AM4A 4CMYA 2CLUA 3KA4A 4PGKA 4TOGA
chains in the Genus database with same CATH topology
3EZ0A 1MFRA 3ISFA 3VVAA 5LBHA 1L8IA 5FFEA 4ISPA 4EVEA 3WVVA 1S2ZA 1F33A 3UOFA 1NFVA 4YVZA 5HQOA 3E2CA 5D8PA 4E6KA 4M33A 4TO9A 1RCGA 1RCDA 1YV1A 3E1MA 4YKHA 5JDOA 5CMRA 3GE4A 2QF9A 4CVSA 4CVTA 4EVBA 3VV9A 3TA8A 3R2OA 3RGDA 1J30A 3ES3A 1BCFA 2ITBA 1JKUA 2BJYA 4LPNA 3HL1A 4X0JA 1Z4AA 2JD80 2AR0A 2W0OA 3NP2X 4DYUA 3N6OA 3PW1B 5GU3X 4ML5A 3AJOA 5J93A 4Z5SA 3PVYB 3C1YA 3R2LA 4LQHA 5D8OA 1RCEA 3T9JA 2XKQA 4P18A 2RBDA 3E6RA 3BVIA 3C23A 4W4KB 1LB3A 2CWLA 3WNWA 3PVRB 1NF6A 3PVTA 2V8UA 2V2IA 4TODA 5JKLA 2YJJA 2ZA8A 3RAVA 3F33A 4LPMA 1TK6A 3SH6A 5J9VA 3IQ1A 1YUZA 3JZAB 3BVEA 2FKZA 1IESA 3Q4NA 3E1JA 2Z6MA 3F39A 4XGSA 4A25A 5CZUA 3LKDA 4DYXA 4AM5A 2XJOA 3E1QA 1QYBA 3OJ5A 4CYBA 2C41A 2IB0A 3F32A 3AF8X 3OGHA 5E2DA 2Z90A 4LQVA 3F37A 3D19A 4LPJA 4TOAA 4XKTA 5JKMA 2JD60 4IXKA 3DBYA 1YUXA 2FG8A 2Z5PA 3KWOA 2F7NA 1F30A 2ZA7A 5D8RA 5I4JA 2D5KA 3AF9X 4RC6B 2X170 3KXUA 4M32A 2V2SA 5J8SA 5ERKA 3AK9A 1TKOA 4TOCA 3R2KA 3HIUA 5D8QA 1LKPA 3BVLA 5D8SA 4AM2A 4MUDA 4ZKXA 1VEIA 4ZJKA 3O7SA 3ERZA 3BT5A 1HRSA 1EUMA 4RC5B 3UNOA 3PW8A 4MXPA 1ZUJA 3KA3A 5D8XA 1JI4A 4RC7A 2G4HA 1NF4A 3GHQA 3KA8A 4DZ0A 4DYYA 1Z6OA 1XZ1A 2V2JA 2YJKA 3GGZA 2OC5A 4TOFA 2XJNA 1JI5A 2V2OA 2WLAA 5GN8B 4XKUA 2Z5QA 2YW6A 3H7GA 4II4B 3UFBA 4LYUA 1JYBA 3QVDA 1S30A 1IERA 1NNQA 1UVHA 4CYAA 2GYQA 1VEQA 1XZ3A 3A68A 4YXJA 1SOFA 3R2SA 3E1NA 3BKNA 4M35A 4MN9A 1RCCA 2OH3A 1QGHA 4KVQA 3KA9A 3V3KB 4KVSA 2XJMA 2V2NA 4Y08A 1JREA 2BKCA 4TW3A 5GU1X 3JZ9A 3R2MA 1O9IA 5HJHA 2CEIA 5FFDA 2FJCA 4ITTA 5GU2X 4W4LB 2FL0A 4ISMA 2CN7A 3EGMA 2ZG7X 3QHBA 2MGYA 5IX6A 2FHAA 3SE1A 1AEWA 1BFRA 5GN8A 3O7RA 3BVFA 1DVBA 5CMQA 1R03A 3IS7A 2CIHA 3R2HA 5GOUA 3AK8A 2GYDA 3ISEA 3QHCA 3PW1A 4CMYV 3AJPA 4DYZA 4RC8A 2V2LA 3PVYA 5C6FA 4PG1A 1JIGA 3FRSA 1TKPA 2OKCA 4DASA 4EVDA 3KHKA 5HJFA 1GWGA 1OTKA 2V2MA 3PVRA 3Q4OA 2IY4A 1RYTA 4OYNA 4E40A 1TJOA 1Z6OM 4ZKWA 4LQNA 1VLGA 5JACA 2Z5RA 3C21A 3WVWA 2YW7A 3PWQC 2Y3QA 4CY9A 5E1UA 4CVPA 2IU2A 5LG2A 1BG7A 1JTSA 3RD0A 2QQYA 2CHPA 4DI0A 4MY7A 4ITWA 1MOJA 3E1OA 2CLBA 1FHAA 1JGCA 3QB9A 4PG0A 4CVRA 2FZFA 3Q4QA 4QUWA 4Z3BA 4XKSA 1SQ3A 3PWFA 4TOEA 3FVBA 1LKOA 1S3QA 5D8YA 4YXMA 1VJXA 3AJQA 5AXSA 4DE6A 4ZL5A 5K52A 2CF7A 5JKLG 4RC6A 4M34A 3QZ3A 1VELA 5J8WA 4REUA 5FEJA 3PVTB 4ZKHA 3C1ZA 2WWXB 3F35A 2VXIA 4ZTTA 3WVUA 3SIDA 3SHXA 4MKUA 3R2RA 1DATA 2GS4A 2Y44A 3VNXA 2XGWA 2V15A 1N1QA 2WLUA 3FSEA 3F36A 4RC5A 2ZURX 3FRRA 4IWKA 5K53A 4PGIA 2HTNA 4ZMCA 5HU6D 5ERJA 5FFCA 3A9QA 4LQJA 3NOZX 1UMNA 2BK6A 5JKMG 3L0MA 3IS8A 3QD8A 2C2JA 4TOBA 5FFAA 1KRQA 1RCIA 2VZBA 3KA6A 2UX1A 4TOHA 1L8HA 3M6JA 4II4A 3E6SA 1H96A 4ZL6A 2C2FA 4LYXA 4EVCA 3E1LA 2HR5A 4U3GA 3KX9A 4ZLWA 2CHIA 4KXRB 2ZA6A 2C2UA 2FG4A 4MJYA 5LS9A 2ZG8X 3F34A 2CN6A 3E1PA 3W54A 3F38A 4ETRA 4KVRA 3EZUA 3RE7A 2G38B 3U90A 2V2RA 3Q4RA 4R42A 2JD70 4RC7B 2V2PA 2FFXJ 2V8TA 1LKMA 3MPSA 1B71A 2BW1A 1DPSA 3AF7X 2VXXA 3UOIA 1ZS3A 3PW8C 3PZAA 2WTLA 5JDOB 3FI6A 3RBCA 4IWJA 2N02A 3GVYA 5LG8A 5GU0X 1O9RA 3NP0X 2ZG9X 2PYBA 3KDQA 5FFBA 3GGYA 3BVKA 1JKVA 3PWQA 4WJG4 4ERUA 2C6RA 4AM4A 4CMYA 2CLUA 3KA4A 4PGKA 4TOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZ0 A;  1MFR A;  3ISF A;  5LBH A;  1L8I A;  5FFE A;  4ISP A;  4EVE A;  3WVV A;  1S2Z A;  1F33 A;  3UOF A;  1NFV A;  5HQO A;  3E2C A;  5D8P A;  4E6K A;  4M33 A;  4TO9 A;  1RCG A;  1RCD A;  1YV1 A;  3E1M A;  4YKH A;  5CMR A;  3GE4 A;  2QF9 A;  4CVS A;  4CVT A;  4EVB A;  3TA8 A;  3R2O A;  3RGD A;  1J30 A;  3ES3 A;  1BCF A;  2ITB A;  1JKU A;  2BJY A;  4LPN A;  3HL1 A;  1Z4A A;  2JD8 0;  2W0O A;  3NP2 X;  4DYU A;  3PW1 B;  5GU3 X;  4ML5 A;  3AJO A;  5J93 A;  4Z5S A;  3PVY B;  3R2L A;  4LQH A;  5D8O A;  1RCE A;  3T9J A;  2XKQ A;  4P18 A;  2RBD A;  3E6R A;  3BVI A;  1LB3 A;  3WNW A;  3PVR B;  1NF6 A;  3PVT A;  2V2I A;  4TOD A;  5JKL A;  2YJJ A;  2ZA8 A;  3RAV A;  3F33 A;  4LPM A;  1TK6 A;  3SH6 A;  5J9V A;  3IQ1 A;  1YUZ A;  3BVE A;  2FKZ A;  1IES A;  3Q4N A;  3E1J A;  2Z6M A;  3F39 A;  4XGS A;  4A25 A;  5CZU A;  4DYX A;  4AM5 A;  2XJO A;  3E1Q A;  1QYB A;  3OJ5 A;  4CYB A;  2C41 A;  2IB0 A;  3F32 A;  3AF8 X;  3OGH A;  5E2D A;  2Z90 A;  4LQV A;  3F37 A;  4LPJ A;  4TOA A;  4XKT A;  5JKM A;  2JD6 0;  4IXK A;  1YUX A;  2FG8 A;  2Z5P A;  3KWO A;  2F7N A;  1F30 A;  2ZA7 A;  5D8R A;  5I4J A;  2D5K A;  3AF9 X;  4RC6 B;  2X17 0;  3KXU A;  4M32 A;  2V2S A;  5J8S A;  5ERK A;  3AK9 A;  1TKO A;  4TOC A;  3R2K A;  3HIU A;  5D8Q A;  1LKP A;  3BVL A;  5D8S A;  4AM2 A;  4MUD A;  4ZKX A;  1VEI A;  4ZJK A;  3O7S A;  3ERZ A;  3BT5 A;  1HRS A;  1EUM A;  4RC5 B;  3UNO A;  3PW8 A;  1ZUJ A;  3KA3 A;  5D8X A;  1JI4 A;  4RC7 A;  2G4H A;  1NF4 A;  3GHQ A;  3KA8 A;  4DZ0 A;  4DYY A;  1Z6O A;  1XZ1 A;  2V2J A;  2YJK A;  2OC5 A;  4TOF A;  2XJN A;  1JI5 A;  2V2O A;  2WLA A;  5GN8 B;  4XKU A;  2Z5Q A;  2YW6 A;  3H7G A;  4II4 B;  4LYU A;  1JYB A;  3QVD A;  1S30 A;  1IER A;  1NNQ A;  1UVH A;  4CYA A;  2GYQ A;  1VEQ A;  1XZ3 A;  3A68 A;  1SOF A;  3R2S A;  3E1N A;  3BKN A;  4M35 A;  4MN9 A;  1RCC A;  2OH3 A;  1QGH A;  4KVQ A;  3KA9 A;  4KVS A;  2XJM A;  2V2N A;  4Y08 A;  1JRE A;  2BKC A;  4TW3 A;  5GU1 X;  5HJH A;  3R2M A;  1O9I A;  2CEI A;  5FFD A;  2FJC A;  4ITT A;  5GU2 X;  2FL0 A;  4ISM A;  2CN7 A;  3EGM A;  2ZG7 X;  3QHB A;  5IX6 A;  2FHA A;  3SE1 A;  1AEW A;  1BFR A;  5GN8 A;  3O7R A;  3BVF A;  1DVB A;  5CMQ A;  1R03 A;  3IS7 A;  2CIH A;  3R2H A;  5GOU A;  3AK8 A;  2GYD A;  3ISE A;  3QHC A;  3PW1 A;  4CMY V;  3AJP A;  4DYZ A;  4RC8 A;  2V2L A;  3PVY A;  5C6F A;  4PG1 A;  1JIG A;  1TKP A;  4DAS A;  4EVD A;  5HJF A;  1GWG A;  1OTK A;  2V2M A;  3PVR A;  3Q4O A;  2IY4 A;  1RYT A;  4OYN A;  1TJO A;  1Z6O M;  4ZKW A;  4LQN A;  1VLG A;  5JAC A;  2Z5R A;  3WVW A;  2YW7 A;  3PWQ C;  2Y3Q A;  4CY9 A;  5E1U A;  4CVP A;  2IU2 A;  5LG2 A;  1BG7 A;  1JTS A;  3RD0 A;  2QQY A;  2CHP A;  4DI0 A;  4MY7 A;  4ITW A;  1MOJ A;  3E1O A;  2CLB A;  1FHA A;  1JGC A;  3QB9 A;  4PG0 A;  4CVR A;  2FZF A;  3Q4Q A;  4QUW A;  4Z3B A;  4XKS A;  1SQ3 A;  3PWF A;  4TOE A;  3FVB A;  1LKO A;  1S3Q A;  5D8Y A;  1VJX A;  3AJQ A;  5AXS A;  4DE6 A;  4ZL5 A;  5K52 A;  2CF7 A;  5JKL G;  4RC6 A;  4M34 A;  3QZ3 A;  1VEL A;  5J8W A;  4REU A;  5FEJ A;  3PVT B;  4ZKH A;  3F35 A;  2VXI A;  4ZTT A;  3WVU A;  3SID A;  3SHX A;  4MKU A;  3R2R A;  1DAT A;  2GS4 A;  3VNX A;  2XGW A;  2V15 A;  1N1Q A;  2WLU A;  3FSE A;  3F36 A;  4RC5 A;  2ZUR X;  4IWK A;  5K53 A;  4PGI A;  2HTN A;  4ZMC A;  5ERJ A;  5FFC A;  3A9Q A;  4LQJ A;  3NOZ X;  1UMN A;  2BK6 A;  5JKM G;  3IS8 A;  3QD8 A;  2C2J A;  4TOB A;  5FFA A;  1KRQ A;  1RCI A;  2VZB A;  3KA6 A;  2UX1 A;  4TOH A;  1L8H A;  4II4 A;  3E6S A;  1H96 A;  4ZL6 A;  2C2F A;  4LYX A;  4EVC A;  3E1L A;  2HR5 A;  4U3G A;  3KX9 A;  4ZLW A;  2CHI A;  2ZA6 A;  2C2U A;  2FG4 A;  4MJY A;  5LS9 A;  2ZG8 X;  3F34 A;  2CN6 A;  3E1P A;  3F38 A;  4ETR A;  4KVR A;  3EZU A;  3RE7 A;  3U90 A;  2V2R A;  3Q4R A;  4R42 A;  2JD7 0;  4RC7 B;  2V2P A;  2FFX J;  1LKM A;  3MPS A;  1B71 A;  2BW1 A;  1DPS A;  3AF7 X;  2VXX A;  3UOI A;  1ZS3 A;  3PW8 C;  3PZA A;  2WTL A;  3FI6 A;  3RBC A;  4IWJ A;  3GVY A;  5LG8 A;  5GU0 X;  1O9R A;  3NP0 X;  2ZG9 X;  2PYB A;  5FFB A;  3BVK A;  1JKV A;  3PWQ A;  4ERU A;  2C6R A;  4AM4 A;  4CMY A;  2CLU A;  3KA4 A;  4PGK A;  4TOG A; 
#chains in the Genus database with same CATH topology
 3EZ0 A;  1MFR A;  3ISF A;  3VVA A;  5LBH A;  1L8I A;  5FFE A;  4ISP A;  4EVE A;  3WVV A;  1S2Z A;  1F33 A;  3UOF A;  1NFV A;  4YVZ A;  5HQO A;  3E2C A;  5D8P A;  4E6K A;  4M33 A;  4TO9 A;  1RCG A;  1RCD A;  1YV1 A;  3E1M A;  4YKH A;  5JDO A;  5CMR A;  3GE4 A;  2QF9 A;  4CVS A;  4CVT A;  4EVB A;  3VV9 A;  3TA8 A;  3R2O A;  3RGD A;  1J30 A;  3ES3 A;  1BCF A;  2ITB A;  1JKU A;  2BJY A;  4LPN A;  3HL1 A;  4X0J A;  1Z4A A;  2JD8 0;  2AR0 A;  2W0O A;  3NP2 X;  4DYU A;  3N6O A;  3PW1 B;  5GU3 X;  4ML5 A;  3AJO A;  5J93 A;  4Z5S A;  3PVY B;  3C1Y A;  3R2L A;  4LQH A;  5D8O A;  1RCE A;  3T9J A;  2XKQ A;  4P18 A;  2RBD A;  3E6R A;  3BVI A;  3C23 A;  4W4K B;  1LB3 A;  2CWL A;  3WNW A;  3PVR B;  1NF6 A;  3PVT A;  2V8U A;  2V2I A;  4TOD A;  5JKL A;  2YJJ A;  2ZA8 A;  3RAV A;  3F33 A;  4LPM A;  1TK6 A;  3SH6 A;  5J9V A;  3IQ1 A;  1YUZ A;  3JZA B;  3BVE A;  2FKZ A;  1IES A;  3Q4N A;  3E1J A;  2Z6M A;  3F39 A;  4XGS A;  4A25 A;  5CZU A;  3LKD A;  4DYX A;  4AM5 A;  2XJO A;  3E1Q A;  1QYB A;  3OJ5 A;  4CYB A;  2C41 A;  2IB0 A;  3F32 A;  3AF8 X;  3OGH A;  5E2D A;  2Z90 A;  4LQV A;  3F37 A;  3D19 A;  4LPJ A;  4TOA A;  4XKT A;  5JKM A;  2JD6 0;  4IXK A;  3DBY A;  1YUX A;  2FG8 A;  2Z5P A;  3KWO A;  2F7N A;  1F30 A;  2ZA7 A;  5D8R A;  5I4J A;  2D5K A;  3AF9 X;  4RC6 B;  2X17 0;  3KXU A;  4M32 A;  2V2S A;  5J8S A;  5ERK A;  3AK9 A;  1TKO A;  4TOC A;  3R2K A;  3HIU A;  5D8Q A;  1LKP A;  3BVL A;  5D8S A;  4AM2 A;  4MUD A;  4ZKX A;  1VEI A;  4ZJK A;  3O7S A;  3ERZ A;  3BT5 A;  1HRS A;  1EUM A;  4RC5 B;  3UNO A;  3PW8 A;  4MXP A;  1ZUJ A;  3KA3 A;  5D8X A;  1JI4 A;  4RC7 A;  2G4H A;  1NF4 A;  3GHQ A;  3KA8 A;  4DZ0 A;  4DYY A;  1Z6O A;  1XZ1 A;  2V2J A;  2YJK A;  3GGZ A;  2OC5 A;  4TOF A;  2XJN A;  1JI5 A;  2V2O A;  2WLA A;  5GN8 B;  4XKU A;  2Z5Q A;  2YW6 A;  3H7G A;  4II4 B;  3UFB A;  4LYU A;  1JYB A;  3QVD A;  1S30 A;  1IER A;  1NNQ A;  1UVH A;  4CYA A;  2GYQ A;  1VEQ A;  1XZ3 A;  3A68 A;  4YXJ A;  1SOF A;  3R2S A;  3E1N A;  3BKN A;  4M35 A;  4MN9 A;  1RCC A;  2OH3 A;  1QGH A;  4KVQ A;  3KA9 A;  3V3K B;  4KVS A;  2XJM A;  2V2N A;  4Y08 A;  1JRE A;  2BKC A;  4TW3 A;  5GU1 X;  3JZ9 A;  3R2M A;  1O9I A;  5HJH A;  2CEI A;  5FFD A;  2FJC A;  4ITT A;  5GU2 X;  4W4L B;  2FL0 A;  4ISM A;  2CN7 A;  3EGM A;  2ZG7 X;  3QHB A;  2MGY A;  5IX6 A;  2FHA A;  3SE1 A;  1AEW A;  1BFR A;  5GN8 A;  3O7R A;  3BVF A;  1DVB A;  5CMQ A;  1R03 A;  3IS7 A;  2CIH A;  3R2H A;  5GOU A;  3AK8 A;  2GYD A;  3ISE A;  3QHC A;  3PW1 A;  4CMY V;  3AJP A;  4DYZ A;  4RC8 A;  2V2L A;  3PVY A;  5C6F A;  4PG1 A;  1JIG A;  3FRS A;  1TKP A;  2OKC A;  4DAS A;  4EVD A;  3KHK A;  5HJF A;  1GWG A;  1OTK A;  2V2M A;  3PVR A;  3Q4O A;  2IY4 A;  1RYT A;  4OYN A;  4E40 A;  1TJO A;  1Z6O M;  4ZKW A;  4LQN A;  1VLG A;  5JAC A;  2Z5R A;  3C21 A;  3WVW A;  2YW7 A;  3PWQ C;  2Y3Q A;  4CY9 A;  5E1U A;  4CVP A;  2IU2 A;  5LG2 A;  1BG7 A;  1JTS A;  3RD0 A;  2QQY A;  2CHP A;  4DI0 A;  4MY7 A;  4ITW A;  1MOJ A;  3E1O A;  2CLB A;  1FHA A;  1JGC A;  3QB9 A;  4PG0 A;  4CVR A;  2FZF A;  3Q4Q A;  4QUW A;  4Z3B A;  4XKS A;  1SQ3 A;  3PWF A;  4TOE A;  3FVB A;  1LKO A;  1S3Q A;  5D8Y A;  4YXM A;  1VJX A;  3AJQ A;  5AXS A;  4DE6 A;  4ZL5 A;  5K52 A;  2CF7 A;  5JKL G;  4RC6 A;  4M34 A;  3QZ3 A;  1VEL A;  5J8W A;  4REU A;  5FEJ A;  3PVT B;  4ZKH A;  3C1Z A;  2WWX B;  3F35 A;  2VXI A;  4ZTT A;  3WVU A;  3SID A;  3SHX A;  4MKU A;  3R2R A;  1DAT A;  2GS4 A;  2Y44 A;  3VNX A;  2XGW A;  2V15 A;  1N1Q A;  2WLU A;  3FSE A;  3F36 A;  4RC5 A;  2ZUR X;  3FRR A;  4IWK A;  5K53 A;  4PGI A;  2HTN A;  4ZMC A;  5HU6 D;  5ERJ A;  5FFC A;  3A9Q A;  4LQJ A;  3NOZ X;  1UMN A;  2BK6 A;  5JKM G;  3L0M A;  3IS8 A;  3QD8 A;  2C2J A;  4TOB A;  5FFA A;  1KRQ A;  1RCI A;  2VZB A;  3KA6 A;  2UX1 A;  4TOH A;  1L8H A;  3M6J A;  4II4 A;  3E6S A;  1H96 A;  4ZL6 A;  2C2F A;  4LYX A;  4EVC A;  3E1L A;  2HR5 A;  4U3G A;  3KX9 A;  4ZLW A;  2CHI A;  4KXR B;  2ZA6 A;  2C2U A;  2FG4 A;  4MJY A;  5LS9 A;  2ZG8 X;  3F34 A;  2CN6 A;  3E1P A;  3W54 A;  3F38 A;  4ETR A;  4KVR A;  3EZU A;  3RE7 A;  2G38 B;  3U90 A;  2V2R A;  3Q4R A;  4R42 A;  2JD7 0;  4RC7 B;  2V2P A;  2FFX J;  2V8T A;  1LKM A;  3MPS A;  1B71 A;  2BW1 A;  1DPS A;  3AF7 X;  2VXX A;  3UOI A;  1ZS3 A;  3PW8 C;  3PZA A;  2WTL A;  5JDO B;  3FI6 A;  3RBC A;  4IWJ A;  2N02 A;  3GVY A;  5LG8 A;  5GU0 X;  1O9R A;  3NP0 X;  2ZG9 X;  2PYB A;  3KDQ A;  5FFB A;  3GGY A;  3BVK A;  1JKV A;  3PWQ A;  4WJG 4;  4ERU A;  2C6R A;  4AM4 A;  4CMY A;  2CLU A;  3KA4 A;  4PGK A;  4TOG A; 
#chains in the Genus database with same CATH homology
 3EZ0 A;  1MFR A;  3ISF A;  3VVA A;  5LBH A;  1L8I A;  5FFE A;  4ISP A;  4EVE A;  3WVV A;  1S2Z A;  1F33 A;  3UOF A;  1NFV A;  4YVZ A;  5HQO A;  3E2C A;  5D8P A;  4E6K A;  4M33 A;  4TO9 A;  1RCG A;  1RCD A;  1YV1 A;  3E1M A;  4YKH A;  5JDO A;  5CMR A;  3GE4 A;  2QF9 A;  4CVS A;  4CVT A;  4EVB A;  3VV9 A;  3TA8 A;  3R2O A;  3RGD A;  1J30 A;  3ES3 A;  1BCF A;  2ITB A;  1JKU A;  2BJY A;  4LPN A;  3HL1 A;  4X0J A;  1Z4A A;  2JD8 0;  2AR0 A;  2W0O A;  3NP2 X;  4DYU A;  3N6O A;  3PW1 B;  5GU3 X;  4ML5 A;  3AJO A;  5J93 A;  4Z5S A;  3PVY B;  3C1Y A;  3R2L A;  4LQH A;  5D8O A;  1RCE A;  3T9J A;  2XKQ A;  4P18 A;  2RBD A;  3E6R A;  3BVI A;  3C23 A;  4W4K B;  1LB3 A;  2CWL A;  3WNW A;  3PVR B;  1NF6 A;  3PVT A;  2V8U A;  2V2I A;  4TOD A;  5JKL A;  2YJJ A;  2ZA8 A;  3RAV A;  3F33 A;  4LPM A;  1TK6 A;  3SH6 A;  5J9V A;  3IQ1 A;  1YUZ A;  3JZA B;  3BVE A;  2FKZ A;  1IES A;  3Q4N A;  3E1J A;  2Z6M A;  3F39 A;  4XGS A;  4A25 A;  5CZU A;  3LKD A;  4DYX A;  4AM5 A;  2XJO A;  3E1Q A;  1QYB A;  3OJ5 A;  4CYB A;  2C41 A;  2IB0 A;  3F32 A;  3AF8 X;  3OGH A;  5E2D A;  2Z90 A;  4LQV A;  3F37 A;  3D19 A;  4LPJ A;  4TOA A;  4XKT A;  5JKM A;  2JD6 0;  4IXK A;  3DBY A;  1YUX A;  2FG8 A;  2Z5P A;  3KWO A;  2F7N A;  1F30 A;  2ZA7 A;  5D8R A;  5I4J A;  2D5K A;  3AF9 X;  4RC6 B;  2X17 0;  3KXU A;  4M32 A;  2V2S A;  5J8S A;  5ERK A;  3AK9 A;  1TKO A;  4TOC A;  3R2K A;  3HIU A;  5D8Q A;  1LKP A;  3BVL A;  5D8S A;  4AM2 A;  4MUD A;  4ZKX A;  1VEI A;  4ZJK A;  3O7S A;  3ERZ A;  3BT5 A;  1HRS A;  1EUM A;  4RC5 B;  3UNO A;  3PW8 A;  4MXP A;  1ZUJ A;  3KA3 A;  5D8X A;  1JI4 A;  4RC7 A;  2G4H A;  1NF4 A;  3GHQ A;  3KA8 A;  4DZ0 A;  4DYY A;  1Z6O A;  1XZ1 A;  2V2J A;  2YJK A;  3GGZ A;  2OC5 A;  4TOF A;  2XJN A;  1JI5 A;  2V2O A;  2WLA A;  5GN8 B;  4XKU A;  2Z5Q A;  2YW6 A;  3H7G A;  4II4 B;  3UFB A;  4LYU A;  1JYB A;  3QVD A;  1S30 A;  1IER A;  1NNQ A;  1UVH A;  4CYA A;  2GYQ A;  1VEQ A;  1XZ3 A;  3A68 A;  4YXJ A;  1SOF A;  3R2S A;  3E1N A;  3BKN A;  4M35 A;  4MN9 A;  1RCC A;  2OH3 A;  1QGH A;  4KVQ A;  3KA9 A;  3V3K B;  4KVS A;  2XJM A;  2V2N A;  4Y08 A;  1JRE A;  2BKC A;  4TW3 A;  5GU1 X;  3JZ9 A;  3R2M A;  1O9I A;  5HJH A;  2CEI A;  5FFD A;  2FJC A;  4ITT A;  5GU2 X;  4W4L B;  2FL0 A;  4ISM A;  2CN7 A;  3EGM A;  2ZG7 X;  3QHB A;  2MGY A;  5IX6 A;  2FHA A;  3SE1 A;  1AEW A;  1BFR A;  5GN8 A;  3O7R A;  3BVF A;  1DVB A;  5CMQ A;  1R03 A;  3IS7 A;  2CIH A;  3R2H A;  5GOU A;  3AK8 A;  2GYD A;  3ISE A;  3QHC A;  3PW1 A;  4CMY V;  3AJP A;  4DYZ A;  4RC8 A;  2V2L A;  3PVY A;  5C6F A;  4PG1 A;  1JIG A;  3FRS A;  1TKP A;  2OKC A;  4DAS A;  4EVD A;  3KHK A;  5HJF A;  1GWG A;  1OTK A;  2V2M A;  3PVR A;  3Q4O A;  2IY4 A;  1RYT A;  4OYN A;  4E40 A;  1TJO A;  1Z6O M;  4ZKW A;  4LQN A;  1VLG A;  5JAC A;  2Z5R A;  3C21 A;  3WVW A;  2YW7 A;  3PWQ C;  2Y3Q A;  4CY9 A;  5E1U A;  4CVP A;  2IU2 A;  5LG2 A;  1BG7 A;  1JTS A;  3RD0 A;  2QQY A;  2CHP A;  4DI0 A;  4MY7 A;  4ITW A;  1MOJ A;  3E1O A;  2CLB A;  1FHA A;  1JGC A;  3QB9 A;  4PG0 A;  4CVR A;  2FZF A;  3Q4Q A;  4QUW A;  4Z3B A;  4XKS A;  1SQ3 A;  3PWF A;  4TOE A;  3FVB A;  1LKO A;  1S3Q A;  5D8Y A;  4YXM A;  1VJX A;  3AJQ A;  5AXS A;  4DE6 A;  4ZL5 A;  5K52 A;  2CF7 A;  5JKL G;  4RC6 A;  4M34 A;  3QZ3 A;  1VEL A;  5J8W A;  4REU A;  5FEJ A;  3PVT B;  4ZKH A;  3C1Z A;  2WWX B;  3F35 A;  2VXI A;  4ZTT A;  3WVU A;  3SID A;  3SHX A;  4MKU A;  3R2R A;  1DAT A;  2GS4 A;  2Y44 A;  3VNX A;  2XGW A;  2V15 A;  1N1Q A;  2WLU A;  3FSE A;  3F36 A;  4RC5 A;  2ZUR X;  3FRR A;  4IWK A;  5K53 A;  4PGI A;  2HTN A;  4ZMC A;  5HU6 D;  5ERJ A;  5FFC A;  3A9Q A;  4LQJ A;  3NOZ X;  1UMN A;  2BK6 A;  5JKM G;  3L0M A;  3IS8 A;  3QD8 A;  2C2J A;  4TOB A;  5FFA A;  1KRQ A;  1RCI A;  2VZB A;  3KA6 A;  2UX1 A;  4TOH A;  1L8H A;  3M6J A;  4II4 A;  3E6S A;  1H96 A;  4ZL6 A;  2C2F A;  4LYX A;  4EVC A;  3E1L A;  2HR5 A;  4U3G A;  3KX9 A;  4ZLW A;  2CHI A;  4KXR B;  2ZA6 A;  2C2U A;  2FG4 A;  4MJY A;  5LS9 A;  2ZG8 X;  3F34 A;  2CN6 A;  3E1P A;  3W54 A;  3F38 A;  4ETR A;  4KVR A;  3EZU A;  3RE7 A;  2G38 B;  3U90 A;  2V2R A;  3Q4R A;  4R42 A;  2JD7 0;  4RC7 B;  2V2P A;  2FFX J;  2V8T A;  1LKM A;  3MPS A;  1B71 A;  2BW1 A;  1DPS A;  3AF7 X;  2VXX A;  3UOI A;  1ZS3 A;  3PW8 C;  3PZA A;  2WTL A;  5JDO B;  3FI6 A;  3RBC A;  4IWJ A;  2N02 A;  3GVY A;  5LG8 A;  5GU0 X;  1O9R A;  3NP0 X;  2ZG9 X;  2PYB A;  3KDQ A;  5FFB A;  3GGY A;  3BVK A;  1JKV A;  3PWQ A;  4WJG 4;  4ERU A;  2C6R A;  4AM4 A;  4CMY A;  2CLU A;  3KA4 A;  4PGK A;  4TOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...