3QB9A

Mycobacterium tuberculosis bacterioferritin, bfra
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
159
structure length
159
Chain Sequence
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRPPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterioferritin
publication title Mycobacterium tuberculosis bacterioferritin, BfrA
rcsb
source organism Mycobacterium tuberculosis
molecule tags Metal binding protein
total genus 77
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3qb9A00
2CHPA 2WLAA 2ZURX 2V2PA 1VJXA 4TO9A 5D8OA 3AK8A 2ITBA 3F32A 5JKLG 1JI5A 1KRQA 2C2JA 2YJKA 3UOFA 4PGIA 1IESA 4LPMA 4LQHA 1RCEA 3SHXA 3PWQA 4LQJA 1JYBA 3R2KA 4TOGA 3ES3A 5FFBA 2XGWA 4RC7A 5JKLA 4CYAA 3O7RA 2V2RA 1QYBA 3TA8A 1MFRA 5D8YA 5AXSA 3RBCA 5ERJA 3SIDA 1Z6OA 2D5KA 2ZA7A 4MY7A 2G4HA 4TOCA 5CZUA 2WLUA 5LG2A 1O9RA 3R2MA 2GS4A 3E1OA 2Z5RA 1JI4A 1TJOA 3FVBA 2VZBA 2FJCA 4RC5B 1N1QA 5J9VA 5GN8A 4CMYA 3RAVA 1Z6OM 5E2DA 5HJHA 1J30A 4ISMA 3UNOA 3E6RA 1DATA 4E6KA 5FFAA 2CN6A 3O7SA 2VXIA 4AM2A 4IWJA 3F39A 3Q4OA 2IU2A 5J8SA 2OC5A 2XKQA 3WVUA 1YUXA 4RC7B 3Q4NA 4LQNA 2CIHA 2FHAA 5J8WA 2VXXA 1LB3A 3KA9A 3UOIA 2PYBA 4TOBA 5D8QA 1TKOA 5JKMG 5CMQA 3QHCA 1L8HA 3H7GA 4OYNA 3A68A 1XZ3A 4ERUA 3FSEA 4XKUA 3IS7A 4ZL5A 3KX9A 4CYBA 2XJOA 4ITTA 4CVPA 4DI0A 2FFXJ 5JKMA 3U90A 2CF7A 1JTSA 5FFCA 4ZTTA 2X170 2C2UA 4DYYA 2XJMA 3F38A 3KA6A 1S3QA 1YUZA 2Y3QA 2XJNA 5FFDA 3PWFA 4RC5A 3E1PA 2CLBA 2OH3A 1SQ3A 4DE6A 3BKNA 1TKPA 4TOFA 4CMYV 2FKZA 4ISPA 3QHBA 3RE7A 1UVHA 3R2LA 4CVRA 3E2CA 3PW1A 1RCGA 3PW8C 3A9QA 2YW6A 1RCIA 1TK6A 2W0OA 4KVQA 3PVTA 4XKTA 3NP2X 5ERKA 4DZ0A 1SOFA 3Q4RA 4A25A 4ITWA 3E1LA 1B71A 4YKHA 2ZG9X 3PZAA 3SE1A 1OTKA 1NF6A 5IX6A 4MJYA 3NP0X 3KXUA 4ML5A 3IS8A 3PVYB 1QGHA 3BT5A 4MUDA 4M33A 1DVBA 3AK9A 1S2ZA 2IY4A 2FG8A 4TODA 4AM5A 2ZA6A 2ZG8X 3E1MA 4MKUA 3HIUA 3NOZX 3PVRA 5D8RA 5FEJA 1NFVA 1JKUA 1F30A 2ZA8A 2FZFA 2JD80 5C6FA 4LYUA 1DPSA 2V2MA 3E1NA 1BCFA 2V2JA 3T9JA 2HR5A 5I4JA 3AF9X 4P18A 1RCDA 3PW1B 1LKOA 4XKSA 4ZL6A 5LG8A 3E6SA 5E1UA 1GWGA 3PVTB 2UX1A 3RGDA 1YV1A 3R2SA 5GU1X 3E1JA 4DYXA 1IERA 1RCCA 4II4B 2JD70 3Q4QA 1BFRA 2CHIA 3HL1A 1R03A 3FI6A 3AJQA 5CMRA 1Z4AA 2BJYA 5JACA 2V15A 2F7NA 1S30A 3EGMA 3F35A 3PVRB 4EVBA 2JD60 5GU3X 3GHQA 4Z5SA 1JGCA 3PVYA 1RYTA 2QQYA 1UMNA 3GVYA 3BVKA 4QUWA 2Z6MA 4ZKHA 4Z3BA 2FG4A 3QVDA 4IWKA 2BK6A 2IB0A 3F33A 3QD8A 3PWQC 2FL0A 3OGHA 1NF4A 5J93A 1VEIA 2CN7A 2CEIA 2BW1A 1MOJA 3GE4A 3ISFA 4DYUA 3BVFA 3RD0A 1F33A 3R2RA 3BVEA 5D8PA 4R42A 4TOEA 4LYXA 4RC6A 2C2FA 1VEQA 3F37A 3R2HA 4DASA 4PG0A 2QF9A 4REUA 3SH6A 3KA3A 1LKPA 3EZ0A 3MPSA 4CVSA 5GOUA 3ISEA 4II4A 2GYQA 3ERZA 4AM4A 4XGSA 1ZS3A 4TOAA 4LPJA 4ZLWA 3AF7X 4RC8A 4IXKA 5LS9A 4EVDA 5GU2X 3AJPA 4M35A 3F36A 1H96A 3PW8A 5D8XA 3WNWA 4ZKXA 3OJ5A 4KVSA 4ZKWA 4LPNA 4DYZA 2Z5PA 4PG1A 4Y08A 1BG7A 2Z90A 4EVCA 5HJFA 4RC6B 3AJOA 3WVWA 4CVTA 4EVEA 5K52A 4U3GA 2C6RA 2GYDA 4MN9A 4TW3A 5D8SA 5FFEA 2V2OA 2Z5QA 3KA4A 4ZJKA 2BKCA 5GU0X 1ZUJA 4PGKA 2ZG7X 3BVIA 3E1QA 3VNXA 4M32A 5LBHA 4ZMCA 3F34A 4M34A 4LQVA 1JIGA 2V2SA 2V2NA 2V2LA 3QZ3A 1AEWA 3R2OA 3KA8A 2C41A 3QB9A 1EUMA 1FHAA 4ETRA 3BVLA 4CY9A 3KWOA 5HQOA 2HTNA 3EZUA 1VLGA 1VELA 1L8IA 3WVVA 1HRSA 2CLUA 5K53A 1LKMA 3IQ1A 1O9IA 2V2IA 1XZ1A 5GN8B 2WTLA 2YW7A 3AF8X 1JKVA 4TOHA 2YJJA 2RBDA 4KVRA 1NNQA 1JREA
chains in the Genus database with same CATH superfamily
2CHPA 2WLAA 2ZURX 2V2PA 1VJXA 4TO9A 5D8OA 3AK8A 2ITBA 3F32A 5JKLG 1JI5A 1KRQA 2C2JA 2YJKA 3UOFA 4PGIA 1IESA 4LPMA 4LQHA 1RCEA 3SHXA 3PWQA 4LQJA 1JYBA 3R2KA 4TOGA 3ES3A 5FFBA 2XGWA 4RC7A 5JKLA 4CYAA 3O7RA 2V2RA 1QYBA 3TA8A 1MFRA 5D8YA 5AXSA 3VV9A 3RBCA 5ERJA 3SIDA 1Z6OA 2D5KA 2ZA7A 4MY7A 2G4HA 4TOCA 5JDOB 5CZUA 2WLUA 5LG2A 1O9RA 3R2MA 2GS4A 3E1OA 2Z5RA 1JI4A 1TJOA 3FVBA 2VZBA 2FJCA 4RC5B 1N1QA 3GGYA 5J9VA 5GN8A 4CMYA 3RAVA 1Z6OM 5E2DA 5HJHA 1J30A 4ISMA 3UNOA 3E6RA 1DATA 4E6KA 5FFAA 2CN6A 4YXJA 3O7SA 2VXIA 2CWLA 4AM2A 4IWJA 3F39A 4YVZA 3Q4OA 2IU2A 5J8SA 2AR0A 2OC5A 2XKQA 3WVUA 1YUXA 4RC7B 3Q4NA 4LQNA 2CIHA 2FHAA 5J8WA 3KHKA 2VXXA 1LB3A 3KA9A 3UOIA 2PYBA 4TOBA 5D8QA 1TKOA 5JKMG 5CMQA 3QHCA 1L8HA 3H7GA 4OYNA 3A68A 1XZ3A 4ERUA 3FSEA 4XKUA 2OKCA 3IS7A 4ZL5A 3KX9A 4CYBA 2XJOA 4ITTA 4CVPA 4DI0A 2FFXJ 5JKMA 3U90A 2CF7A 1JTSA 5FFCA 4ZTTA 4KXRB 2X170 2C2UA 4DYYA 2XJMA 3F38A 3KA6A 1S3QA 1YUZA 2Y3QA 2XJNA 5FFDA 3PWFA 4RC5A 3E1PA 2CLBA 2OH3A 1SQ3A 4DE6A 3BKNA 1TKPA 4TOFA 4CMYV 2FKZA 4ISPA 3QHBA 3RE7A 1UVHA 3R2LA 4CVRA 3E2CA 3PW1A 1RCGA 3KDQA 3PW8C 3A9QA 2YW6A 1RCIA 1TK6A 2W0OA 4KVQA 3DBYA 3PVTA 4XKTA 3NP2X 5ERKA 4DZ0A 1SOFA 3FRRA 3Q4RA 4A25A 4ITWA 3E1LA 1B71A 4YKHA 2ZG9X 3PZAA 3SE1A 1OTKA 1NF6A 5IX6A 4MJYA 3NP0X 3KXUA 2N02A 4ML5A 3IS8A 3PVYB 1QGHA 3BT5A 4MUDA 4M33A 1DVBA 3AK9A 1S2ZA 2IY4A 2FG8A 3C1YA 4TODA 4AM5A 2ZA6A 2V8TA 2ZG8X 3E1MA 4MKUA 3HIUA 3NOZX 3PVRA 5D8RA 5FEJA 1NFVA 3M6JA 1JKUA 1F30A 2ZA8A 2WWXB 2FZFA 2JD80 5C6FA 4LYUA 1DPSA 2V2MA 3E1NA 1BCFA 2V2JA 3T9JA 2HR5A 5I4JA 3AF9X 4P18A 1RCDA 3V3KB 3PW1B 1LKOA 4XKSA 4ZL6A 5LG8A 3E6SA 5E1UA 1GWGA 3PVTB 2UX1A 3RGDA 1YV1A 3R2SA 5GU1X 2V8UA 5HU6D 3E1JA 4DYXA 2G38B 1IERA 1RCCA 4II4B 2JD70 3Q4QA 1BFRA 2CHIA 3HL1A 1R03A 3FI6A 3AJQA 5CMRA 4X0JA 1Z4AA 2BJYA 5JACA 2V15A 2F7NA 1S30A 3EGMA 3F35A 4W4LB 3PVRB 4EVBA 2JD60 5GU3X 3GHQA 4Z5SA 1JGCA 3PVYA 1RYTA 2QQYA 1UMNA 3GVYA 3BVKA 4QUWA 2Z6MA 4ZKHA 4Z3BA 2FG4A 3QVDA 4IWKA 4MXPA 2BK6A 2IB0A 3C1ZA 3F33A 2MGYA 3QD8A 3N6OA 3PWQC 2FL0A 3LKDA 3OGHA 1NF4A 5J93A 1VEIA 2CN7A 3W54A 2CEIA 2BW1A 1MOJA 3GE4A 3ISFA 4DYUA 2Y44A 3BVFA 3RD0A 1F33A 3JZAB 3R2RA 3BVEA 5D8PA 4R42A 4TOEA 4YXMA 4LYXA 4RC6A 4E40A 2C2FA 1VEQA 3F37A 3R2HA 4DASA 4PG0A 2QF9A 4REUA 3SH6A 3KA3A 1LKPA 3UFBA 3EZ0A 3MPSA 4CVSA 5GOUA 3ISEA 4II4A 2GYQA 3ERZA 4AM4A 4XGSA 1ZS3A 4TOAA 4LPJA 4ZLWA 3AF7X 4RC8A 4IXKA 5LS9A 4EVDA 5GU2X 3AJPA 4M35A 3F36A 1H96A 3PW8A 5D8XA 3WNWA 4ZKXA 3OJ5A 4KVSA 3VVAA 4ZKWA 4LPNA 4DYZA 2Z5PA 4WJG4 3L0MA 4PG1A 4Y08A 1BG7A 2Z90A 4EVCA 5HJFA 3D19A 4RC6B 3AJOA 3WVWA 4CVTA 4EVEA 5K52A 4U3GA 2C6RA 2GYDA 4MN9A 4TW3A 3C21A 5D8SA 2V2OA 5FFEA 2Z5QA 3JZ9A 3KA4A 4W4KB 4ZJKA 2BKCA 5GU0X 1ZUJA 4PGKA 3C23A 2ZG7X 3BVIA 3E1QA 3VNXA 4M32A 5LBHA 4ZMCA 3F34A 4M34A 4LQVA 1JIGA 2V2SA 2V2NA 2V2LA 3QZ3A 3FRSA 1AEWA 3GGZA 3R2OA 3KA8A 2C41A 3QB9A 1EUMA 1FHAA 4ETRA 3BVLA 4CY9A 3KWOA 5HQOA 2HTNA 3EZUA 1VLGA 1VELA 1L8IA 3WVVA 1HRSA 2CLUA 5K53A 1LKMA 3IQ1A 1O9IA 2V2IA 1XZ1A 5GN8B 2WTLA 2YW7A 5JDOA 3AF8X 1JKVA 4TOHA 2YJJA 2RBDA 4KVRA 1NNQA 1JREA
chains in the Genus database with same CATH topology
2CHPA 2WLAA 2ZURX 2V2PA 1VJXA 4TO9A 5D8OA 3AK8A 2ITBA 3F32A 5JKLG 1JI5A 1KRQA 2C2JA 2YJKA 3UOFA 4PGIA 1IESA 4LPMA 4LQHA 1RCEA 3SHXA 3PWQA 4LQJA 1JYBA 3R2KA 4TOGA 3ES3A 5FFBA 2XGWA 4RC7A 5JKLA 4CYAA 3O7RA 2V2RA 1QYBA 3TA8A 1MFRA 5D8YA 5AXSA 3VV9A 3RBCA 5ERJA 3SIDA 1Z6OA 2D5KA 2ZA7A 4MY7A 2G4HA 4TOCA 5JDOB 5CZUA 2WLUA 5LG2A 1O9RA 3R2MA 2GS4A 3E1OA 2Z5RA 1JI4A 1TJOA 3FVBA 2VZBA 2FJCA 4RC5B 1N1QA 3GGYA 5J9VA 5GN8A 4CMYA 3RAVA 1Z6OM 5E2DA 5HJHA 1J30A 4ISMA 3UNOA 3E6RA 1DATA 4E6KA 5FFAA 2CN6A 4YXJA 3O7SA 2VXIA 2CWLA 4AM2A 4IWJA 3F39A 4YVZA 3Q4OA 2IU2A 5J8SA 2AR0A 2OC5A 2XKQA 3WVUA 1YUXA 4RC7B 3Q4NA 4LQNA 2CIHA 2FHAA 5J8WA 3KHKA 2VXXA 1LB3A 3KA9A 3UOIA 2PYBA 4TOBA 5D8QA 1TKOA 5JKMG 5CMQA 3QHCA 1L8HA 3H7GA 4OYNA 3A68A 1XZ3A 4ERUA 3FSEA 4XKUA 2OKCA 3IS7A 4ZL5A 3KX9A 4CYBA 2XJOA 4ITTA 4CVPA 4DI0A 2FFXJ 5JKMA 3U90A 2CF7A 1JTSA 5FFCA 4ZTTA 4KXRB 2X170 2C2UA 4DYYA 2XJMA 3F38A 3KA6A 1S3QA 1YUZA 2Y3QA 2XJNA 5FFDA 3PWFA 4RC5A 3E1PA 2CLBA 2OH3A 1SQ3A 4DE6A 3BKNA 1TKPA 4TOFA 4CMYV 2FKZA 4ISPA 3QHBA 3RE7A 1UVHA 3R2LA 4CVRA 3E2CA 3PW1A 1RCGA 3KDQA 3PW8C 3A9QA 2YW6A 1RCIA 1TK6A 2W0OA 4KVQA 3DBYA 3PVTA 4XKTA 3NP2X 5ERKA 4DZ0A 1SOFA 3FRRA 3Q4RA 4A25A 4ITWA 3E1LA 1B71A 4YKHA 2ZG9X 3PZAA 3SE1A 1OTKA 1NF6A 5IX6A 4MJYA 3NP0X 3KXUA 2N02A 4ML5A 3IS8A 3PVYB 1QGHA 3BT5A 4MUDA 4M33A 1DVBA 3AK9A 1S2ZA 2IY4A 2FG8A 3C1YA 4TODA 4AM5A 2ZA6A 2V8TA 2ZG8X 3E1MA 4MKUA 3HIUA 3NOZX 3PVRA 5D8RA 5FEJA 1NFVA 3M6JA 1JKUA 1F30A 2ZA8A 2WWXB 2FZFA 2JD80 5C6FA 4LYUA 1DPSA 2V2MA 3E1NA 1BCFA 2V2JA 3T9JA 2HR5A 5I4JA 3AF9X 4P18A 1RCDA 3V3KB 3PW1B 1LKOA 4XKSA 4ZL6A 5LG8A 3E6SA 5E1UA 1GWGA 3PVTB 2UX1A 3RGDA 1YV1A 3R2SA 5GU1X 2V8UA 5HU6D 3E1JA 4DYXA 2G38B 1IERA 1RCCA 4II4B 2JD70 3Q4QA 1BFRA 2CHIA 3HL1A 1R03A 3FI6A 3AJQA 5CMRA 4X0JA 1Z4AA 2BJYA 5JACA 2V15A 2F7NA 1S30A 3EGMA 3F35A 4W4LB 3PVRB 4EVBA 2JD60 5GU3X 3GHQA 4Z5SA 1JGCA 3PVYA 1RYTA 2QQYA 1UMNA 3GVYA 3BVKA 4QUWA 2Z6MA 4ZKHA 4Z3BA 2FG4A 3QVDA 4IWKA 4MXPA 2BK6A 2IB0A 3C1ZA 3F33A 2MGYA 3QD8A 3N6OA 3PWQC 2FL0A 3LKDA 3OGHA 1NF4A 5J93A 1VEIA 2CN7A 3W54A 2CEIA 2BW1A 1MOJA 3GE4A 3ISFA 4DYUA 2Y44A 3BVFA 3RD0A 1F33A 3JZAB 3R2RA 3BVEA 5D8PA 4R42A 4TOEA 4YXMA 4LYXA 4RC6A 4E40A 2C2FA 1VEQA 3F37A 3R2HA 4DASA 4PG0A 2QF9A 4REUA 3SH6A 3KA3A 1LKPA 3UFBA 3EZ0A 3MPSA 4CVSA 5GOUA 3ISEA 4II4A 2GYQA 3ERZA 4AM4A 4XGSA 1ZS3A 4TOAA 4LPJA 4ZLWA 3AF7X 4RC8A 4IXKA 5LS9A 4EVDA 5GU2X 3AJPA 4M35A 3F36A 1H96A 3PW8A 5D8XA 3WNWA 4ZKXA 3OJ5A 4KVSA 3VVAA 4ZKWA 4LPNA 4DYZA 2Z5PA 4WJG4 3L0MA 4PG1A 4Y08A 1BG7A 2Z90A 4EVCA 5HJFA 3D19A 4RC6B 3AJOA 3WVWA 4CVTA 4EVEA 5K52A 4U3GA 2C6RA 2GYDA 4MN9A 4TW3A 3C21A 5D8SA 2V2OA 5FFEA 2Z5QA 3JZ9A 3KA4A 4W4KB 4ZJKA 2BKCA 5GU0X 1ZUJA 4PGKA 3C23A 2ZG7X 3BVIA 3E1QA 3VNXA 4M32A 5LBHA 4ZMCA 3F34A 4M34A 4LQVA 1JIGA 2V2SA 2V2NA 2V2LA 3QZ3A 3FRSA 1AEWA 3GGZA 3R2OA 3KA8A 2C41A 3QB9A 1EUMA 1FHAA 4ETRA 3BVLA 4CY9A 3KWOA 5HQOA 2HTNA 3EZUA 1VLGA 1VELA 1L8IA 3WVVA 1HRSA 2CLUA 5K53A 1LKMA 3IQ1A 1O9IA 2V2IA 1XZ1A 5GN8B 2WTLA 2YW7A 5JDOA 3AF8X 1JKVA 4TOHA 2YJJA 2RBDA 4KVRA 1NNQA 1JREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHP A;  2WLA A;  2ZUR X;  2V2P A;  1VJX A;  4TO9 A;  5D8O A;  3AK8 A;  2ITB A;  3F32 A;  5JKL G;  1JI5 A;  1KRQ A;  2C2J A;  2YJK A;  3UOF A;  4PGI A;  1IES A;  4LPM A;  4LQH A;  1RCE A;  3SHX A;  3PWQ A;  4LQJ A;  1JYB A;  3R2K A;  4TOG A;  3ES3 A;  5FFB A;  2XGW A;  4RC7 A;  5JKL A;  4CYA A;  3O7R A;  2V2R A;  1QYB A;  3TA8 A;  1MFR A;  5D8Y A;  5AXS A;  3RBC A;  5ERJ A;  3SID A;  1Z6O A;  2D5K A;  2ZA7 A;  4MY7 A;  2G4H A;  4TOC A;  5CZU A;  2WLU A;  5LG2 A;  1O9R A;  3R2M A;  2GS4 A;  3E1O A;  2Z5R A;  1JI4 A;  1TJO A;  3FVB A;  2VZB A;  2FJC A;  4RC5 B;  1N1Q A;  5J9V A;  5GN8 A;  4CMY A;  3RAV A;  1Z6O M;  5E2D A;  5HJH A;  1J30 A;  4ISM A;  3UNO A;  3E6R A;  1DAT A;  4E6K A;  5FFA A;  2CN6 A;  3O7S A;  2VXI A;  4AM2 A;  4IWJ A;  3F39 A;  3Q4O A;  2IU2 A;  5J8S A;  2OC5 A;  2XKQ A;  3WVU A;  1YUX A;  4RC7 B;  3Q4N A;  4LQN A;  2CIH A;  2FHA A;  5J8W A;  2VXX A;  1LB3 A;  3KA9 A;  3UOI A;  2PYB A;  4TOB A;  5D8Q A;  1TKO A;  5JKM G;  5CMQ A;  3QHC A;  1L8H A;  3H7G A;  4OYN A;  3A68 A;  1XZ3 A;  4ERU A;  3FSE A;  4XKU A;  3IS7 A;  4ZL5 A;  3KX9 A;  4CYB A;  2XJO A;  4ITT A;  4CVP A;  4DI0 A;  2FFX J;  5JKM A;  3U90 A;  2CF7 A;  1JTS A;  5FFC A;  4ZTT A;  2X17 0;  2C2U A;  4DYY A;  2XJM A;  3F38 A;  3KA6 A;  1S3Q A;  1YUZ A;  2Y3Q A;  2XJN A;  5FFD A;  3PWF A;  4RC5 A;  3E1P A;  2CLB A;  2OH3 A;  1SQ3 A;  4DE6 A;  3BKN A;  1TKP A;  4TOF A;  4CMY V;  2FKZ A;  4ISP A;  3QHB A;  3RE7 A;  1UVH A;  3R2L A;  4CVR A;  3E2C A;  3PW1 A;  1RCG A;  3PW8 C;  3A9Q A;  2YW6 A;  1RCI A;  1TK6 A;  2W0O A;  4KVQ A;  3PVT A;  4XKT A;  3NP2 X;  5ERK A;  4DZ0 A;  1SOF A;  3Q4R A;  4A25 A;  4ITW A;  3E1L A;  1B71 A;  4YKH A;  2ZG9 X;  3PZA A;  3SE1 A;  1OTK A;  1NF6 A;  5IX6 A;  4MJY A;  3NP0 X;  3KXU A;  4ML5 A;  3IS8 A;  3PVY B;  1QGH A;  3BT5 A;  4MUD A;  4M33 A;  1DVB A;  3AK9 A;  1S2Z A;  2IY4 A;  2FG8 A;  4TOD A;  4AM5 A;  2ZA6 A;  2ZG8 X;  3E1M A;  4MKU A;  3HIU A;  3NOZ X;  3PVR A;  5D8R A;  5FEJ A;  1NFV A;  1JKU A;  1F30 A;  2ZA8 A;  2FZF A;  2JD8 0;  5C6F A;  4LYU A;  1DPS A;  2V2M A;  3E1N A;  1BCF A;  2V2J A;  3T9J A;  2HR5 A;  5I4J A;  3AF9 X;  4P18 A;  1RCD A;  3PW1 B;  1LKO A;  4XKS A;  4ZL6 A;  5LG8 A;  3E6S A;  5E1U A;  1GWG A;  3PVT B;  2UX1 A;  3RGD A;  1YV1 A;  3R2S A;  5GU1 X;  3E1J A;  4DYX A;  1IER A;  1RCC A;  4II4 B;  2JD7 0;  3Q4Q A;  1BFR A;  2CHI A;  3HL1 A;  1R03 A;  3FI6 A;  3AJQ A;  5CMR A;  1Z4A A;  2BJY A;  5JAC A;  2V15 A;  2F7N A;  1S30 A;  3EGM A;  3F35 A;  3PVR B;  4EVB A;  2JD6 0;  5GU3 X;  3GHQ A;  4Z5S A;  1JGC A;  3PVY A;  1RYT A;  2QQY A;  1UMN A;  3GVY A;  3BVK A;  4QUW A;  2Z6M A;  4ZKH A;  4Z3B A;  2FG4 A;  3QVD A;  4IWK A;  2BK6 A;  2IB0 A;  3F33 A;  3QD8 A;  3PWQ C;  2FL0 A;  3OGH A;  1NF4 A;  5J93 A;  1VEI A;  2CN7 A;  2CEI A;  2BW1 A;  1MOJ A;  3GE4 A;  3ISF A;  4DYU A;  3BVF A;  3RD0 A;  1F33 A;  3R2R A;  3BVE A;  5D8P A;  4R42 A;  4TOE A;  4LYX A;  4RC6 A;  2C2F A;  1VEQ A;  3F37 A;  3R2H A;  4DAS A;  4PG0 A;  2QF9 A;  4REU A;  3SH6 A;  3KA3 A;  1LKP A;  3EZ0 A;  3MPS A;  4CVS A;  5GOU A;  3ISE A;  4II4 A;  2GYQ A;  3ERZ A;  4AM4 A;  4XGS A;  1ZS3 A;  4TOA A;  4LPJ A;  4ZLW A;  3AF7 X;  4RC8 A;  4IXK A;  5LS9 A;  4EVD A;  5GU2 X;  3AJP A;  4M35 A;  3F36 A;  1H96 A;  3PW8 A;  5D8X A;  3WNW A;  4ZKX A;  3OJ5 A;  4KVS A;  4ZKW A;  4LPN A;  4DYZ A;  2Z5P A;  4PG1 A;  4Y08 A;  1BG7 A;  2Z90 A;  4EVC A;  5HJF A;  4RC6 B;  3AJO A;  3WVW A;  4CVT A;  4EVE A;  5K52 A;  4U3G A;  2C6R A;  2GYD A;  4MN9 A;  4TW3 A;  5D8S A;  5FFE A;  2V2O A;  2Z5Q A;  3KA4 A;  4ZJK A;  2BKC A;  5GU0 X;  1ZUJ A;  4PGK A;  2ZG7 X;  3BVI A;  3E1Q A;  3VNX A;  4M32 A;  5LBH A;  4ZMC A;  3F34 A;  4M34 A;  4LQV A;  1JIG A;  2V2S A;  2V2N A;  2V2L A;  3QZ3 A;  1AEW A;  3R2O A;  3KA8 A;  2C41 A;  3QB9 A;  1EUM A;  1FHA A;  4ETR A;  3BVL A;  4CY9 A;  3KWO A;  5HQO A;  2HTN A;  3EZU A;  1VLG A;  1VEL A;  1L8I A;  3WVV A;  1HRS A;  2CLU A;  5K53 A;  1LKM A;  3IQ1 A;  1O9I A;  2V2I A;  1XZ1 A;  5GN8 B;  2WTL A;  2YW7 A;  3AF8 X;  1JKV A;  4TOH A;  2YJJ A;  2RBD A;  4KVR A;  1NNQ A;  1JRE A; 
#chains in the Genus database with same CATH topology
 2CHP A;  2WLA A;  2ZUR X;  2V2P A;  1VJX A;  4TO9 A;  5D8O A;  3AK8 A;  2ITB A;  3F32 A;  5JKL G;  1JI5 A;  1KRQ A;  2C2J A;  2YJK A;  3UOF A;  4PGI A;  1IES A;  4LPM A;  4LQH A;  1RCE A;  3SHX A;  3PWQ A;  4LQJ A;  1JYB A;  3R2K A;  4TOG A;  3ES3 A;  5FFB A;  2XGW A;  4RC7 A;  5JKL A;  4CYA A;  3O7R A;  2V2R A;  1QYB A;  3TA8 A;  1MFR A;  5D8Y A;  5AXS A;  3VV9 A;  3RBC A;  5ERJ A;  3SID A;  1Z6O A;  2D5K A;  2ZA7 A;  4MY7 A;  2G4H A;  4TOC A;  5JDO B;  5CZU A;  2WLU A;  5LG2 A;  1O9R A;  3R2M A;  2GS4 A;  3E1O A;  2Z5R A;  1JI4 A;  1TJO A;  3FVB A;  2VZB A;  2FJC A;  4RC5 B;  1N1Q A;  3GGY A;  5J9V A;  5GN8 A;  4CMY A;  3RAV A;  1Z6O M;  5E2D A;  5HJH A;  1J30 A;  4ISM A;  3UNO A;  3E6R A;  1DAT A;  4E6K A;  5FFA A;  2CN6 A;  4YXJ A;  3O7S A;  2VXI A;  2CWL A;  4AM2 A;  4IWJ A;  3F39 A;  4YVZ A;  3Q4O A;  2IU2 A;  5J8S A;  2AR0 A;  2OC5 A;  2XKQ A;  3WVU A;  1YUX A;  4RC7 B;  3Q4N A;  4LQN A;  2CIH A;  2FHA A;  5J8W A;  3KHK A;  2VXX A;  1LB3 A;  3KA9 A;  3UOI A;  2PYB A;  4TOB A;  5D8Q A;  1TKO A;  5JKM G;  5CMQ A;  3QHC A;  1L8H A;  3H7G A;  4OYN A;  3A68 A;  1XZ3 A;  4ERU A;  3FSE A;  4XKU A;  2OKC A;  3IS7 A;  4ZL5 A;  3KX9 A;  4CYB A;  2XJO A;  4ITT A;  4CVP A;  4DI0 A;  2FFX J;  5JKM A;  3U90 A;  2CF7 A;  1JTS A;  5FFC A;  4ZTT A;  4KXR B;  2X17 0;  2C2U A;  4DYY A;  2XJM A;  3F38 A;  3KA6 A;  1S3Q A;  1YUZ A;  2Y3Q A;  2XJN A;  5FFD A;  3PWF A;  4RC5 A;  3E1P A;  2CLB A;  2OH3 A;  1SQ3 A;  4DE6 A;  3BKN A;  1TKP A;  4TOF A;  4CMY V;  2FKZ A;  4ISP A;  3QHB A;  3RE7 A;  1UVH A;  3R2L A;  4CVR A;  3E2C A;  3PW1 A;  1RCG A;  3KDQ A;  3PW8 C;  3A9Q A;  2YW6 A;  1RCI A;  1TK6 A;  2W0O A;  4KVQ A;  3DBY A;  3PVT A;  4XKT A;  3NP2 X;  5ERK A;  4DZ0 A;  1SOF A;  3FRR A;  3Q4R A;  4A25 A;  4ITW A;  3E1L A;  1B71 A;  4YKH A;  2ZG9 X;  3PZA A;  3SE1 A;  1OTK A;  1NF6 A;  5IX6 A;  4MJY A;  3NP0 X;  3KXU A;  2N02 A;  4ML5 A;  3IS8 A;  3PVY B;  1QGH A;  3BT5 A;  4MUD A;  4M33 A;  1DVB A;  3AK9 A;  1S2Z A;  2IY4 A;  2FG8 A;  3C1Y A;  4TOD A;  4AM5 A;  2ZA6 A;  2V8T A;  2ZG8 X;  3E1M A;  4MKU A;  3HIU A;  3NOZ X;  3PVR A;  5D8R A;  5FEJ A;  1NFV A;  3M6J A;  1JKU A;  1F30 A;  2ZA8 A;  2WWX B;  2FZF A;  2JD8 0;  5C6F A;  4LYU A;  1DPS A;  2V2M A;  3E1N A;  1BCF A;  2V2J A;  3T9J A;  2HR5 A;  5I4J A;  3AF9 X;  4P18 A;  1RCD A;  3V3K B;  3PW1 B;  1LKO A;  4XKS A;  4ZL6 A;  5LG8 A;  3E6S A;  5E1U A;  1GWG A;  3PVT B;  2UX1 A;  3RGD A;  1YV1 A;  3R2S A;  5GU1 X;  2V8U A;  5HU6 D;  3E1J A;  4DYX A;  2G38 B;  1IER A;  1RCC A;  4II4 B;  2JD7 0;  3Q4Q A;  1BFR A;  2CHI A;  3HL1 A;  1R03 A;  3FI6 A;  3AJQ A;  5CMR A;  4X0J A;  1Z4A A;  2BJY A;  5JAC A;  2V15 A;  2F7N A;  1S30 A;  3EGM A;  3F35 A;  4W4L B;  3PVR B;  4EVB A;  2JD6 0;  5GU3 X;  3GHQ A;  4Z5S A;  1JGC A;  3PVY A;  1RYT A;  2QQY A;  1UMN A;  3GVY A;  3BVK A;  4QUW A;  2Z6M A;  4ZKH A;  4Z3B A;  2FG4 A;  3QVD A;  4IWK A;  4MXP A;  2BK6 A;  2IB0 A;  3C1Z A;  3F33 A;  2MGY A;  3QD8 A;  3N6O A;  3PWQ C;  2FL0 A;  3LKD A;  3OGH A;  1NF4 A;  5J93 A;  1VEI A;  2CN7 A;  3W54 A;  2CEI A;  2BW1 A;  1MOJ A;  3GE4 A;  3ISF A;  4DYU A;  2Y44 A;  3BVF A;  3RD0 A;  1F33 A;  3JZA B;  3R2R A;  3BVE A;  5D8P A;  4R42 A;  4TOE A;  4YXM A;  4LYX A;  4RC6 A;  4E40 A;  2C2F A;  1VEQ A;  3F37 A;  3R2H A;  4DAS A;  4PG0 A;  2QF9 A;  4REU A;  3SH6 A;  3KA3 A;  1LKP A;  3UFB A;  3EZ0 A;  3MPS A;  4CVS A;  5GOU A;  3ISE A;  4II4 A;  2GYQ A;  3ERZ A;  4AM4 A;  4XGS A;  1ZS3 A;  4TOA A;  4LPJ A;  4ZLW A;  3AF7 X;  4RC8 A;  4IXK A;  5LS9 A;  4EVD A;  5GU2 X;  3AJP A;  4M35 A;  3F36 A;  1H96 A;  3PW8 A;  5D8X A;  3WNW A;  4ZKX A;  3OJ5 A;  4KVS A;  3VVA A;  4ZKW A;  4LPN A;  4DYZ A;  2Z5P A;  4WJG 4;  3L0M A;  4PG1 A;  4Y08 A;  1BG7 A;  2Z90 A;  4EVC A;  5HJF A;  3D19 A;  4RC6 B;  3AJO A;  3WVW A;  4CVT A;  4EVE A;  5K52 A;  4U3G A;  2C6R A;  2GYD A;  4MN9 A;  4TW3 A;  3C21 A;  5D8S A;  2V2O A;  5FFE A;  2Z5Q A;  3JZ9 A;  3KA4 A;  4W4K B;  4ZJK A;  2BKC A;  5GU0 X;  1ZUJ A;  4PGK A;  3C23 A;  2ZG7 X;  3BVI A;  3E1Q A;  3VNX A;  4M32 A;  5LBH A;  4ZMC A;  3F34 A;  4M34 A;  4LQV A;  1JIG A;  2V2S A;  2V2N A;  2V2L A;  3QZ3 A;  3FRS A;  1AEW A;  3GGZ A;  3R2O A;  3KA8 A;  2C41 A;  3QB9 A;  1EUM A;  1FHA A;  4ETR A;  3BVL A;  4CY9 A;  3KWO A;  5HQO A;  2HTN A;  3EZU A;  1VLG A;  1VEL A;  1L8I A;  3WVV A;  1HRS A;  2CLU A;  5K53 A;  1LKM A;  3IQ1 A;  1O9I A;  2V2I A;  1XZ1 A;  5GN8 B;  2WTL A;  2YW7 A;  5JDO A;  3AF8 X;  1JKV A;  4TOH A;  2YJJ A;  2RBD A;  4KVR A;  1NNQ A;  1JRE A; 
#chains in the Genus database with same CATH homology
 2CHP A;  2WLA A;  2ZUR X;  2V2P A;  1VJX A;  4TO9 A;  5D8O A;  3AK8 A;  2ITB A;  3F32 A;  5JKL G;  1JI5 A;  1KRQ A;  2C2J A;  2YJK A;  3UOF A;  4PGI A;  1IES A;  4LPM A;  4LQH A;  1RCE A;  3SHX A;  3PWQ A;  4LQJ A;  1JYB A;  3R2K A;  4TOG A;  3ES3 A;  5FFB A;  2XGW A;  4RC7 A;  5JKL A;  4CYA A;  3O7R A;  2V2R A;  1QYB A;  3TA8 A;  1MFR A;  5D8Y A;  5AXS A;  3VV9 A;  3RBC A;  5ERJ A;  3SID A;  1Z6O A;  2D5K A;  2ZA7 A;  4MY7 A;  2G4H A;  4TOC A;  5JDO B;  5CZU A;  2WLU A;  5LG2 A;  1O9R A;  3R2M A;  2GS4 A;  3E1O A;  2Z5R A;  1JI4 A;  1TJO A;  3FVB A;  2VZB A;  2FJC A;  4RC5 B;  1N1Q A;  3GGY A;  5J9V A;  5GN8 A;  4CMY A;  3RAV A;  1Z6O M;  5E2D A;  5HJH A;  1J30 A;  4ISM A;  3UNO A;  3E6R A;  1DAT A;  4E6K A;  5FFA A;  2CN6 A;  4YXJ A;  3O7S A;  2VXI A;  2CWL A;  4AM2 A;  4IWJ A;  3F39 A;  4YVZ A;  3Q4O A;  2IU2 A;  5J8S A;  2AR0 A;  2OC5 A;  2XKQ A;  3WVU A;  1YUX A;  4RC7 B;  3Q4N A;  4LQN A;  2CIH A;  2FHA A;  5J8W A;  3KHK A;  2VXX A;  1LB3 A;  3KA9 A;  3UOI A;  2PYB A;  4TOB A;  5D8Q A;  1TKO A;  5JKM G;  5CMQ A;  3QHC A;  1L8H A;  3H7G A;  4OYN A;  3A68 A;  1XZ3 A;  4ERU A;  3FSE A;  4XKU A;  2OKC A;  3IS7 A;  4ZL5 A;  3KX9 A;  4CYB A;  2XJO A;  4ITT A;  4CVP A;  4DI0 A;  2FFX J;  5JKM A;  3U90 A;  2CF7 A;  1JTS A;  5FFC A;  4ZTT A;  4KXR B;  2X17 0;  2C2U A;  4DYY A;  2XJM A;  3F38 A;  3KA6 A;  1S3Q A;  1YUZ A;  2Y3Q A;  2XJN A;  5FFD A;  3PWF A;  4RC5 A;  3E1P A;  2CLB A;  2OH3 A;  1SQ3 A;  4DE6 A;  3BKN A;  1TKP A;  4TOF A;  4CMY V;  2FKZ A;  4ISP A;  3QHB A;  3RE7 A;  1UVH A;  3R2L A;  4CVR A;  3E2C A;  3PW1 A;  1RCG A;  3KDQ A;  3PW8 C;  3A9Q A;  2YW6 A;  1RCI A;  1TK6 A;  2W0O A;  4KVQ A;  3DBY A;  3PVT A;  4XKT A;  3NP2 X;  5ERK A;  4DZ0 A;  1SOF A;  3FRR A;  3Q4R A;  4A25 A;  4ITW A;  3E1L A;  1B71 A;  4YKH A;  2ZG9 X;  3PZA A;  3SE1 A;  1OTK A;  1NF6 A;  5IX6 A;  4MJY A;  3NP0 X;  3KXU A;  2N02 A;  4ML5 A;  3IS8 A;  3PVY B;  1QGH A;  3BT5 A;  4MUD A;  4M33 A;  1DVB A;  3AK9 A;  1S2Z A;  2IY4 A;  2FG8 A;  3C1Y A;  4TOD A;  4AM5 A;  2ZA6 A;  2V8T A;  2ZG8 X;  3E1M A;  4MKU A;  3HIU A;  3NOZ X;  3PVR A;  5D8R A;  5FEJ A;  1NFV A;  3M6J A;  1JKU A;  1F30 A;  2ZA8 A;  2WWX B;  2FZF A;  2JD8 0;  5C6F A;  4LYU A;  1DPS A;  2V2M A;  3E1N A;  1BCF A;  2V2J A;  3T9J A;  2HR5 A;  5I4J A;  3AF9 X;  4P18 A;  1RCD A;  3V3K B;  3PW1 B;  1LKO A;  4XKS A;  4ZL6 A;  5LG8 A;  3E6S A;  5E1U A;  1GWG A;  3PVT B;  2UX1 A;  3RGD A;  1YV1 A;  3R2S A;  5GU1 X;  2V8U A;  5HU6 D;  3E1J A;  4DYX A;  2G38 B;  1IER A;  1RCC A;  4II4 B;  2JD7 0;  3Q4Q A;  1BFR A;  2CHI A;  3HL1 A;  1R03 A;  3FI6 A;  3AJQ A;  5CMR A;  4X0J A;  1Z4A A;  2BJY A;  5JAC A;  2V15 A;  2F7N A;  1S30 A;  3EGM A;  3F35 A;  4W4L B;  3PVR B;  4EVB A;  2JD6 0;  5GU3 X;  3GHQ A;  4Z5S A;  1JGC A;  3PVY A;  1RYT A;  2QQY A;  1UMN A;  3GVY A;  3BVK A;  4QUW A;  2Z6M A;  4ZKH A;  4Z3B A;  2FG4 A;  3QVD A;  4IWK A;  4MXP A;  2BK6 A;  2IB0 A;  3C1Z A;  3F33 A;  2MGY A;  3QD8 A;  3N6O A;  3PWQ C;  2FL0 A;  3LKD A;  3OGH A;  1NF4 A;  5J93 A;  1VEI A;  2CN7 A;  3W54 A;  2CEI A;  2BW1 A;  1MOJ A;  3GE4 A;  3ISF A;  4DYU A;  2Y44 A;  3BVF A;  3RD0 A;  1F33 A;  3JZA B;  3R2R A;  3BVE A;  5D8P A;  4R42 A;  4TOE A;  4YXM A;  4LYX A;  4RC6 A;  4E40 A;  2C2F A;  1VEQ A;  3F37 A;  3R2H A;  4DAS A;  4PG0 A;  2QF9 A;  4REU A;  3SH6 A;  3KA3 A;  1LKP A;  3UFB A;  3EZ0 A;  3MPS A;  4CVS A;  5GOU A;  3ISE A;  4II4 A;  2GYQ A;  3ERZ A;  4AM4 A;  4XGS A;  1ZS3 A;  4TOA A;  4LPJ A;  4ZLW A;  3AF7 X;  4RC8 A;  4IXK A;  5LS9 A;  4EVD A;  5GU2 X;  3AJP A;  4M35 A;  3F36 A;  1H96 A;  3PW8 A;  5D8X A;  3WNW A;  4ZKX A;  3OJ5 A;  4KVS A;  3VVA A;  4ZKW A;  4LPN A;  4DYZ A;  2Z5P A;  4WJG 4;  3L0M A;  4PG1 A;  4Y08 A;  1BG7 A;  2Z90 A;  4EVC A;  5HJF A;  3D19 A;  4RC6 B;  3AJO A;  3WVW A;  4CVT A;  4EVE A;  5K52 A;  4U3G A;  2C6R A;  2GYD A;  4MN9 A;  4TW3 A;  3C21 A;  5D8S A;  2V2O A;  5FFE A;  2Z5Q A;  3JZ9 A;  3KA4 A;  4W4K B;  4ZJK A;  2BKC A;  5GU0 X;  1ZUJ A;  4PGK A;  3C23 A;  2ZG7 X;  3BVI A;  3E1Q A;  3VNX A;  4M32 A;  5LBH A;  4ZMC A;  3F34 A;  4M34 A;  4LQV A;  1JIG A;  2V2S A;  2V2N A;  2V2L A;  3QZ3 A;  3FRS A;  1AEW A;  3GGZ A;  3R2O A;  3KA8 A;  2C41 A;  3QB9 A;  1EUM A;  1FHA A;  4ETR A;  3BVL A;  4CY9 A;  3KWO A;  5HQO A;  2HTN A;  3EZU A;  1VLG A;  1VEL A;  1L8I A;  3WVV A;  1HRS A;  2CLU A;  5K53 A;  1LKM A;  3IQ1 A;  1O9I A;  2V2I A;  1XZ1 A;  5GN8 B;  2WTL A;  2YW7 A;  5JDO A;  3AF8 X;  1JKV A;  4TOH A;  2YJJ A;  2RBD A;  4KVR A;  1NNQ A;  1JRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...