4DZ0A

Crystal structure of the cu-adduct of human h-ferritin variant mic1 labeled with a dansyl fluorophore
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
172
structure length
172
Chain Sequence
TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSEYFDRDDVALKNFACYFHHQSHEEHEHAHKLMKLQEQRGGRIFLQDIQKADEDDWESGLNAMEAALHLEKNVNQSLLELHKLATDKNDPHLADFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferritin heavy chain
publication title Re-engineering protein interfaces yields copper-inducible ferritin cage assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 172
sequence length 172
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4dz0A00
2GYDA 5LBHA 3SE1A 2Z6MA 2Z90A 3EZUA 2C2UA 3UOFA 2IY4A 4ISPA 3PZAA 1DVBA 5GU3X 4MKUA 4U3GA 4ZTTA 5FFDA 5FFEA 3BKNA 4ETRA 1XZ1A 3H7GA 2CHIA 1AEWA 2ZURX 2XKQA 3AF9X 1JGCA 4CVSA 3R2RA 4ZMCA 2BJYA 3KA9A 2V15A 4AM4A 4ZLWA 2BW1A 2BKCA 4ZKWA 4ITTA 4MN9A 4DE6A 1JREA 2XGWA 1BFRA 4PG0A 3PW8A 1QGHA 3ISFA 1JKUA 2HTNA 2X170 3ISEA 2ZG9X 3KXUA 2CN7A 2FFXJ 2IB0A 3QB9A 3PVYA 2FG8A 4TOCA 2PYBA 4E6KA 1L8HA 3PWQA 4LYUA 4LQNA 3FVBA 4CMYV 4TOHA 2C6RA 1GWGA 3BVFA 2C2JA 1VEQA 4LPNA 5GN8A 2CLBA 1BG7A 4RC7B 3RAVA 4M33A 4DYYA 1JYBA 1R03A 1S3QA 2YW7A 3KWOA 3RBCA 4RC6A 1SQ3A 1UVHA 3R2LA 3GVYA 5HJHA 3BT5A 1LKPA 2F7NA 1RCCA 4AM5A 5FFBA 3E2CA 3E1PA 1YUXA 4LQHA 5J93A 1DPSA 2YW6A 5JKLA 1VEIA 3AF8X 4KVRA 4EVEA 3BVIA 4PG1A 3RGDA 1XZ3A 1JI4A 4LQJA 2V2JA 4ITWA 5JKMG 2XJNA 2BK6A 4II4B 2ZA7A 3QHBA 2QF9A 1LKMA 2CEIA 5D8RA 4ZKHA 5I4JA 3UNOA 4PGKA 3SH6A 1LB3A 1HRSA 1VLGA 3FI6A 4REUA 2ZA8A 3UOIA 3RE7A 2V2NA 3E1OA 4M34A 1EUMA 2V2SA 3PVRB 1F30A 3KA6A 2FHAA 2V2PA 3IS8A 5ERJA 2D5KA 2XJOA 3EZ0A 3EGMA 3KA8A 1JKVA 3R2SA 1MOJA 4II4A 4YKHA 3PVTB 1Z4AA 5K52A 3ERZA 4OYNA 3A68A 1NNQA 4RC5B 5JACA 3RD0A 2G4HA 5ERKA 5K53A 3Q4QA 1RCGA 1TJOA 1FHAA 4DYXA 3BVLA 3PW1B 3F36A 3WVUA 3E1NA 1KRQA 3AJOA 3T9JA 2OH3A 2UX1A 2XJMA 3PVRA 2IU2A 5E1UA 3OGHA 5LS9A 4IXKA 5FFAA 2V2LA 1BCFA 3O7RA 4MY7A 3WVWA 2ZG8X 4MUDA 1TKPA 4A25A 4DI0A 4Z5SA 3F34A 2ZG7X 3E6RA 3HIUA 1N1QA 3NP2X 3QVDA 4R42A 4ISMA 4DYZA 4TOAA 3A9QA 5IX6A 2WTLA 3TA8A 1ZUJA 2WLAA 4RC5A 2VXIA 2Z5QA 4ERUA 4XKSA 4IWJA 3Q4OA 1JTSA 5CZUA 2FJCA 5C6FA 4XKTA 3AJPA 2JD60 5CMQA 3IS7A 3F33A 2YJKA 4AM2A 5GU1X 1LKOA 2V2MA 4M32A 2CN6A 4ZKXA 5D8PA 2ITBA 1SOFA 4DZ0A 1IESA 1DATA 3O7SA 2QQYA 4DYUA 5J8WA 3QD8A 3F35A 5D8OA 3WVVA 4ZL6A 4RC7A 3PW8C 4EVBA 1RCIA 5D8XA 1O9RA 1JI5A 2V2RA 3GHQA 2ZA6A 3NOZX 5FFCA 1NFVA 4PGIA 1Z6OM 4Y08A 4CY9A 3R2KA 3SHXA 3Q4NA 4QUWA 4MJYA 3E1MA 3MPSA 5GU2X 3VNXA 2FG4A 1RCEA 1VJXA 2CIHA 4M35A 3F38A 3OJ5A 5JKMA 3R2OA 1TK6A 1TKOA 2JD80 1NF6A 3AK9A 3PVYB 3IQ1A 4EVCA 4P18A 1VELA 1MFRA 2Z5PA 1OTKA 4XKUA 2WLUA 3KA3A 1Z6OA 3AJQA 4ML5A 1IERA 4TOFA 2OC5A 4ZL5A 4LQVA 4TOGA 2Y3QA 3QZ3A 5GN8B 3NP0X 1JIGA 4CVPA 2C41A 2FL0A 4CYBA 2FKZA 2CHPA 3KA4A 3BVKA 5CMRA 4RC6B 5LG2A 2Z5RA 2JD70 4TOBA 4RC8A 4TOEA 1YUZA 2RBDA 3PVTA 4CVRA 2HR5A 3FSEA 3ES3A 4IWKA 2GS4A 1NF4A 5JKLG 1S30A 1YV1A 4TODA 4TO9A 5GOUA 3E1JA 5GU0X 4DASA 3PW1A 2C2FA 4LYXA 3E1LA 4CMYA 1QYBA 1RYTA 4Z3BA 2W0OA 2V2OA 2GYQA 1L8IA 3R2HA 2CLUA 3R2MA 4LPJA 4TW3A 5J8SA 3AF7X 3F32A 3HL1A 5E2DA 3WNWA 5J9VA 3F37A 4KVSA 4EVDA 4KVQA 5D8SA 1RCDA 1H96A 3SIDA 5LG8A 3E6SA 3E1QA 1O9IA 3PWFA 2V2IA 2VXXA 1J30A 4ZJKA 2CF7A 2VZBA 2FZFA 3BVEA 1B71A 2YJJA 5AXSA 4CVTA 3Q4RA 5HJFA 3PWQC 4LPMA 5FEJA 1S2ZA 3U90A 4XGSA 3QHCA 3KX9A 3GE4A 1F33A 4CYAA 5D8QA 1UMNA 1ZS3A 5HQOA 3AK8A 3F39A 5D8YA
chains in the Genus database with same CATH superfamily
2GYDA 5LBHA 3SE1A 2Z6MA 3FRRA 2Z90A 3EZUA 2C2UA 3UOFA 2IY4A 4ISPA 3PZAA 1DVBA 5GU3X 4MKUA 4U3GA 4ZTTA 5FFDA 5FFEA 3BKNA 4ETRA 1XZ1A 3H7GA 3JZAB 2CHIA 1AEWA 2ZURX 2XKQA 4KXRB 3AF9X 1JGCA 4CVSA 3R2RA 4ZMCA 2BJYA 3KA9A 3W54A 2V15A 4AM4A 4ZLWA 2BW1A 2N02A 2BKCA 4ZKWA 4ITTA 4MN9A 4DE6A 4W4KB 1JREA 2XGWA 1BFRA 4PG0A 3PW8A 1QGHA 3ISFA 1JKUA 2HTNA 2X170 3ISEA 2ZG9X 3KXUA 2CN7A 2FFXJ 2IB0A 3QB9A 3PVYA 2FG8A 4TOCA 2PYBA 4E6KA 1L8HA 3PWQA 4LYUA 4LQNA 3FVBA 3C21A 3DBYA 4CMYV 4TOHA 2C6RA 1GWGA 3BVFA 2C2JA 1VEQA 4LPNA 5GN8A 2CLBA 1BG7A 4RC7B 3RAVA 4M33A 4DYYA 1JYBA 1R03A 1S3QA 2YW7A 3KWOA 3RBCA 4RC6A 1SQ3A 1UVHA 3R2LA 3GVYA 3C1YA 5HJHA 3BT5A 1LKPA 2F7NA 1RCCA 4AM5A 5FFBA 3LKDA 3E2CA 3E1PA 1YUXA 4LQHA 5J93A 1DPSA 2YW6A 5JKLA 1VEIA 3AF8X 4KVRA 2Y44A 3BVIA 4PG1A 4EVEA 3RGDA 1XZ3A 1JI4A 4LQJA 4MXPA 2V2JA 4ITWA 5JKMG 2XJNA 2BK6A 4II4B 2ZA7A 3QHBA 2QF9A 1LKMA 2CEIA 5D8RA 4ZKHA 5I4JA 3UNOA 4PGKA 3SH6A 1LB3A 1HRSA 1VLGA 3FI6A 4REUA 2ZA8A 3GGZA 3UOIA 3RE7A 2V2NA 3D19A 3E1OA 1EUMA 4M34A 2V2SA 3PVRB 1F30A 3KA6A 2FHAA 2V8TA 2V2PA 3IS8A 5ERJA 2D5KA 2XJOA 3EZ0A 3EGMA 3JZ9A 3KA8A 1JKVA 3R2SA 1MOJA 3C1ZA 3N6OA 4II4A 4YKHA 2AR0A 3PVTB 1Z4AA 5K52A 3ERZA 4OYNA 3A68A 1NNQA 4RC5B 5JACA 3RD0A 2G4HA 4W4LB 5ERKA 5K53A 3Q4QA 1RCGA 1TJOA 1FHAA 4DYXA 3BVLA 3PW1B 3F36A 3WVUA 3E1NA 1KRQA 3AJOA 3T9JA 2OH3A 3VV9A 2UX1A 4YXMA 2XJMA 3PVRA 2IU2A 5E1UA 3OGHA 5LS9A 4IXKA 5FFAA 2V2LA 1BCFA 3O7RA 4MY7A 3WVWA 2ZG8X 4MUDA 1TKPA 4A25A 4DI0A 4Z5SA 3F34A 3KDQA 2CWLA 2ZG7X 3E6RA 3HIUA 3NP2X 1N1QA 2WWXB 3QVDA 4R42A 4ISMA 4DYZA 4TOAA 3A9QA 5IX6A 2WTLA 3TA8A 1ZUJA 2OKCA 2WLAA 4RC5A 2VXIA 2Z5QA 3L0MA 4ERUA 4XKSA 4IWJA 3Q4OA 1JTSA 5CZUA 2FJCA 5C6FA 4XKTA 3AJPA 2JD60 5CMQA 3IS7A 3F33A 2YJKA 4AM2A 5GU1X 1LKOA 5JDOB 4WJG4 2V2MA 4M32A 2CN6A 4ZKXA 5D8PA 2ITBA 1SOFA 4DZ0A 1IESA 1DATA 3O7SA 2QQYA 3KHKA 4DYUA 5J8WA 3QD8A 3F35A 2MGYA 3VVAA 5D8OA 3WVVA 4ZL6A 4RC7A 3PW8C 4EVBA 1RCIA 5D8XA 1O9RA 1JI5A 2V2RA 3GHQA 2ZA6A 3NOZX 5FFCA 1NFVA 4PGIA 1Z6OM 4Y08A 4CY9A 3R2KA 3SHXA 3Q4NA 4QUWA 4MJYA 3E1MA 3MPSA 5GU2X 3VNXA 2FG4A 1RCEA 1VJXA 2CIHA 4M35A 3F38A 5JDOA 4YXJA 3OJ5A 5JKMA 3R2OA 1TK6A 1TKOA 2JD80 1NF6A 3AK9A 3PVYB 3IQ1A 4EVCA 4P18A 4YVZA 1VELA 1MFRA 2Z5PA 1OTKA 4XKUA 2WLUA 3KA3A 1Z6OA 3AJQA 4ML5A 1IERA 4TOFA 2OC5A 4ZL5A 4LQVA 4TOGA 2Y3QA 3QZ3A 5GN8B 3NP0X 1JIGA 4CVPA 2C41A 2FL0A 4CYBA 2FKZA 2CHPA 3KA4A 3BVKA 5CMRA 4RC6B 5LG2A 2Z5RA 2JD70 4TOBA 4RC8A 4TOEA 1YUZA 2RBDA 3PVTA 4CVRA 2HR5A 2V8UA 3FSEA 3ES3A 4IWKA 2GS4A 1NF4A 3GGYA 5JKLG 1S30A 1YV1A 5HU6D 4TODA 4TO9A 5GOUA 3E1JA 5GU0X 4DASA 3PW1A 2C2FA 4LYXA 3E1LA 4CMYA 1QYBA 1RYTA 4Z3BA 2W0OA 2V2OA 2GYQA 1L8IA 3R2HA 2CLUA 3R2MA 4E40A 4LPJA 4TW3A 5J8SA 3AF7X 3F32A 3HL1A 5E2DA 3WNWA 5J9VA 3F37A 4KVSA 4EVDA 4KVQA 5D8SA 1RCDA 3FRSA 1H96A 3M6JA 3SIDA 3V3KB 5LG8A 3E6SA 3E1QA 1O9IA 3C23A 3PWFA 3UFBA 2V2IA 2VXXA 1J30A 4ZJKA 2CF7A 2G38B 2VZBA 2FZFA 3BVEA 1B71A 2YJJA 5AXSA 4CVTA 3Q4RA 5HJFA 3PWQC 4LPMA 5FEJA 1S2ZA 3U90A 4XGSA 3QHCA 3KX9A 3GE4A 1F33A 4CYAA 5D8QA 1UMNA 1ZS3A 5HQOA 3AK8A 4X0JA 3F39A 5D8YA
chains in the Genus database with same CATH topology
2GYDA 5LBHA 3SE1A 2Z6MA 3FRRA 2Z90A 3EZUA 2C2UA 3UOFA 2IY4A 4ISPA 3PZAA 1DVBA 5GU3X 4MKUA 4U3GA 4ZTTA 5FFDA 5FFEA 3BKNA 4ETRA 1XZ1A 3H7GA 3JZAB 2CHIA 1AEWA 2ZURX 2XKQA 4KXRB 3AF9X 1JGCA 4CVSA 3R2RA 4ZMCA 2BJYA 3KA9A 3W54A 2V15A 4AM4A 4ZLWA 2BW1A 2N02A 2BKCA 4ZKWA 4ITTA 4MN9A 4DE6A 4W4KB 1JREA 2XGWA 1BFRA 4PG0A 3PW8A 1QGHA 3ISFA 1JKUA 2HTNA 2X170 3ISEA 2ZG9X 3KXUA 2CN7A 2FFXJ 2IB0A 3QB9A 3PVYA 2FG8A 4TOCA 2PYBA 4E6KA 1L8HA 3PWQA 4LYUA 4LQNA 3FVBA 3C21A 3DBYA 4CMYV 4TOHA 2C6RA 1GWGA 3BVFA 2C2JA 1VEQA 4LPNA 5GN8A 2CLBA 1BG7A 4RC7B 3RAVA 4M33A 4DYYA 1JYBA 1R03A 1S3QA 2YW7A 3KWOA 3RBCA 4RC6A 1SQ3A 1UVHA 3R2LA 3GVYA 3C1YA 5HJHA 3BT5A 1LKPA 2F7NA 1RCCA 4AM5A 5FFBA 3LKDA 3E2CA 3E1PA 1YUXA 4LQHA 5J93A 1DPSA 2YW6A 5JKLA 1VEIA 3AF8X 4KVRA 2Y44A 3BVIA 4PG1A 4EVEA 3RGDA 1XZ3A 1JI4A 4LQJA 4MXPA 2V2JA 4ITWA 5JKMG 2XJNA 2BK6A 4II4B 2ZA7A 3QHBA 2QF9A 1LKMA 2CEIA 5D8RA 4ZKHA 5I4JA 3UNOA 4PGKA 3SH6A 1LB3A 1HRSA 1VLGA 3FI6A 4REUA 2ZA8A 3GGZA 3UOIA 3RE7A 2V2NA 3D19A 3E1OA 1EUMA 4M34A 2V2SA 3PVRB 1F30A 3KA6A 2FHAA 2V8TA 2V2PA 3IS8A 5ERJA 2D5KA 2XJOA 3EZ0A 3EGMA 3JZ9A 3KA8A 1JKVA 3R2SA 1MOJA 3C1ZA 3N6OA 4II4A 4YKHA 2AR0A 3PVTB 1Z4AA 5K52A 3ERZA 4OYNA 3A68A 1NNQA 4RC5B 5JACA 3RD0A 2G4HA 4W4LB 5ERKA 5K53A 3Q4QA 1RCGA 1TJOA 1FHAA 4DYXA 3BVLA 3PW1B 3F36A 3WVUA 3E1NA 1KRQA 3AJOA 3T9JA 2OH3A 3VV9A 2UX1A 4YXMA 2XJMA 3PVRA 2IU2A 5E1UA 3OGHA 5LS9A 4IXKA 5FFAA 2V2LA 1BCFA 3O7RA 4MY7A 3WVWA 2ZG8X 4MUDA 1TKPA 4A25A 4DI0A 4Z5SA 3F34A 3KDQA 2CWLA 2ZG7X 3E6RA 3HIUA 3NP2X 1N1QA 2WWXB 3QVDA 4R42A 4ISMA 4DYZA 4TOAA 3A9QA 5IX6A 2WTLA 3TA8A 1ZUJA 2OKCA 2WLAA 4RC5A 2VXIA 2Z5QA 3L0MA 4ERUA 4XKSA 4IWJA 3Q4OA 1JTSA 5CZUA 2FJCA 5C6FA 4XKTA 3AJPA 2JD60 5CMQA 3IS7A 3F33A 2YJKA 4AM2A 5GU1X 1LKOA 5JDOB 4WJG4 2V2MA 4M32A 2CN6A 4ZKXA 5D8PA 2ITBA 1SOFA 4DZ0A 1IESA 1DATA 3O7SA 2QQYA 3KHKA 4DYUA 5J8WA 3QD8A 3F35A 2MGYA 3VVAA 5D8OA 3WVVA 4ZL6A 4RC7A 3PW8C 4EVBA 1RCIA 5D8XA 1O9RA 1JI5A 2V2RA 3GHQA 2ZA6A 3NOZX 5FFCA 1NFVA 4PGIA 1Z6OM 4Y08A 4CY9A 3R2KA 3SHXA 3Q4NA 4QUWA 4MJYA 3E1MA 3MPSA 5GU2X 3VNXA 2FG4A 1RCEA 1VJXA 2CIHA 4M35A 3F38A 5JDOA 4YXJA 3OJ5A 5JKMA 3R2OA 1TK6A 1TKOA 2JD80 1NF6A 3AK9A 3PVYB 3IQ1A 4EVCA 4P18A 4YVZA 1VELA 1MFRA 2Z5PA 1OTKA 4XKUA 2WLUA 3KA3A 1Z6OA 3AJQA 4ML5A 1IERA 4TOFA 2OC5A 4ZL5A 4LQVA 4TOGA 2Y3QA 3QZ3A 5GN8B 3NP0X 1JIGA 4CVPA 2C41A 2FL0A 4CYBA 2FKZA 2CHPA 3KA4A 3BVKA 5CMRA 4RC6B 5LG2A 2Z5RA 2JD70 4TOBA 4RC8A 4TOEA 1YUZA 2RBDA 3PVTA 4CVRA 2HR5A 2V8UA 3FSEA 3ES3A 4IWKA 2GS4A 1NF4A 3GGYA 5JKLG 1S30A 1YV1A 5HU6D 4TODA 4TO9A 5GOUA 3E1JA 5GU0X 4DASA 3PW1A 2C2FA 4LYXA 3E1LA 4CMYA 1QYBA 1RYTA 4Z3BA 2W0OA 2V2OA 2GYQA 1L8IA 3R2HA 2CLUA 3R2MA 4E40A 4LPJA 4TW3A 5J8SA 3AF7X 3F32A 3HL1A 5E2DA 3WNWA 5J9VA 3F37A 4KVSA 4EVDA 4KVQA 5D8SA 1RCDA 3FRSA 1H96A 3M6JA 3SIDA 3V3KB 5LG8A 3E6SA 3E1QA 1O9IA 3C23A 3PWFA 3UFBA 2V2IA 2VXXA 1J30A 4ZJKA 2CF7A 2G38B 2VZBA 2FZFA 3BVEA 1B71A 2YJJA 5AXSA 4CVTA 3Q4RA 5HJFA 3PWQC 4LPMA 5FEJA 1S2ZA 3U90A 4XGSA 3QHCA 3KX9A 3GE4A 1F33A 4CYAA 5D8QA 1UMNA 1ZS3A 5HQOA 3AK8A 4X0JA 3F39A 5D8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GYD A;  5LBH A;  3SE1 A;  2Z6M A;  2Z90 A;  3EZU A;  2C2U A;  3UOF A;  2IY4 A;  4ISP A;  3PZA A;  1DVB A;  5GU3 X;  4MKU A;  4U3G A;  4ZTT A;  5FFD A;  5FFE A;  3BKN A;  4ETR A;  1XZ1 A;  3H7G A;  2CHI A;  1AEW A;  2ZUR X;  2XKQ A;  3AF9 X;  1JGC A;  4CVS A;  3R2R A;  4ZMC A;  2BJY A;  3KA9 A;  2V15 A;  4AM4 A;  4ZLW A;  2BW1 A;  2BKC A;  4ZKW A;  4ITT A;  4MN9 A;  4DE6 A;  1JRE A;  2XGW A;  1BFR A;  4PG0 A;  3PW8 A;  1QGH A;  3ISF A;  1JKU A;  2HTN A;  2X17 0;  3ISE A;  2ZG9 X;  3KXU A;  2CN7 A;  2FFX J;  2IB0 A;  3QB9 A;  3PVY A;  2FG8 A;  4TOC A;  2PYB A;  4E6K A;  1L8H A;  3PWQ A;  4LYU A;  4LQN A;  3FVB A;  4CMY V;  4TOH A;  2C6R A;  1GWG A;  3BVF A;  2C2J A;  1VEQ A;  4LPN A;  5GN8 A;  2CLB A;  1BG7 A;  4RC7 B;  3RAV A;  4M33 A;  4DYY A;  1JYB A;  1R03 A;  1S3Q A;  2YW7 A;  3KWO A;  3RBC A;  4RC6 A;  1SQ3 A;  1UVH A;  3R2L A;  3GVY A;  5HJH A;  3BT5 A;  1LKP A;  2F7N A;  1RCC A;  4AM5 A;  5FFB A;  3E2C A;  3E1P A;  1YUX A;  4LQH A;  5J93 A;  1DPS A;  2YW6 A;  5JKL A;  1VEI A;  3AF8 X;  4KVR A;  4EVE A;  3BVI A;  4PG1 A;  3RGD A;  1XZ3 A;  1JI4 A;  4LQJ A;  2V2J A;  4ITW A;  5JKM G;  2XJN A;  2BK6 A;  4II4 B;  2ZA7 A;  3QHB A;  2QF9 A;  1LKM A;  2CEI A;  5D8R A;  4ZKH A;  5I4J A;  3UNO A;  4PGK A;  3SH6 A;  1LB3 A;  1HRS A;  1VLG A;  3FI6 A;  4REU A;  2ZA8 A;  3UOI A;  3RE7 A;  2V2N A;  3E1O A;  4M34 A;  1EUM A;  2V2S A;  3PVR B;  1F30 A;  3KA6 A;  2FHA A;  2V2P A;  3IS8 A;  5ERJ A;  2D5K A;  2XJO A;  3EZ0 A;  3EGM A;  3KA8 A;  1JKV A;  3R2S A;  1MOJ A;  4II4 A;  4YKH A;  3PVT B;  1Z4A A;  5K52 A;  3ERZ A;  4OYN A;  3A68 A;  1NNQ A;  4RC5 B;  5JAC A;  3RD0 A;  2G4H A;  5ERK A;  5K53 A;  3Q4Q A;  1RCG A;  1TJO A;  1FHA A;  4DYX A;  3BVL A;  3PW1 B;  3F36 A;  3WVU A;  3E1N A;  1KRQ A;  3AJO A;  3T9J A;  2OH3 A;  2UX1 A;  2XJM A;  3PVR A;  2IU2 A;  5E1U A;  3OGH A;  5LS9 A;  4IXK A;  5FFA A;  2V2L A;  1BCF A;  3O7R A;  4MY7 A;  3WVW A;  2ZG8 X;  4MUD A;  1TKP A;  4A25 A;  4DI0 A;  4Z5S A;  3F34 A;  2ZG7 X;  3E6R A;  3HIU A;  1N1Q A;  3NP2 X;  3QVD A;  4R42 A;  4ISM A;  4DYZ A;  4TOA A;  3A9Q A;  5IX6 A;  2WTL A;  3TA8 A;  1ZUJ A;  2WLA A;  4RC5 A;  2VXI A;  2Z5Q A;  4ERU A;  4XKS A;  4IWJ A;  3Q4O A;  1JTS A;  5CZU A;  2FJC A;  5C6F A;  4XKT A;  3AJP A;  2JD6 0;  5CMQ A;  3IS7 A;  3F33 A;  2YJK A;  4AM2 A;  5GU1 X;  1LKO A;  2V2M A;  4M32 A;  2CN6 A;  4ZKX A;  5D8P A;  2ITB A;  1SOF A;  4DZ0 A;  1IES A;  1DAT A;  3O7S A;  2QQY A;  4DYU A;  5J8W A;  3QD8 A;  3F35 A;  5D8O A;  3WVV A;  4ZL6 A;  4RC7 A;  3PW8 C;  4EVB A;  1RCI A;  5D8X A;  1O9R A;  1JI5 A;  2V2R A;  3GHQ A;  2ZA6 A;  3NOZ X;  5FFC A;  1NFV A;  4PGI A;  1Z6O M;  4Y08 A;  4CY9 A;  3R2K A;  3SHX A;  3Q4N A;  4QUW A;  4MJY A;  3E1M A;  3MPS A;  5GU2 X;  3VNX A;  2FG4 A;  1RCE A;  1VJX A;  2CIH A;  4M35 A;  3F38 A;  3OJ5 A;  5JKM A;  3R2O A;  1TK6 A;  1TKO A;  2JD8 0;  1NF6 A;  3AK9 A;  3PVY B;  3IQ1 A;  4EVC A;  4P18 A;  1VEL A;  1MFR A;  2Z5P A;  1OTK A;  4XKU A;  2WLU A;  3KA3 A;  1Z6O A;  3AJQ A;  4ML5 A;  1IER A;  4TOF A;  2OC5 A;  4ZL5 A;  4LQV A;  4TOG A;  2Y3Q A;  3QZ3 A;  5GN8 B;  3NP0 X;  1JIG A;  4CVP A;  2C41 A;  2FL0 A;  4CYB A;  2FKZ A;  2CHP A;  3KA4 A;  3BVK A;  5CMR A;  4RC6 B;  5LG2 A;  2Z5R A;  2JD7 0;  4TOB A;  4RC8 A;  4TOE A;  1YUZ A;  2RBD A;  3PVT A;  4CVR A;  2HR5 A;  3FSE A;  3ES3 A;  4IWK A;  2GS4 A;  1NF4 A;  5JKL G;  1S30 A;  1YV1 A;  4TOD A;  4TO9 A;  5GOU A;  3E1J A;  5GU0 X;  4DAS A;  3PW1 A;  2C2F A;  4LYX A;  3E1L A;  4CMY A;  1QYB A;  1RYT A;  4Z3B A;  2W0O A;  2V2O A;  2GYQ A;  1L8I A;  3R2H A;  2CLU A;  3R2M A;  4LPJ A;  4TW3 A;  5J8S A;  3AF7 X;  3F32 A;  3HL1 A;  5E2D A;  3WNW A;  5J9V A;  3F37 A;  4KVS A;  4EVD A;  4KVQ A;  5D8S A;  1RCD A;  1H96 A;  3SID A;  5LG8 A;  3E6S A;  3E1Q A;  1O9I A;  3PWF A;  2V2I A;  2VXX A;  1J30 A;  4ZJK A;  2CF7 A;  2VZB A;  2FZF A;  3BVE A;  1B71 A;  2YJJ A;  5AXS A;  4CVT A;  3Q4R A;  5HJF A;  3PWQ C;  4LPM A;  5FEJ A;  1S2Z A;  3U90 A;  4XGS A;  3QHC A;  3KX9 A;  3GE4 A;  1F33 A;  4CYA A;  5D8Q A;  1UMN A;  1ZS3 A;  5HQO A;  3AK8 A;  3F39 A;  5D8Y A; 
#chains in the Genus database with same CATH topology
 2GYD A;  5LBH A;  3SE1 A;  2Z6M A;  3FRR A;  2Z90 A;  3EZU A;  2C2U A;  3UOF A;  2IY4 A;  4ISP A;  3PZA A;  1DVB A;  5GU3 X;  4MKU A;  4U3G A;  4ZTT A;  5FFD A;  5FFE A;  3BKN A;  4ETR A;  1XZ1 A;  3H7G A;  3JZA B;  2CHI A;  1AEW A;  2ZUR X;  2XKQ A;  4KXR B;  3AF9 X;  1JGC A;  4CVS A;  3R2R A;  4ZMC A;  2BJY A;  3KA9 A;  3W54 A;  2V15 A;  4AM4 A;  4ZLW A;  2BW1 A;  2N02 A;  2BKC A;  4ZKW A;  4ITT A;  4MN9 A;  4DE6 A;  4W4K B;  1JRE A;  2XGW A;  1BFR A;  4PG0 A;  3PW8 A;  1QGH A;  3ISF A;  1JKU A;  2HTN A;  2X17 0;  3ISE A;  2ZG9 X;  3KXU A;  2CN7 A;  2FFX J;  2IB0 A;  3QB9 A;  3PVY A;  2FG8 A;  4TOC A;  2PYB A;  4E6K A;  1L8H A;  3PWQ A;  4LYU A;  4LQN A;  3FVB A;  3C21 A;  3DBY A;  4CMY V;  4TOH A;  2C6R A;  1GWG A;  3BVF A;  2C2J A;  1VEQ A;  4LPN A;  5GN8 A;  2CLB A;  1BG7 A;  4RC7 B;  3RAV A;  4M33 A;  4DYY A;  1JYB A;  1R03 A;  1S3Q A;  2YW7 A;  3KWO A;  3RBC A;  4RC6 A;  1SQ3 A;  1UVH A;  3R2L A;  3GVY A;  3C1Y A;  5HJH A;  3BT5 A;  1LKP A;  2F7N A;  1RCC A;  4AM5 A;  5FFB A;  3LKD A;  3E2C A;  3E1P A;  1YUX A;  4LQH A;  5J93 A;  1DPS A;  2YW6 A;  5JKL A;  1VEI A;  3AF8 X;  4KVR A;  2Y44 A;  3BVI A;  4PG1 A;  4EVE A;  3RGD A;  1XZ3 A;  1JI4 A;  4LQJ A;  4MXP A;  2V2J A;  4ITW A;  5JKM G;  2XJN A;  2BK6 A;  4II4 B;  2ZA7 A;  3QHB A;  2QF9 A;  1LKM A;  2CEI A;  5D8R A;  4ZKH A;  5I4J A;  3UNO A;  4PGK A;  3SH6 A;  1LB3 A;  1HRS A;  1VLG A;  3FI6 A;  4REU A;  2ZA8 A;  3GGZ A;  3UOI A;  3RE7 A;  2V2N A;  3D19 A;  3E1O A;  1EUM A;  4M34 A;  2V2S A;  3PVR B;  1F30 A;  3KA6 A;  2FHA A;  2V8T A;  2V2P A;  3IS8 A;  5ERJ A;  2D5K A;  2XJO A;  3EZ0 A;  3EGM A;  3JZ9 A;  3KA8 A;  1JKV A;  3R2S A;  1MOJ A;  3C1Z A;  3N6O A;  4II4 A;  4YKH A;  2AR0 A;  3PVT B;  1Z4A A;  5K52 A;  3ERZ A;  4OYN A;  3A68 A;  1NNQ A;  4RC5 B;  5JAC A;  3RD0 A;  2G4H A;  4W4L B;  5ERK A;  5K53 A;  3Q4Q A;  1RCG A;  1TJO A;  1FHA A;  4DYX A;  3BVL A;  3PW1 B;  3F36 A;  3WVU A;  3E1N A;  1KRQ A;  3AJO A;  3T9J A;  2OH3 A;  3VV9 A;  2UX1 A;  4YXM A;  2XJM A;  3PVR A;  2IU2 A;  5E1U A;  3OGH A;  5LS9 A;  4IXK A;  5FFA A;  2V2L A;  1BCF A;  3O7R A;  4MY7 A;  3WVW A;  2ZG8 X;  4MUD A;  1TKP A;  4A25 A;  4DI0 A;  4Z5S A;  3F34 A;  3KDQ A;  2CWL A;  2ZG7 X;  3E6R A;  3HIU A;  3NP2 X;  1N1Q A;  2WWX B;  3QVD A;  4R42 A;  4ISM A;  4DYZ A;  4TOA A;  3A9Q A;  5IX6 A;  2WTL A;  3TA8 A;  1ZUJ A;  2OKC A;  2WLA A;  4RC5 A;  2VXI A;  2Z5Q A;  3L0M A;  4ERU A;  4XKS A;  4IWJ A;  3Q4O A;  1JTS A;  5CZU A;  2FJC A;  5C6F A;  4XKT A;  3AJP A;  2JD6 0;  5CMQ A;  3IS7 A;  3F33 A;  2YJK A;  4AM2 A;  5GU1 X;  1LKO A;  5JDO B;  4WJG 4;  2V2M A;  4M32 A;  2CN6 A;  4ZKX A;  5D8P A;  2ITB A;  1SOF A;  4DZ0 A;  1IES A;  1DAT A;  3O7S A;  2QQY A;  3KHK A;  4DYU A;  5J8W A;  3QD8 A;  3F35 A;  2MGY A;  3VVA A;  5D8O A;  3WVV A;  4ZL6 A;  4RC7 A;  3PW8 C;  4EVB A;  1RCI A;  5D8X A;  1O9R A;  1JI5 A;  2V2R A;  3GHQ A;  2ZA6 A;  3NOZ X;  5FFC A;  1NFV A;  4PGI A;  1Z6O M;  4Y08 A;  4CY9 A;  3R2K A;  3SHX A;  3Q4N A;  4QUW A;  4MJY A;  3E1M A;  3MPS A;  5GU2 X;  3VNX A;  2FG4 A;  1RCE A;  1VJX A;  2CIH A;  4M35 A;  3F38 A;  5JDO A;  4YXJ A;  3OJ5 A;  5JKM A;  3R2O A;  1TK6 A;  1TKO A;  2JD8 0;  1NF6 A;  3AK9 A;  3PVY B;  3IQ1 A;  4EVC A;  4P18 A;  4YVZ A;  1VEL A;  1MFR A;  2Z5P A;  1OTK A;  4XKU A;  2WLU A;  3KA3 A;  1Z6O A;  3AJQ A;  4ML5 A;  1IER A;  4TOF A;  2OC5 A;  4ZL5 A;  4LQV A;  4TOG A;  2Y3Q A;  3QZ3 A;  5GN8 B;  3NP0 X;  1JIG A;  4CVP A;  2C41 A;  2FL0 A;  4CYB A;  2FKZ A;  2CHP A;  3KA4 A;  3BVK A;  5CMR A;  4RC6 B;  5LG2 A;  2Z5R A;  2JD7 0;  4TOB A;  4RC8 A;  4TOE A;  1YUZ A;  2RBD A;  3PVT A;  4CVR A;  2HR5 A;  2V8U A;  3FSE A;  3ES3 A;  4IWK A;  2GS4 A;  1NF4 A;  3GGY A;  5JKL G;  1S30 A;  1YV1 A;  5HU6 D;  4TOD A;  4TO9 A;  5GOU A;  3E1J A;  5GU0 X;  4DAS A;  3PW1 A;  2C2F A;  4LYX A;  3E1L A;  4CMY A;  1QYB A;  1RYT A;  4Z3B A;  2W0O A;  2V2O A;  2GYQ A;  1L8I A;  3R2H A;  2CLU A;  3R2M A;  4E40 A;  4LPJ A;  4TW3 A;  5J8S A;  3AF7 X;  3F32 A;  3HL1 A;  5E2D A;  3WNW A;  5J9V A;  3F37 A;  4KVS A;  4EVD A;  4KVQ A;  5D8S A;  1RCD A;  3FRS A;  1H96 A;  3M6J A;  3SID A;  3V3K B;  5LG8 A;  3E6S A;  3E1Q A;  1O9I A;  3C23 A;  3PWF A;  3UFB A;  2V2I A;  2VXX A;  1J30 A;  4ZJK A;  2CF7 A;  2G38 B;  2VZB A;  2FZF A;  3BVE A;  1B71 A;  2YJJ A;  5AXS A;  4CVT A;  3Q4R A;  5HJF A;  3PWQ C;  4LPM A;  5FEJ A;  1S2Z A;  3U90 A;  4XGS A;  3QHC A;  3KX9 A;  3GE4 A;  1F33 A;  4CYA A;  5D8Q A;  1UMN A;  1ZS3 A;  5HQO A;  3AK8 A;  4X0J A;  3F39 A;  5D8Y A; 
#chains in the Genus database with same CATH homology
 2GYD A;  5LBH A;  3SE1 A;  2Z6M A;  3FRR A;  2Z90 A;  3EZU A;  2C2U A;  3UOF A;  2IY4 A;  4ISP A;  3PZA A;  1DVB A;  5GU3 X;  4MKU A;  4U3G A;  4ZTT A;  5FFD A;  5FFE A;  3BKN A;  4ETR A;  1XZ1 A;  3H7G A;  3JZA B;  2CHI A;  1AEW A;  2ZUR X;  2XKQ A;  4KXR B;  3AF9 X;  1JGC A;  4CVS A;  3R2R A;  4ZMC A;  2BJY A;  3KA9 A;  3W54 A;  2V15 A;  4AM4 A;  4ZLW A;  2BW1 A;  2N02 A;  2BKC A;  4ZKW A;  4ITT A;  4MN9 A;  4DE6 A;  4W4K B;  1JRE A;  2XGW A;  1BFR A;  4PG0 A;  3PW8 A;  1QGH A;  3ISF A;  1JKU A;  2HTN A;  2X17 0;  3ISE A;  2ZG9 X;  3KXU A;  2CN7 A;  2FFX J;  2IB0 A;  3QB9 A;  3PVY A;  2FG8 A;  4TOC A;  2PYB A;  4E6K A;  1L8H A;  3PWQ A;  4LYU A;  4LQN A;  3FVB A;  3C21 A;  3DBY A;  4CMY V;  4TOH A;  2C6R A;  1GWG A;  3BVF A;  2C2J A;  1VEQ A;  4LPN A;  5GN8 A;  2CLB A;  1BG7 A;  4RC7 B;  3RAV A;  4M33 A;  4DYY A;  1JYB A;  1R03 A;  1S3Q A;  2YW7 A;  3KWO A;  3RBC A;  4RC6 A;  1SQ3 A;  1UVH A;  3R2L A;  3GVY A;  3C1Y A;  5HJH A;  3BT5 A;  1LKP A;  2F7N A;  1RCC A;  4AM5 A;  5FFB A;  3LKD A;  3E2C A;  3E1P A;  1YUX A;  4LQH A;  5J93 A;  1DPS A;  2YW6 A;  5JKL A;  1VEI A;  3AF8 X;  4KVR A;  2Y44 A;  3BVI A;  4PG1 A;  4EVE A;  3RGD A;  1XZ3 A;  1JI4 A;  4LQJ A;  4MXP A;  2V2J A;  4ITW A;  5JKM G;  2XJN A;  2BK6 A;  4II4 B;  2ZA7 A;  3QHB A;  2QF9 A;  1LKM A;  2CEI A;  5D8R A;  4ZKH A;  5I4J A;  3UNO A;  4PGK A;  3SH6 A;  1LB3 A;  1HRS A;  1VLG A;  3FI6 A;  4REU A;  2ZA8 A;  3GGZ A;  3UOI A;  3RE7 A;  2V2N A;  3D19 A;  3E1O A;  1EUM A;  4M34 A;  2V2S A;  3PVR B;  1F30 A;  3KA6 A;  2FHA A;  2V8T A;  2V2P A;  3IS8 A;  5ERJ A;  2D5K A;  2XJO A;  3EZ0 A;  3EGM A;  3JZ9 A;  3KA8 A;  1JKV A;  3R2S A;  1MOJ A;  3C1Z A;  3N6O A;  4II4 A;  4YKH A;  2AR0 A;  3PVT B;  1Z4A A;  5K52 A;  3ERZ A;  4OYN A;  3A68 A;  1NNQ A;  4RC5 B;  5JAC A;  3RD0 A;  2G4H A;  4W4L B;  5ERK A;  5K53 A;  3Q4Q A;  1RCG A;  1TJO A;  1FHA A;  4DYX A;  3BVL A;  3PW1 B;  3F36 A;  3WVU A;  3E1N A;  1KRQ A;  3AJO A;  3T9J A;  2OH3 A;  3VV9 A;  2UX1 A;  4YXM A;  2XJM A;  3PVR A;  2IU2 A;  5E1U A;  3OGH A;  5LS9 A;  4IXK A;  5FFA A;  2V2L A;  1BCF A;  3O7R A;  4MY7 A;  3WVW A;  2ZG8 X;  4MUD A;  1TKP A;  4A25 A;  4DI0 A;  4Z5S A;  3F34 A;  3KDQ A;  2CWL A;  2ZG7 X;  3E6R A;  3HIU A;  3NP2 X;  1N1Q A;  2WWX B;  3QVD A;  4R42 A;  4ISM A;  4DYZ A;  4TOA A;  3A9Q A;  5IX6 A;  2WTL A;  3TA8 A;  1ZUJ A;  2OKC A;  2WLA A;  4RC5 A;  2VXI A;  2Z5Q A;  3L0M A;  4ERU A;  4XKS A;  4IWJ A;  3Q4O A;  1JTS A;  5CZU A;  2FJC A;  5C6F A;  4XKT A;  3AJP A;  2JD6 0;  5CMQ A;  3IS7 A;  3F33 A;  2YJK A;  4AM2 A;  5GU1 X;  1LKO A;  5JDO B;  4WJG 4;  2V2M A;  4M32 A;  2CN6 A;  4ZKX A;  5D8P A;  2ITB A;  1SOF A;  4DZ0 A;  1IES A;  1DAT A;  3O7S A;  2QQY A;  3KHK A;  4DYU A;  5J8W A;  3QD8 A;  3F35 A;  2MGY A;  3VVA A;  5D8O A;  3WVV A;  4ZL6 A;  4RC7 A;  3PW8 C;  4EVB A;  1RCI A;  5D8X A;  1O9R A;  1JI5 A;  2V2R A;  3GHQ A;  2ZA6 A;  3NOZ X;  5FFC A;  1NFV A;  4PGI A;  1Z6O M;  4Y08 A;  4CY9 A;  3R2K A;  3SHX A;  3Q4N A;  4QUW A;  4MJY A;  3E1M A;  3MPS A;  5GU2 X;  3VNX A;  2FG4 A;  1RCE A;  1VJX A;  2CIH A;  4M35 A;  3F38 A;  5JDO A;  4YXJ A;  3OJ5 A;  5JKM A;  3R2O A;  1TK6 A;  1TKO A;  2JD8 0;  1NF6 A;  3AK9 A;  3PVY B;  3IQ1 A;  4EVC A;  4P18 A;  4YVZ A;  1VEL A;  1MFR A;  2Z5P A;  1OTK A;  4XKU A;  2WLU A;  3KA3 A;  1Z6O A;  3AJQ A;  4ML5 A;  1IER A;  4TOF A;  2OC5 A;  4ZL5 A;  4LQV A;  4TOG A;  2Y3Q A;  3QZ3 A;  5GN8 B;  3NP0 X;  1JIG A;  4CVP A;  2C41 A;  2FL0 A;  4CYB A;  2FKZ A;  2CHP A;  3KA4 A;  3BVK A;  5CMR A;  4RC6 B;  5LG2 A;  2Z5R A;  2JD7 0;  4TOB A;  4RC8 A;  4TOE A;  1YUZ A;  2RBD A;  3PVT A;  4CVR A;  2HR5 A;  2V8U A;  3FSE A;  3ES3 A;  4IWK A;  2GS4 A;  1NF4 A;  3GGY A;  5JKL G;  1S30 A;  1YV1 A;  5HU6 D;  4TOD A;  4TO9 A;  5GOU A;  3E1J A;  5GU0 X;  4DAS A;  3PW1 A;  2C2F A;  4LYX A;  3E1L A;  4CMY A;  1QYB A;  1RYT A;  4Z3B A;  2W0O A;  2V2O A;  2GYQ A;  1L8I A;  3R2H A;  2CLU A;  3R2M A;  4E40 A;  4LPJ A;  4TW3 A;  5J8S A;  3AF7 X;  3F32 A;  3HL1 A;  5E2D A;  3WNW A;  5J9V A;  3F37 A;  4KVS A;  4EVD A;  4KVQ A;  5D8S A;  1RCD A;  3FRS A;  1H96 A;  3M6J A;  3SID A;  3V3K B;  5LG8 A;  3E6S A;  3E1Q A;  1O9I A;  3C23 A;  3PWF A;  3UFB A;  2V2I A;  2VXX A;  1J30 A;  4ZJK A;  2CF7 A;  2G38 B;  2VZB A;  2FZF A;  3BVE A;  1B71 A;  2YJJ A;  5AXS A;  4CVT A;  3Q4R A;  5HJF A;  3PWQ C;  4LPM A;  5FEJ A;  1S2Z A;  3U90 A;  4XGS A;  3QHC A;  3KX9 A;  3GE4 A;  1F33 A;  4CYA A;  5D8Q A;  1UMN A;  1ZS3 A;  5HQO A;  3AK8 A;  4X0J A;  3F39 A;  5D8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...